Vous êtes sur la page 1sur 256

REVUE

Rdc DE DROIT
CANONIQUE

In memoriam
Jean Bernhard
Coutume et interprtation
Questions dhistoire
Les divorcs remaris

STRASBOURG 2005 TOME 55/2


SOMMAIRE RDC 55/2 2005

Jean WERCKMEISTER, In memoriam Jean Bernhard ................................... 225


Laurent KONDRATUK, La lgret, le jazz et le droit canonique :
Hommage Edoardo Dieni ............................................................................... 241
Philippe MINAUD, Franois Morlot, un canoniste nous a quitts ..... 249
Coutume et interprtation

Marcel METZGER, La coutume comme modle pour


le nouveau droit liturgique ................................................................................ 251
Edoardo DIENI, Le tragique de linterprtation
dans le droit canonique ........................................................................................ 271
Emmanuel TAWIL, Linterprtation du droit canonique par
les autorits sculires ............................................................................................ 299
Questions dhistoire

Rmy LEBRUN, Lempchement du canon 1088 ............................................. 325


Henri HENAFF, Les conservateurs apostoliques daprs
le concile de Vienne ................................................................................................ 341
Jeanne-Marie Tuffry-Andrieu, Le synode docsain
du concile de Trente au code de 1917 .................................................... 355
Aram MARDIROSSIAN, Les prmices dune distinction
entre ordre et juridiction dans lglise armnienne
au 5e sicle :une thorie sans lendemain .............................................. 377
Mariage

Claire SENON-DUPLESSIS, Lglise catholique et les fidles


divorcs remaris : les huit thses du cardinal Ratzinger........ 393
Jean WERCKMEISTER, La grande diversit des comportements
matrimoniaux en Europe ..................................................................................... 423
Comptes rendus ....................................................................................................................... 431
Rsums, Summaries, Summarien ............................................................................. 471
Index du tome 55 ..................................................................................................................... 479
Table des matires du tome 55 ....................................................................................... 483

Prix du numro : 20
Abonnements : voir en page 2 de couverture
J EAN BERNHARD est dcd Marienthal (Alsace), le
PDLjOkJHGHTXDWUH-vingt-douze ans.
Personnalit exceptionnelle, il a marqu de sa forte
HPSUHLQWH WRXV FHX[ TXL ORQW UHQFRQWUp 1RXV YRXGULRQV
relater ici quelques pisodes de sa vie aux multiples facettes
ainsi que certaines de ses nombreuses activits, plus particu-
lirement dans le domaine du droit canonique : le profes-
seur, ORIILFLDOle fondateur de la Revue de droit canonique 1.

Jean Bernhard est n Ribeauvill le 14 avril 1914, dans


une famille de quatre enfants. Trois mois plus tard se
dclenchait la Grande GuerreTXLYLWVLQVWDXUHUXQUpJLPH
militaire particulirement svre en Alsace, allemande
depuis 1870, mais rHVWpHIUDQoDLVHGHFXU. Jean Bernhard
connut sa premire arrestation, en compagnie de ses deux
frres, dans les bras de sa mre.
Une fois la guerre termine, il fit ses tudes primaires et
secondaires Ribeauvill, sous rgime franais. Il entra au
grand sminaire de Strasbourg en 1933, suivit les cours de

1. Ce texte doit beaucoup au mmoire de matrise de droit cano-


nique de M. Bernard DRYE, Le chanoine Jean Bernhard, un canoniste conci-
liaire, Strasbourg, 2004, 98 pages dactylographies. M. Drye avait lon-
guement rencontr M. Bernhard, et de nombreuses indications biogra-
phiques proviennent de ces entretiens. La bibliographie qui suit est
extraite aussi de ce mmoire.
la Facult de thologie catholique, fut ordonn prtre le 17
juillet 1938 et nomm vicaire Obernai (Bas-Rhin).
Un an plus tard clatait la Seconde guerre mondiale. Le
jeune prtre fut mobilis comme lieutenant, puis promu
capitaine. Fait prisonnier ds le dbut des hostilits, il passa
SOXVGXQDQHQ7FKpFRVORYDTXLHjO2IODJ;9,,$HQFRP-
pagnie notamment du pre Yves Congar, de dix ans son
an, avec qui il organisa des confrences thologiques
OLQWpULHXUGXFDPSJUkFHjODLGHGHOD&URL[-Rouge.
Libr HQ WDQW TXAlsacien FHVW--dire citoyen alle-
mand, alors que le pre Congar, citoyen franais, resta pri-
VRQQLHU MXVTXHQ  , il reprit fin 1941 son poste de
vicaire Obernai. Mais iOpWDLWGXQFDUDFWqUHLQGRFLOH/RUV
GHV UpXQLRQV GH MHXQHV TXLO RUJDQLVDLW dans le cadre du
scoutisme ou des cercles bibliques, on coutait la radio
anglaise et on parlait franais, ce qui tait strictement
interdit. Un des jeunes scouts alla briser une vitre de la salle
o le Gauleiter donnait une confrence. /DEEp Jean Bern-
hard fut arrt en fvrier 1942 et condamn quinze mois
de travaux forcs par le Sondergericht (tribunal spcial) pour
convictions pro-franaises au dtriment du peuple alle-
mand . Il passa ces quinze mois Bruchsal, prs de Karls-
ruhe (Pays de Bade).
Relch le 13 mai 1943, il fut mis OpFDUW, ou ODEUL
par le vicaire gnral, Mgr Douvier, qui le nomma secrtaire
j OpYch de Strasbourg. Mgr Douvier dirigeait le diocse
HQ ODEVHQFH GH OpYrTXH, Mgr Ruch, rfugi Prigueux.
Mais il faut croire que, mme ce poste peu expos, ses
DFWLYLWpV IXUHQW MXJpHV VXEYHUVLYHV SXLVTXLO IXW DUUrWp XQH
quatrime fois VLORQFRPSWHVRQDUUHVWDWLRQFRPPHSHWLW
enfant), le 24 avril 1944, et renvoy GHODXWUHF{WpGX5KLQ,
au camp de Schelklingen dans le Wurtemberg, puis non
loin de l, Oggelshausen, petit village entre Ulm et
&RQVWDQFHjOHVWGHOD)RUrW-Noire 2.
Il fut libr le 3 mai 1945 par les troupes allies. En tant
qXRIILFLHU IUDQoDLV LO IXW FKDUJp GX PDLQWLHQ GH ORUGUH
dans la rgion. Il lui arrivait GpYRTXHU, avec rticence, les

2. Voir Ren EPP, L'Enfer sur terre : prtres et religieux d'Alsace interns
et dports par les nazis (1940-1945), Strasbourg, 2000, 335 p.
horreurs commises aussi bien par les troupes allemandes en
droute que par les troupes allies conqurantes.
Entre-temps, ses deux frUHV pWDLHQW PRUWV OXQ FRPPH
VROGDW DOOHPDQG LQFRUSRUp GH IRUFH ODXWUH GXQH maladie
mal soigne. ,OOXLUHVWDLWXQHVXU
Il rejoignit VRQ SRVWH GH VHFUpWDLUH j OpYch en sep-
tembre 1945, sous la houlette du nouvel vque, Mgr
Weber, lui-mme ancien officier, en qui il trouva un sou-
tien sans faille.
Gabriel Le Bras TXL HQVHLJQDLW j O,QVWLWXW GH GURLW
canonique de Strasbourg, OHQFRXUDJHa reprendre des
tudes de droit et de droit canonique. Sous sa direction, il
rdigea une thse de droit canonique sur La Notion de
sanatio in radice dans le droit moderne et contemporain (Stras-
bourg, 1948). En mme temps, il tudiait Paris le droit,
DYHF GHX[ GLSO{PHV GpWXGHV VSpFLDOLVpHV OXQ HQ KLVtoire
GXGURLWODXWUHHQGURLWDGPLQLVWUDWLI5RPHil suivit les
cours du Studium de la Rote tout en tant chapelain de
Saint-Louis-des-Franais, et se lia GDPLWLp DYHF OH FDUGLQDO
Jullien, doyen de la Rote.
En 1951, Strasbourg, il fonda la Revue de droit cano-
nique. Nous y reviendrons.
En 1952, J. Bernhard fut nomm vice-official, puis, en
RIILFLDOIRQFWLRQTXLODVVXUHUDMXVTXHQ1RXV\
reviendrons galement.
En 1958, il est FKDUJp GHQVHLJQHPHQW de droit cano-
nique la Facult de thologie catholique HWjO,QVWLWXWGH
droit canonique de Strasbourg. Il soutient en 1962 son doc-
torat GeWDW GH WKpRORJLH FRQVDFUp la Collection en II
livres 3, ce qui lui permet GREWHQLUXQSRVWHGH professeur.
En 1970, succdant son collgue et ami M. Ren Metz 4,
LO SUHQG OD GLUHFWLRQ GH O,QVWLWXt de droit canonique, TXLO
FRQVHUYHMXVTXjVDUHWUDLWHHQ
RHWLUpGHO8QLYHUVLWpil continue de se consacrer jORIIL-
cialit de Strasbourg et la RDC. Puis vient, en 1987, la
UHWUDLWH GH VRQ SRVWH GRIILFLDO TXLO DXUD RFFXSp SHQGDQW

3. Publi dans la RDC 12, 1962.


4. M. Ren Metz, n en 1910, est dcd en 2006, quelques mois
aprs M. Bernhard. Nous lui consacrerons une ncrologie dans le
prochain numro de la RDC.
plus de trente ans, sous trois vques successifs (Weber,
Elchinger, Brand). En 1994jOkJHGHTXDWUH-vingts ans, il
dcide de renoncer sa Revue, aprs quarante-quatre
annes de direction.
,OSDVVHOHVGHUQLqUHVDQQpHVGHVDYLHGDERUGGDQVODS-
partement TXLO ORXH j 6WUDVERXUJ DYHF 0PH -HUPDQQ VD
fidle collaboratrice j ORIILFLDOLWp HW j OD 5HYXH, puis dans
diverses maisons de retraite, la dernire en date tant la
Maison des prtres Marienthal, au nord de Strasbourg.
-XVTXDX GHUQLHU MRXU LO UHVWH intellectuellement et physi-
quement actifWRXMRXUVERXLOORQQDQWGLGpHVHWFXULHX[GH
tout.
Il meurt subitement au cours de la nuit du 4 mai 2006,
seul dans sa chambre, mais ayant au bout du fil Mme Jer-
PDQQTXLODappele au tlphone avec ses dernires forces.
Il est inhum Ribeauvill, sa ville natale.

-DLVXLYLOHVFRXUVGH0%HUQKDUGjOD)DFXOWpGHWKpR-
ORJLH HW j O,QVWLWXW GH GURLW FDQRQLTXH GH 6WUDVERXUJ j
partir de 1969. Contrairement plusieurs de ses collgues,
LOQDYDLt pas t traumatis par les vnements de Mai 68 et
Vefforait dDGDSWHU son enseignement j OHVSULW QRXYHDX
Renonant au cours magistral, il organisait des groupes de
discussion entre tudiants. Mais les temps postconciliaires
taient durs pour le droit canonique, accus de manquer
GHVSULW SDVWRUDO &HVW SRXUTXRL LO SUpIpUDLW SDUOHU GH
thologie canonique .
&HVW j O,QVWLWXW GH GURLW FDQRQLTXH, avec de petits
JURXSHVGpWXGLDQWV TXLOGRQQDit la pleine mesure de son
talent pdagogique. Incapable GHVHQWHQLUDXWH[WHGHVRQ
cours, pourtant soigneusement prpar, il se lanait volon-
tiers dans de longues digressions aussi savantes que passion-
QDQWHVVXUOHVVXMHWVTXLOXLWHQDLHQWjFXU. propos des
divorcs remaris, par exemple, il soulignait TXLO QH IDXW
SDVPHWWUHGHWUDLWGXQLRQHQWUHFHVGHX[PRWVSDUFHTXLO
QH[LVWHSDVGH catgorie divorc-remari GHPrPHTXLO
QH[LVWHSDV GH catgorie non-catholique (ou, pire, aca-
tholique ). Les protestants, les juifs, les musulmans, les
athes ne se dfinissent pas par leur non-catholicisme ; de
mme, disait-il, les chrtiens qui ont divorc et se sont
remaris ne se rduisent pas ces vnements de leur vie et
QHIRUPHQWSDVXQHFDWpJRULHGDQVOeJOLVH.
Comme en tmoigne sa bibliogUDSKLHVHVFHQWUHVGLQWp-
UrW SULQFLSDX[ pWDLHQW OKLVWRLUH GX GURLW FDQRQLTXH OD
Collection en II livres, le Concile de Trente) et le mariage.
Mais il avait des ides, souvent originales, sur toutes les
questions canoniques.
la suite du concile Vatican II, il fut nomm consulteur
de la Commission de rvision du Code de droit canonique,
dans la section consacre aux Normes gnrales. Il y prit
une SDUW DFWLYH ELHQ TXLO DLW WRXMRXUV UHJUHWWp GH QDYRLU
pas t membre de la section charge du droit matrimonial.
Il nous racontait les dbats en cours et nous demandait nos
avis. Le professeur, qui souhaitait des changements radi-
caux dans OH GURLW GH OeJOLVH partageait avec ses tudiants
ses dceptions et ses enthousiasmes, en cette poque
passionnante de ius condendum GH GURLW HQ FRXUV GpODbo-
ration.
partir de 1972, il organisa chaque anne, au mois de
mai, le Colloque de Strasbourg , srie de manifestations
scientifiques TXLQHVHVWSDVLQWHUURPSXHGHSXLVlors et qui
alimente les numros de la Revue de droit canonique.
8QHIRLVGLUHFWHXUGHO,QVWLWXWLORUJDQLVDXQV\VWqPHGH
FRXUV SDU VHVVLRQV TXL SHUPLW GpODUJLU et de transformer
considrablement le public en attirant des tudiants de tous
ges et de toute origine gographique. La craWLRQ GXQH
amicale des tudiants et anciens tudiants, qui se runissait
lors des colloques, lui permit de garder de nombreux liens,
en particulier avec son ami le chanoine Louis Menuz, offi-
FLDO G$QQHF\ HW SUpVLGHQW GH ODVVRFLDWLRQ, qui partageait
avec lui ses opinions novatrices 5. ,OVIDLVDLHQWSDUWLHOXQHW
ODXWUHGHODJpQpUDWLRQTXLDYDLWvcu OHFRQFLOHHWQDYDLHQW
SHXUGDXFXQHaudace.

5. Louis MENUZ, La dimension pastorale du droit matrimonial ,


RDC 36, 1986, p. 192-213.
1RXV ODYRQV GLW -HDQ %HUQKDUG IXW YLFH-official puis
official de Strasbourg pendant trente-cinq ans, de 1952
1987. Mais ces trente-cinq annes ne furent pas linaires.
Frais moulu du Studium de la Rote romaine, il com-
mena sa carrire judiciaire de faon classique, soucieux,
comme il tait de mise, de dfendre le mariage en
appliquant strictement la rgle de la faveur du droit. Les
dclarations de nullit taient rares GDQV OeJOLVH GH OpSR-
que et les personnes divorces remaries traites sans mis-
ricorde SXLVTXRQ OHXU UHIXVDLW PrPH OHV IXQpUDLOOHV FKUp-
tiennes.
De son propre aveu, son attitude se modifia au cours des
annes 1960 VRXV OLQIOXHQFH GX FRQFLOH PDLV VXUWRXW de
ses contacts avec les intresss. 3OXW{WTXHGHGpIHQGUHOLQV-
titution, il chercha comprendre les personnes.
&HWWH pYROXWLRQ QDYDLW VDQV GRXWH ULHQ GRULJLQDO : la
plupart des officialits firent de mme, des degrs divers.
La Rote romaine elle-mme, bien avant le nouveau Code,
ILWpYROXHUSURIRQGpPHQWVDMXULVSUXGHQFHHWODPLWLpTXLOH
liait plusieurs de ses doyens (Mgr Jullien, Mgr Lefebvre)
ne fut pas trangre sa nouvelle perception.
Ce qui fit ORULJLQDOLWp GH - %HUQKDUG HVW TXLO VHIIRUoD
de tirer MXVTXDX ERXW les consquences pratiques et tho-
riques de cette nouvelle conception, dite personnaliste .
,ODYDLWGpILQLWLYHPHQWDGPLVOLGpHTXHOH PDULDJHQHVWSDV
XQFRQWUDWPDLVXQHDOOLDQFH'qVORUVLOQHVDJLVVDLWSOXV
GpWXdier sa validit ou sa nullit, mais sa russite ou son
chec. Le mariage, disait-il, est comme une courbe qui
FRQQDvWGHVKDXWVHWGHVEDV/HVVHQWLHOHVWTXHODWHQGance
gnrale soit vers le haut. Un mariage qui, ds le dpart,
GHVFHQG LQpOXFWDEOHPHQW TXL VHIIRQGUH QHVW SDV VDFUD-
mentel.
En pratique, il se reprsentait ORIILFLDOLWp comme un
VHUYLFH GeJOLVH ddi rsoudre les problmes matrimo-
niaux des fidles. Plutt que de tribunal , il parlait de
commission . sentence de nullit , il prfrait les
expressions dcret de libert ou FRQVWDWGpWDWOLEUH , le
EXWpWDQWGHSHUPHWWUHXQUHPDULDJH GDQV OeJOLVH, lorsque
cela tait possible 6. Pour cela, il fallait faire mieux con-
QDvWUHORIILFLDOLWp,ORUJDQLVDGHJUDQGHVWRXUQpHVGDQVWRXV
les doyenns du diocse, allant expliquer aux curs dans
quelles conditions ils pouvaient lui adresser les personnes
concernes.
Il fit ainsi de StrasbouUJ OXQH GHV SOXV LPSRUWDQWHV RIIL-
FLDOLWpV GH )UDQFH %LHQ TXH QpWDQW SDV LQWHUGLRFpVDLQH
ORIILFLDOLWp GH 6WUDVERXUJ HXt connatre, dans les annes
1970 et 1980, prs GXQHFHQWDLQHGHFDXVHVSDUDQHQSUH-
mire instance, soit un tiers ou un quart de toutes les causes
traites en France. En outre, elle faisait elle fait toujours
office de seconde instance pour les causes de Metz.
$X FRXUV GHV GL[ GHUQLqUHV DQQpHV GDFWLYLWp GH - Ber-
QDUGHQWDQWTXRIILFLDO, de 1977 1986, on ne relve que
trois dcisions ngatives (non constare) contre 851 positives
(dclarations de nullit) 7. &HWWH SURSRUWLRQ VH[SOLTXH
GDERUG SDU OH WUL SUpDODEOH RSpUp SDU OHV FXUpV 0DLV DXVVL
SDUODWWLWXGHSDVWRUDOHGHORIILFLDO : quoi servirait, deman-
dait-il, de coincer canoniquement les gens dans un
PDULDJHTXLQexiste plus HWTXLQDSOXVDXFXQHFKDQFHGH
se reconstituer " 6LO H[LVWH XQH SRVVLELOLWp FDQRQLTXH GH
rsouGUHOHXUSUREOqPHSRXUTXRLQHSDVOXWLOLVHU ?
$YHFWRXWHOpTXLSHGHORIILFLDOLWp de Strasbourg et celle
GH 0HW] LQVWDQFH GDSSHO acquises ses conceptions,
lDFWLYLWpSUDWLTXHGH- Bernhard fut donc dbordante.
Il dveloppa en mme temps des thories nouvelles sur
le droit matrimonial. La plus connue de ces thories est
celle de la consommation existentielle et dans la foi 8. Ce
QHVW SDV OH OLHX GH Oexposer ici, ni les dbats et opposi-
tions TXHOOH VXVFLWD 5DSSHORQV simplement TXHOOH

6. Rorientation de la procdure en nullit de mariage , RDC 40,


1990, p. 179-200.
7. B. DRYE, loc. cit., p. 87.
8.  SURSRV GH OK\SRWKqVH FRQFHUQDQW OD QRWLRQ GH FRQsomma-
tion existentielle du mariage , RDC 20, 1970, p. 184-192 ; Rinter-
prtation (existentielle et dans la foi) de la lgislation canonique concer-
QDQWOLQGLVVROXELOLWpGXPDULDJHFKUpWLHQ , RDC 21, 1971, p. 243-278 ;
3HUVSHFWLYHV UHQRXYHOpHV VXU OK\SRWKqVH GH OD FRQsommation exis-
tentielle et dans la foi du mariage chrtien , RDC 24, 1974, p. 334-349.
consiste considrer le mariage dans son volution : le
mariageVHORQ-%HUQKDUGQHVWSDs consomm ds la nuit
de noces, LOQHVWSDVrendu parfait par un simple rapport
sexuel. Il se perfectionne peu peu, mesure que VpWDEOLW
la SURIRQGHFRPPXQDXWpGHYLHHWGDPRXU dont parle la
constitution conciliaire Gaudium et Spes. Et pour les poux
chrtiens, cette consommation ne doit pas se faire seule-
PHQW GDQV OH[LVWHQFH TXRWLGLHQQH PDLV DXVVL GDQV OD IRL
partage.
2U OH GURLW GH OeJOLVH affirme depuis longtemps que
OLQGLVVROXELOLWp QHVW SDV OLpH j Ochange des consente-
ments, mais la consommation ou la perfection du
PDULDJH 6L ORQ DGPHW TXLO IDXW GX WHPSV SRXU parfaire
son mariage, on doit considrer que OLQGLVVROXELOLWp
QDGYLHQWTXHSURJUHVVLYHPHQWHWTXHOOHne devient canoni-
quement absolue que ORUVTXH OXQion est consomme
existentiellement et dans la foi ; alors, en effet, les
GHX[SHUVRQQHV IRUPDQWOH FRXSOH QLPDJLQHQWPrPH SOXV
pouvoir vivre spares.
Autrement dit, Jean Bernhard prenait en compte deux
dimensions souvent oublies : le temps (le mariage QHVWSDV
instantan mais inchoatif) et la ralit (OXQLRQ vcue con-
crtement est plus importante que le lien juridique
abstrait).

Jean Bernhard a fond la Revue de droit canonique en


1951. On peine aujourd'hui imaginer comment ce jeune
SUrWUHHQFRUHpWXGLDQWVDQVSRVWHQLjOXQLYHUVLWpQi mme
dans le diocse (il devint vice-official un an plus tard),
russit lancer une telle entreprise. Il faut le souligner : la
Revue de droit canonique fut une revue prive, lance non par
une institution, mais par un particulier. Elle resta la
SURSULpWp GH VRQ IRQGDWHXU MXVTXHQ  DQQpH R il la
confia la Facult de thologie catholique.
La cration de la RDC profitait du vide laiss en France
par la disparition, depuis 1927, du Canoniste contemporain,
mais elle se heurta bientt DX ODQFHPHQW GXQH nouvelle
venue, O$QQpHFDQRQLTXH, fonde en 1952 Paris.
La concurrence entre les deux revues francophones ne
freina pas leur expansion. Deux lments pHUPHWWHQW GH[-
pliquer le succs du lancement de la RDC et sa prennit.
DXQHSDUW- BernKDUGVXWVHQWRXUHUGHcollaborateurs qui
DOODLHQW GHYHQLU RX TXL pWDLHQW GpMj SRXU QRPEUH GHQWUH
HX[pPLQHQWV4XRQHQMXJH OH SUHPLHUQXPpURVRXYUH
avec un article de Jean Gaudemet ( La doctrine des sources
du droit dans le Dcret de Gratien ) ; puis viennent les
signatures de Charles Lefebvre, avec un titre magnifique
( 'XQHWKpRULHGHOLPSUpYLVLRQHQGURLWFDQRQLTXH ), de
Gabriel Marie Garonne ( Position prsente du droit cano-
nique ), de Raoul Naz ( Le baptme dans les cliniques ),
etc.
/H VHFRQG pOpPHQW GH VXFFqV IXW OHVSULW GRXYHUWXUH GH
la Revue. Le Canoniste contemporain avait t fond en 1878
avec une position trs ultramontaine, dans le but avou de
diffuser les prescriptions romaines en France, la suite du
concile Vatican I. Le dernier article publi en 1927 par le
Canoniste contemporain tait consacr la question qui
SDUDvW DXMRXUGKXL bien futile des prsances dans le
clerg catholique.
Jean Bernhard voulut faire une revue trs diffrente, qui
ne ft pas le simple porte-parole des ides romaines, mais
une publication scientifiqueFHVW--dire critique et indpen-
dante. Le choix des articles devait tre pluridisciplinaire :
droit canonique, certes, mais aussi droit, histoire, sociolo-
gie, psychologie, thologie, FXPpQLVPH etc. En tmoi-
gnent, toujours dans le premier numro de 1951, les
contributions du docteur Maurice Porot sur La psycho-
chirurgie ou du docteur Paul Cossa sur les Fausses voca-
tions et vocations troubles .
Le jeune prtre tudiant alla voir Mgr Weber, et lui
expliqua son projet. Celui-ci lui conseilla, fort sagement, de
QH SDV GHPDQGHU Oimprimatur, pourtant obligatoire, ce qui
vitait jOpYrTXHGavoir le refuser et permettait la Revue
de garder toute sa libert. La solution, en 1951, tait coura-
geuseGDXWDQWTXHFRPPHQRXVODYRQVGLWDXFXQHLQVWL-
tution universitaire ou autre ne patronnait la publication.

*
Malgr les audaces de sa pense et de son action, Jean
%HUQKDUGQHFRQQXWJXqUHGennuis ecclsiastiques, protg
VDQVGRXWHSDUOHVSULWGXWHPSV(aprs le concile) et par ses
amitis haut places. Cependant, sur le tard il avait
quatre-vingt-trois ans HW OHVSULW GX WHPSV DYDLW chang il
IXW FRQYRTXp SDU OpYrTXH GH 6WUDVERXUJ charg par la
Congrgation de la doctrine de la foi de le sanctionner
pour un article publi dans Concilium 9. Cet article ne faisait
pourtant que reprendre des ides maintes fois exprimes
dans la RDC. Jean Bernhard en souffrit, mais aussi VHQ
amusait : On a fini par me lire Rome parce que
Concilium est traduit en italien . Il refusa de se rtracter :
-HQDLYXGDXWUHV mon ge, que voulez-YRXVTXils me
fassent ?
Une personnalit indocile, dcidment. Qui nous
manque.

Jean WERCKMEISTER

9. Della vita la legge. A proposito del diritto matrimoniale e della


relativa legislazione , Concilium 5/1995, p. 145-154.
La notion de Sanatio in radice dans le droit canonique moderne et
contemporain, thse de doctorat en droit canonique, Institut
de droit canonique, Universit de Strasbourg, 1948.
La Collection en II livres, thse de doctorat en thologie,
Facult de thologie catholique, Universit de Strasbourg,
1962, 601 pages dactylographies (= La collection en II
livres, Cod. Vat. Lat. 3832 , RDC 12, 1962).
/pSRTXH GH OD Rforme et du Concile de Trente (en collaboration
avec Charles LEFEBVRE et Francis RAPP ), Paris, Cujas,
1989, in +LVWRLUH GX 'URLW HW GHV ,QVWLWXWLRQV GH OeJOLVH HQ
Occident, sous la direction de Gabriel LE BRAS et Jean
GAUDEMET, tome 14.

La fcondation artificielle et le contrat de mariage , La


Nouvelle Revue Thologique, 1948, p. 846-853.
/HVFRQGLWLRQVGDSSOLFDWLRQGHOD sanatio in radice , La
Nouvelle Revue Thologique, 1950, p. 794-810.
La sanatio in radice et le consentement matrimonial dans le
droit canonique moderne (du concile de Trente au code
de droit canonique) , Ephemerides iuris canonici 6/2, 1950,
p. 3-17.
/H[SOLFDWLRQ MXULGLTXH GH OD UpWURDFWLYLWp GH OD sanatio in
radice dans la doctrine canonique moderne , Ephemerides
iuris canonici 7/1, 1951, p. 3-11.
La dclaration de nullit de mariage pour exclusion des
enfants GDSUqVOHVGpFLVLRQVGX7ULEXQDOGHOD5RWH YRO
XXXIII, anne 1941) , RDC 1, 1951, p. 94-107.
/H[communication du can. 2319 1 n 1 , RDC 1, 1951,
p. 195-201.
Le Directoire pour la pastorale des sacrements , RDC 1,
1951, p. 355-358.
Chronique des Actes du Saint-Sige : Acta Apostolicae Sedis,
1951, n 1-15 , RDC 1, 1951, p. 451-457.
La sanatio in radice et la lgitimation des enfants dans la
doctrine catholique moderne (du concile de Trente au
Code de droit canonique) , RDC 2, 1952, p. 30-56.
Chronique des Actes du Saint-Sige : Acta Apostolicae Sedis,
1951, n 16 - 1952, n 16 , RDC 1952, 2, p. 444-449.
Les problmes du temps daQV OKLVWRLUH GX GURLW FDQRQ ,
RDC 3, 1953, p.373-376.
Chronique des Actes du Saint-Sige : Acta Apostolicae Sedis,
1952, n 17-1953, n 14 , RDC 3, 1953, p. 425-434.
II sessiRQ GpWXGHV GH GURLW FDQRQLTXH Paris, 21-23 avril
1954 , RDC 4, 1954, p. 228-229.
/H SUHPLHU FHQWHQDLUH GH O8QLYHUVLWp GH 6DODPDQTXH ,
RDC 4, 1954, p. 361.
+LVWRLUHGXGURLWHWGHVLQVWLWXWLRQVGHOeJOLVHHQ2FFLGHQW,
publie sous la direction de Gabriel Le Bras, t. I : Prol-
gomnes, par Gabriel Le Bras , RDC 6, 1956, p. 1-5.
La conditio de praesenti et le consentement de mariage,
GDSUqV OD MXULVSUXGHQFH GX WULEXQDO GH OD 5RWH -
1946) , RDC 7, 1957, p. 225-254.
La conditio de praesenti et le consentement de mariage,
GDSUqV OD MXULVSUXGHQFH GX 7ULEXQDO GH OD Rote (1935-
1947) (suite) , RDC 7, 1957, p. 389-400.
La conditio de praesenti et le consentement de mariage,
GDSUqV OD MXULVSUXGHQFH GX 7ULEXQDO GH OD 5RWH -
1947) (suite) , RDC 8, 1958, p. 231-252.
8QHEHOOHXYUH : travers textes et ralits sociales, M. Le
Bras fait revivre les institutions ecclsiastiques de la chr-
tient mdivale , RDC 9, 1959, p. 297-308.
La valeur probatoire du tmoignage dans la procdure
canonique , RDC 10, 1960, p. 27-47.
4XHOTXHVDVSHFWVGHOXYUHMXGLFiaire du Cardinal Jullien ,
(0pODQJHV HQ OKRQQHXU GH VRQ minence le Cardinal
Andr Jullien, ancien doyen du Tribunal de la Rote), RDC
11, 1961, p. 295-318.
Le deuxime concile du Vatican et le problme des
mariages mixtes , RDC 11, 1961, p. 151-162.
En vue de la rforme du droit canonique , RDC 13, 1963,
p. 135-148.
Les mariages mixtes et la forme canonique de clbration ,
RDC 13, 1963, p. 193-204.
Motu proprio Pastorale Munus. Commentaire , RDC 14,
1964, p. 206-216.
Motu proprio Pastorale Munus. Commentaire (suite). Essai
VXUODQDWXUHGHODMXULGLFWLRQpSLVFRSDOHGDSUqVOD&RQV-
titution De Ecclesia , RDC 15, 1965, p. 59-72.
Excommunication et pnitence-sacrement aux premiers
VLqFOHV GH OeJOLVH &RQWULEXWLRQ FDQRQLTXH , RDC 15,
1965, p. 265-281.
Excommunication et pnitence-sacrement aux premiers
VLqFOHVGHOeJOLVH VXLWH , RDC 15, 1965, p. 318-330.
J. BERNHARD et H. LEGRAND, /,QVWUXFWLRQ Matrimonii
Sacramentum sur les mariages mixtes , RDC 16, 1966,
p. 58-73.
Excommunication et pnitence-sacrement aux deux
SUHPLHUVVLqFOHVGHOeJOLVH , RDC 16, 1966, p. 41-70.
La conditio de praesenti la lumire de la jurisprudence du
Tribunal de la Rote (1947-1956) , Apollinaris 40, 1967,
p. 535-570.
propos de la forme ordinaire du mariage , Ius Sacrum,
1969, p. 575-591.
$ SURSRV GH OLQGLVVROXELOLWp GX PDULDJH FKUpWLHQ , Revue
des Sciences Religieuses, Mmorial du cinquantenaire (1919-
 GHOD)DFXOWpGH7KpRORJLH&DWKROLTXHGHO8QLYHU-
sit de Strasbourg, 1970, p. 243-256.
A SURSRV GH OK\SRWKqVH FRQFHUQDQW OD QRWLRQ GH FRQ-
VRPPDWLRQH[LVWHQWLHOOH du mariage , RDC 20, 1970, p.
184-192.
2HQHVWODGLVVROXELOLWpGXPDULDJHFKUpWLHQGDQVOeJOLVH
GDXMRXUGKXL ? tat de la question , /$QQpH &DQRQLTXH
14, 1971, p. 59-82.
Rinterprtation (existentielle et dans la foi) de la lgislation
FDQRQLTXH FRQFHUQDQW OLQGLVVROXELOLWp GX PDULDJH FKUp-
tien , RDC 21, 1971, p. 243-278.
$OORFXWLRQ GRXYHUWXUH DX FROORTXH VXU OHV PLQLstres de
GLUHFWLRQGDQVOeJOLVH , RDC 23, 1973, p. 13-16.
Perspectives renoXYHOpHV VXU OK\SRWKqVH GH OD consom-
mation existentielle HWGDQVODIRL du mariage chrtien ,
RDC 24, 1974, p. 334-349.
5pIOH[LRQ FULWLTXH VXU OLQFDSDFLWp PRUDOH ,QFDSDFLWp RX
non-consommation existentielle du mariage ? , RDC ,
25, 1975, p. 274-286.
Sens et limites des interventions des officialits en matire
GLQFDSDFLWpPRUDOH , RDC 26, 1976, p. 91-99.
/H[FOXVLRQGHOLQGLVVROXELOLWpGXPDULDJHGDQVODSUDWLTXH
FDQRQLTXHGHOeJOLVH , RDC 27, 1977, p. 159-173.
5pIOH[LRQ VXU OD G\QDPLTXH de l HQJDJHPHQW Patrimo-
nial en droit canonique ( SURSRV GXQ OLYUH UpFHQW ,
RDC 27, 1977, p. 290-301.
Bilan partiel des recherches canoniques effectues en
France , Il Diritto Ecclesiastico, 1978, p. 85-105.
De OD SUD[LV canonique la thorie. Interprtation
QRXYHOOH GH OLQVXIILVDQFH GHQJDJHPHQW , RDC 29,
1979, p. 140-150.
volution du sens de la forme de clbration du mariage
GDQV OeJOLVH G2FFLGHQW ,PSOLFDWLRQV FDQRQLTXHV DF-
tuelles , RDC 30, 1980, p. 187-205.
Le dcret Tametsi du Concile de Trente : triomphe du
consensualisme matrimonial ou institution de la forme
solennelle du mariage ? , RDC 30, 1980, p. 209-234.
/H FRQFLOHGH7UHQWH HWOpOHFWLRQ GHVpYrTXHV , Concilium,
157, septembre 1980, p. 41-49.
Couple et communaut ecclsiale. Implications cano-
niques , RDC 31, 1981, p. 95-106.
The evolution of matrimonial jurisprudence. The opinion
of a french canonist , Juris 41, 1981, p. 105-116.
Le mariage clat  TXHVW-RQ HQ GURLW Gattendre du droit
canonique ? , RDC 32, 1982, p. 167-185.
La dure du mariage et ses implications canoniques , RDC
33, 1983, p. 276-292.
Le sacrement de pnitence au concile de Trente , RDC 34,
1984, p. 249-273.
,QVXIILVDQFHGXFRQVHQWHPHQWHWabsence du consente-
PHQW partir de la jurisprudence rotale et de nos exp-
riences , 5HFXHLOFDQRQLTXHG$UUDV, 1986, p. 59.
SURSRV GH OD GLPHQVLRQ HFFOpVLDOH GH OHQJDJHPHQW
matrimonial , Revue des Sciences Religieuses, 58, 1984,
p. 137-149.
ComPHQW WUDGXLUH HQ WHUPHV FDQRQLTXHV OHV FDV GpFKHF
dans le mariage ? , RDC 36, 1986, p. 243-266.
Les mariages entre chrtiens de confession diffrente ,
/$QQpH&DQRQLTXH 30, 1987, p. 367-391.
/LQGLVVROXELOLWp GX PDULDJH DX FRQFLOH GH 7UHQWH , RDC
38, 1988, p. 78-99.
Thologie et droit matrimonial , RDC 39, 1989, p. 69-92.
Rorientation de la procdure en nullit de mariage , RDC
40, 1990, p. 179-200.
Le mariage sacrement au Concile de Trente , RDC 42,
1992, p. 269-285.
Fidlit et indissolubilit du mariage : questions poses la
doctrine canonique , RDC 44, 1994, p. 83-99.
Dalla vita alla legge. A proposito del diritto matrimoniale e
della relativa legislazione , Concilium 5, 1996, p. 145-154.

Bibliographie tablie par


Bernard DRYE
:

Chaque fois que le rgne de lhumain me


parat condamn la pesanteur, je me dis qu
linstar de Perse je devrais menvoler dans un autre
espace. Il ne sagit nullement de fuite dans le rve ou
lirrationnel. Je veux dire quil me faut changer
dapproche, quil me faut considrer le monde avec
une autre optique, une autre logique, dautres
moyens de connaissance et de contrle. Les images
de lgret que je cherche ne doivent pas, au contact
de la ralit prsente et future, se laisser dissoudre
FRPPHGHVUrYHV 1.

E
DOARDO DIENI est dcd brutalement lge de
41 ans au mois de juin 2006. Il a laiss dans la
douleur et le dsarroi ses parents, ses deux
VXUVDLQVLque de nombreux amis, collgues et
tudiants. Nous souhaitons, dans ces quelques pages, d-
peindre la fois un ami et un complice de travail, en
remmorant dans un premier temps un parcours acad-
mique et scientifique ; puis, plus longuement et de manire
plus intimiste peut-tre, voquer ce qui lanimait. Nous le
ferons avec nos mots, nos souvenirs et tel que nous pensons

1. Italo CALVINO, Lgret , Leons amricaines. Aide-mmoire pour


le prochain millnaire, Paris, Seuil (coll. Points , 873), 2001, p. 25-26.
Nous remercions la professeure Barbara Pozzo (Milan) qui, se souve-
nant de multiples moments avec Edoardo Dieni, nous avait dit com-
bien son travail et sa PDQLqUHGrWUHOXLIDLVDLHQWSHQVHUjFHWH[WHG,WDOR
Calvino.
quil aurait apprci que nous le fassions : sur un air de jazz
ou de bossa nova.

Originaire de Reggio di Calabria, Edoardo Dieni a reu


une formation initiale de juriste lUniversit de Messine.
Il a obtenu la Laurea di giurisprudenza et fait lavocat
(selon son expression), mais cest la recherche universi-
taire quil souhaitait consacrer son existence. Pour cela, il
poursuivit des tudes doctorales en droit civil ecclsiastique
et surtout en droit canonique, sous le patronage du profes-
seur Salvatore Berling. Il obtint son doctorat en droit en
1997 avec une thse historique qui portait sur la doctrine
matrimoniale iuscorporaliste dans la premire codification
canonique 2.
Edoardo Dieni a entretenu des liens trs troits avec la
France : avec Paris, o il fit une partie de ses tudes docto-
rales (Universit Paris-Sud), mais aussi avec Strasbourg o,
tout juste nomm ricercatore lUniversit Tor Vergata
(Rome), il fut invit comme professeur extrieur en 2001,
afin de dispenser des cours lInstitut de droit canonique.
La collaboration se poursuivit, puisqu partir de cette
mme anne il rejoignit le comit de rdaction de la Revue
de droit canonique et intervint frquemment aux colloques de
la revue. Il garda une affection particulire pour Strasbourg,
pour ses collgues de lIDC et du CRIT quil invita
Cme et Milan, ou TXLO DVVRFLD au projet collectif sur les
symboles religieux.
lautomne 2001, il fut nomm professeur associ
lUniversit de lInsubria (Cme). Il y dispensa des cours de
droit civil ecclsiastique, de droit canonique et de droit
compar des religions.
En 2004, il obtint une mutation lUniversit Bicocca
(Milan), o il est demeur professeur associ de droit civil
ecclsiastique jusqu sa mort, survenue le 11 juin 2006.

2. Edoardo DIENI, Conception juscorporaliste et divorce dans le


GURLW PDWULPRQLDO FDQRQLTXH /LGpH GH FRQMXJDOLWp FKH] OHV FRGLILFD-
teurs de 1917 et ses ascendances , Thse pour le doctorat en droit sous
la direction de Anne LEFEBVRE-TEILLARD, Paris, 1997, 4 volumes,
823 p.
Ses travaux ont port sur le droit matrimonial canoni-
que, mais aussi sur la thorie du droit. Il a publi un ouvrage
sur les fictions en droit canonique 3 et co-dirig avec Alessan-
dro Ferrari (Cme) et Vincenzo Pacillo (Modne) un projet
sur la place des symboles dans les droits savants qui a abouti
la publication de deux monographies 4. Il avait achev un
ouvrage de droit civil ecclsiastique et travaillait, au
moment de sa mort, sur la publication du deuxime tome
du Code europen droit et religion en tant que coordinateur 5,
ainsi que sur un projet douvrage collectif avec des amis
constitutionalistes.
Edoardo Dieni avait reu le prestigieux prix Arturo
Carlo Jemolo en 1992, pour un article publi dans les Qua-
derni di diritto e politica ecclesiastica 6.
Enfin, il faisait partie des comits de rdaction de Dai-
mon. Annuario di diritto comparato delle religione 7, et galement,
on le disait plus haut, de la Revue de droit canonique.

Ce bref rappel biographique effectu, nous ne souhai-


tons pas nous arrter la surface des choses, un curriculum
vit qui, sil peut renseigner sur un parcours personnel, ne

3. Edoardo DIENI, Finzioni canoniche. Dinamiche del come se tra


diritto sacro e diritto profano, Milano, Giuffr, 2004, 412 p.
4. Edoardo DIENI, Alessandro FERRARI et Vincenzo PACILLO
(dir.), I Simboli religiosi tra diritto e culture , Milano, Giuffr, 2006, 402
p. ; Idem, Symbolon/Diabolon. Simboli, religioni, diritti nell'Europa
multiculturale, Bologna, il Mulino, 2005, 328 p.
5. paratre aux ditions Giuffr (Milan).
6. Edoardo DIENI, Il matrimonio civile dei divorziati risposati ,
Quaderni di diritto e politica ecclesiastica, 1993/1, Bologna, il Mulino,
1993, p. 173-193.
7. Ses contributions Daimon : Edoardo DIENI, Matrimoni e or-
dinamenti religiosi. Introduzione al tema , Daimon. Annuario di diritto
comparato delle religione, 2, Bologna, il Mulino, 2002, p. 3-17. ; IDEM,
,O SDQRUDPD GHOOLQVHJQDPHQWR GHO 'LULWWR FRPSDUDWR GHOOH UHOLJLRQL
in Italia , Daimon. Annuario di diritto comparato delle religione, 5, Bolo-
gna, il Mulino, 2006, p. 169-178.
reflte pas ce quEdoardo Dieni tait, ni quelle tait sa
conception de la recherche universitaire.
Edoardo Dieni rvait dune universit qui privilgierait
la promotion sociale par lexcellence et le travail, non par
les relations et le carnet dadresses. Il napprciait pas lide
quon puisse nommer des professeurs TXLQpWDLHQWpas titu-
laires dun doctorat, ou seulement en rcompense de leur
docilit reproduire la bonne doctrine , sans le moindre
esprit critique. Il a parfois exprim son amertume devant
limposition du conformisme, mais il savait trop bien que la
libert, luniversit, ne sacquiert quune fois parvenu en
haut de lchelle.
Lobligation de conformisme aurait pu tre complte-
ment paralysante : il sen est jou. Le fil conducteur de son
XYUH Vest tiss autour de cela 8. Et le leitmotiv de ses tra-
vaux pourrait se rsumer, selon nous, cette simple inter-
rogation : comment tirer profit des lacunes systmiques et
institutionnelles pour se librer de loppression et penser
par soi-mme 9 ?
Edoardo Dieni a effectivement beaucoup insist sur le
fait que le droit use (et abuse) de la rhtorique, de la mta-
phore, fabrique des fictions 10. Sous lapparence structure,
sous laffirmation de compltude et de cohrence, subsis-

8. 6L OLQWHUSUpWDWLRQ juste QHVW SDV WRXMRXUV IDFLOH j WURXYHU HQ


UHYDQFKHLOHVWIDFLOHGHWURXYHUXQHVROXWLRQVLPSOHHWUDVVXUDQWHFHVW
la solution conformiste dj prpare pour nous. Le choix du canoniste
oscille donc entre deux possibilits RXELHQUHVWHUjORPEUHUDVVXUDQWH
GHODUEUH mais sans aller nulle part RXELHQVpORLJQHUORLQGDQVOD
SUDLULHHQDVVXPDQWOHVWDWXWLQTXLHWGHOH[SORUDWHXUGHODYLHPRUDOH
RXYHUWDX[DYHQWXUHVGHOLQterprtation (Edoardo DIENI, Le tragique
GH OLQWHUSUpWDWLRQ GDQV OH GURLW FDQRQLTXH , publi dans ce mme
numro).
9. Edoardo apprciait beaucoup une notice quelque peu atypique
du Dictionnaire de la culture juridique TXLOIDLVDLWOLUHjVHV pWXGLDnts :
Guy THUILLIER, Penser par soi-mme , dans Denis ALLAND et St-
phane RIALS (dir.), Dictionnaire de la culture juridique, Paris, PUF-Lamy
(coll. Quadrige ), 2003, p. 1145-1146.
10. Edoardo DIENI, Finzioni canoniche. op. cit. ; IDEM, La
coutume dans le droit canonique de la post-modernit , RDC, 53/2,
Strasbourg, 2003, p. 241-265. ; IDEM, 8QD UHWRULFD FDQRQLFD FRPH
pedagogia della legge ? , Il Diritto Ecclesiastico, CXII/I, Milano,
Giuffr, 2001, p. 214-265.
tent dans les systmes des espaces de subversion, o le sujet
peut se faire crateur de droit, artiste son tour, tout en
donnant le sentiment de respecter scrupuleusement les
conventions 11.
La subversion ne se limitait pas ce travail dcons-
tructionniste sur le droit (il apprciait le poststructura-
lisme derridien), elle consistait plus concrtement dans la
dfense des exclus du systme 12. Edoardo Dieni tait un
dialecticien, dans le sens aristotlo-thomiste du terme : le
droit tait objet de jeu, jamais clos, toujours en dbat ; il
ntait pas une chose allant de soi, il tait faire.
Tout comme le jazzman nest pas un musicien conven-
tionnel, Edoardo ntait pas un chercheur conventionnel.
On ne peut pas dire que ses champs de recherche visaient la

11. >@&KDTXHpJOLVHSDUWLFXOLre ou locale et mme ajoutera-t-


on, chaque communaut en gnral, mais aussi chaque membre de la
communaut HVW FRPPH XQ LQVWUXPHQW GRXp GXQ WLPEUH GXQH
FRXOHXU GLIIpUHQWH GHV DXWUHV ,O SHXW VDYpUHU TXH OD PXVLTXH MRXpH
prsente des dissonances, comme chez Claude Debussy ou Duke Elling-
WRQHWTXHQpDQPRLQVHOOHVRLWDJUpDEOHjORUHLOOH ex dissonantia armo-
nia ,OSHXWVDYpUHUGDLOOHXUVTXHGDQVXQHFRPPXQDXWpRQQHMRXH
SDV OD PrPH PpORGLH PDLV SOXVLHXUV PpORGLHV GLIIpUHQWHV SRO\SKR-
QLH  HW TXHQFRUH OH UpVXOWDW VRLW DJUpDEOH RX ELHQ TXH OD PXVLTXH VH
WUDQVIRUPH HQ FDFRSKRQLH ,O SHXW VDYpUHU TXH SDUIRLV OHV PXVLFLHQV
QDLHQW SDV EHVRLQ GrWUH VRXPLV j XQ FKHI GRUFKHVWUH TXLOV VHQWHQ-
dent assez bien pour jouer de faon spontane, et mme sans suivre, en
ERQQHSDUWLHXQHSDUWLWLRQpFULWHFRPPH GDQVOHMD]],OSHXWVDYpUHU
TXHIIHFWLYHPHQWOHVPXVLFLHQVMRXHQWGHVWKqPHVGLIIpUHQWVGHFHOXLTXL
HVWpFULWGDQV OD SDUWLWLRQ GX FKHIGRUFKHVWUHHWDORUV OH SURblme est
grave, comme OH GpPRQWUH OH[SpULHQFH GH OeJOLVH SRVW-conciliaire
&RPSWHUHQGXGHORXYUDJHGH3LHUR$QWRQLR%RQQHW Annotazioni su
la consuetudine canonica, dans : RDC, 53/2, Strasbourg, 2003, p. 435-
436).
12. Edoardo DIENI, 0XOLHUTXDPYLVGRFWDHWVDQFWD /accesso al
sapere e al potere in base al genere nel diritto della Chiesa cattolica ,
Confrence au colloque Saperi e poteri religiosi : complementarit e
conflitto fra uomo e donna (Piacenza, 30 octobre-1er novembre 2003)
( paratre aux ditions Morcelliana - Brescia) ; IDEM, /H XQLRQL GL
IDWWR : quale rilievo per il diritto canonico ? , Quaderni di diritto e poli-
tica ecclesiastica, 2002/1, Bologna, il Mulino, 2002, p. 139-163. ; IDEM,
/DUUrW 3HOOHJULQL FRQWUH ,WDOLH GH OD &RXU HXURSpHQQH Ges droits de
OKRPPH , RDC, 51/1, Strasbourg, 2001, p. 141-161. ; IDEM, Appar-
tenenza religiosa e diritti della donna : per una mappatura preliminare
del campo d'indagine , Quaderni di diritto e politica ecclesiastica,
2000/1, Bologna, il Mulino, 2000, p. 217-248. ; IDEM, Apories
persistantes dans le droit matrimonial canonique , RDC, 50/1,
Strasbourg, 2000, p. 171-196.
rentabilitQLTXLOV pouvaient rencontrer un vaste lectorat.
Dune part parce que la philosophie du droit applique aux
droits internes des religions nest pas beaucoup tudie et
encore moins enseigne ; dautre part parce que le style
mme dEdoardo, son jeu et sa musique taient complexes,
par consquent difficilement accessibles aux oreilles des
nophytes.
Le jazzman puise ses inspirations on ne sait o, un peu
partout peut-tre, aucune cohabitation ne lui parat ind-
cente. Il en fut de mme pour Edoardo. Il affichait des
gots trs htroclites, un peu la manire de lintellectuel
de la Renaissance, dans tous les domaines du savoir. Il ado-
rait la littrature 13 OD SKLORVRSKLH OD PXVLTXH ,O pWDLW j
laise avec Homre, Marcel Proust ou David Lodge, Aris-
WRWH.DQWRX3DXO5LFXU, Georges Brassens, Mina Mazzini
ou Paolo Conte. Dans le domaine strictement juridique,
cest sans doute avec son matre le professeur Berling quil
avait les plus grandes affinits intellectuelles. Il fut non seu-
lement son disciple, lui emprunta un certain style 14, mais
continua, professeur son tour, de lui demander conseil,
que ce ft pour ses livres, ses articles ou mme ses conf-
rences. Lventail de ses capacits de travail semblait infini :
il tait un excellent positiviste, dans les deux droits, et il
avait la fibre historienne ; enfin, il tait toujours lafft de
nouveaux champs dinvestigation, et de multiples travaux
contemporains suscitaient son intrt, que ce ft la sociolo-
gie du droit de Niklas Luhmann, le droit des religions de
Silvio Ferrari, la rhtorique juridique de Cham Perelman,
ou encore la philosophie du droit de Franois Ost, Michel
van de Kerchove, Francesco Viola et Giuseppe Zaccaria.
Il puisait ses sources on ne sait o, comme le jazzman.
Il est une autre similitude avec le jazz que nous relverons,
ctait cette aptitude, ce talent dEdoardo faire se ren-
contrer les personnes, constituer des big bands, au-del des
disciplines. Il tait un efficace entremetteur, sentait presque
instinctivement qui pouvait jouer ensemble, faire un

13,ODYDLWPrPHHQWDPpOpFULWXUHGXQURPDQXQSRODUFRPLTXH
GRQWODFWLRQVHGpURXODLWGDQVOHVFRXOLVVHVGXPLOLHXXQLYHUVLWDLUe.
14. Voir par exemple Edoardo DIENI, 7UDGL]LRQHMXVFRUSRUDOLVWDH
codificazione del matrimonio canonico, Milano, Giuffr, 1999, 833 p.
EXI . Sa curiosit le poussait naturellement vers des
dsirs dexprimentations, il glissait allgrement du jazz con-
ventionnel vers le free jazz.
LXYUH HVW XQ FRPPHQFHPHQW , dit Danile Salle-
nave : il y a dans le monde grce elle quelque chose qui
ny tait pas 15. Avec la mort dEdoardo demeurent des
mots, profusion, et des images. On gardera limage dun
homme discret, subtil, volontiers ironique sans jamais tre
blessant ; limage dun homme attentif, gnreux et aimant.
Cependant, lXYUHQHVHUpVXPHSDVjXQHLPDJHRXj
des mots, elle est un don posthume, un don de plus. Il y a
dans le petit monde des canonistes, grce Edoardo Dieni,
quelque chose qui ny tait pas ; il a transmis une thique
ceux qui ont eu la chance de le rencontrer, une certaine
vision du monde, du droit, de la recherche : une vision
confiante, un peu idaliste du monde ; une vision potique
et ludique du droit ; enfin, une vision mancipatrice et
progressiste de la recherche. Gageons que ceux qui
aimaient Edoardo ne cesseront pas de jouer, et auront
FXU GH QH SDV ODLVVHU OHV LPDJHV GH OpJqUHt se dissoudre
comme des rves.

Laurent KONDRATUK

15. Danile SALLENAVE, Le Don des Morts. Sur la littrature, Paris,


Gallimard, 1991, p. 20.
P
RTRE, CRIVAIN, CANONISTE, M. Franois Mor-
lot est dcd le vendredi 31 mars 2006. Dans
son testament, il crivait : Je dsire les obsques
les plus simples, avec le cercueil et le convoi des pauvres.
/RIIUDQGHGHODSULqUHHWGXVDFULILFHHXFKDULVWLTXHHQVHUD
OD VHXOH ULFKHVVH >@ -LQWHUdis tout tmoignage et autres
expressions mon sujet  ODWWHQWLRQ GH WRXV GRLW rWUH
tourne vers le seul Seigneur ressuscit qui je remets ma
foi et dans la foi de qui je veux mourir et entrer dans la
vie 6HVIXQpUDLOOHVFRQIRUPHVjFHTXLOVRXKDLWDLWRQWpWp
clbres le mardi 4 avril 2006 dans la cathdrale de Troyes.
4XLOVRLWSHUPLVFHSHQGDQWGHQGLUHTXHOTXHVPRWV/H
pre Morlot tait n le 10 juin 1921 Chaumont (Haute-
Marne). Ordonn prtre le 26 avril 1944, pour le diocse
de Troyes, il D GDERUG pWp SUrWUH HQ SDURLVVH HQVHLJQDQW
aumnier. De 1969 1974 Rome, il a travaill la
Congrgation pour les Instituts de vie consacre. De 1974
1984, Paris, il a assur le secrtariat international des
Groupes vangile et Mission, appels DXMRXUGKXL /D
Famille Cor Unum (LQVWLWXWVpFXOLHUGHV3UrWUHVGX&Xr de
Jsus).
'H UHWRXU j 7UR\HV LO VHVW YX FRQILHU OD FKDUJH GH
vicaire judiciaire, official de 1re instance de la province de
Reims (Champagne-Picardie). Il a exerc cette responsabilit
GH  MXVTXj VRQ GpFqV Au cours de ces vingt-deux
annes, il a t juge ponent dans plus de quatre cents
causes. ,O D HX GDXWUHV FKDUJHV FHOOe de vicaire piscopal
pour la vie consacre, celle de la Commission diocsaine de
pastorale liturgique et sacramentelle et celle de la Commis-
VLRQGLRFpVDLQHGart sacr.
Son travail de canoniste ne se limitait pas la province
de Reims. Avec quelques autres officiaux, il avait cr Le
Recueil des sentences de diverses officialits francopho-
nes . De 1987 1999, 13 recueils un par an ont ainsi
t diffuss.
Depuis sa prise de fonction comme official, il publiait
chaque anne O$QQXDLUH GHV 2IILFLDOLWpV GH )UDQFH . Il
tait galement un intervenant rgulier et apprci des
MRXUQpHVFDQRQLTXHVG$UUDVIRQdes et animes par le pre
*UHVVLHUG$UUDV et le pre Candelier de Tournai.
Travailleur et chercheur infatigable, prcis et tenace, il a
publi de nombreux ouvrages et articles dans les domaines
du droit canonique, mais aussi de la spiritualit et de
OKLVWRLUHIl tait membre rsidant de la Socit acadmique
GH O$XEH GHYDQW ODTuelle il a fait de trs nombreuses
communications.
-XVTXDXWHUPHGHVDYLHLODXUDWUDYDLOOpSi son activit
de canoniste a occup une place importante dans sa vie,
FHWWHDFWLYLWppWDLWGDERUG et surtout, comme il le disait lui-
mme, une activit pastorale.

Philippe MINAUD
E
N 1991, LA CONGRGATION du culte divin et de
la discipline des sacrements publiait une nou-
velle version de la prire eucharistique appele
prcdemment Pour les rassemblements , devenue
Prire eucharistique qui peut tre employe dans les mes-
ses pour des circonstances particulires 1 . Une brve en-
TXrWHPDSHUmis de constater que des confrres ignoraient
cette version, ou bien savaient vaJXHPHQWTXHOOHH[LVWDLWHW
continuaient utiliser la premire version, puisTXH FHVW
celle-Oj TXLOV WURXYDLHQW GDQV OH PLVVHO GDXWHO PLV j OHXU
disposition. Dans les faits, ce sont surtout les publications
jetables, comme le Missel des dimanches, du genre livre de
poche , ou le mensuel Prions en glise, qui permettent de
diffuser la nouvelle version de faon systmatique. De la
VRUWH GDQV OHV DVVHPEOpHV OH SUrWUH j ODXWHO HW OHV SDUtici-
pants dans la nef trouvent dans les livres de chant ou les
misVHOVOHVXQVODQFLHQQHversion et les autres, la nouvelle.
Sans doute ont-elles t assez rares, les paroisses qui ont
remplac systmatiquement tous les anciens missels,

1. Si on rduit un titre aussi long ses initiales, on obtient : PEQP-


EEDLMPDCP, ou plus bref : PEMCP. Nos anctres taient plus prati-
ques et mieux inspirs, ils attribuaient de telles compositions des
3qUHVGHOeJOLVH'DQVVDSUHPLqUHYHUVLRQOD3(0&3DYDLWpWpFRPpo-
VpHjORFFDVLRn du synode suisse de 1974 GHFHIDLWRQODSSHODLWDORUV
tout simplement le canon suisse . La traduction franaise du nouveau
WLWUH QHVW TXDSSUR[LPDWLYH SXLVTXH OH ODWLQ pro variis necessitatibus a
t remplac en franais par circonstances particulires .
manuels paroissiaux et recueils de chants, uniquement
SRXU TXH WRXWH ODVsemble ait accs cette nouvelle ver-
VLRQ/RSpUDWLRQGHYDLWrWUHRQpUHXVH.
Pourtant, le dcret de promulgation de la nouvelle ver-
sion (6 aot 1991) abrogeait (sic) les traductions antrieu-
res 2. Mais combien de diocses ont diffus officiellement
ces mesures de promulgaWLRQHWGDEURJDWLRQ ? Ainsi, dans
glise en Alsace, bulletin officiel du diocse de Strasbourg,
RQQHQWURXYHPHQWLRQTXHQQRYHPEUHHWQRQSDV
VRXV OD IRUPH GXQ PDQGHPHQW pSLVFRSDO PDLV GDQV XQH
prsentation rdige par un membre du Centre national de
Pastorale liturgique, le P. Didier Rimaud, sous le titre 3 :
Du nouveau dans la prire eucharistique ? /DXteur pr-
sente quelques avantages de la nouvelle version, mais sans
aucune rfrence quelque intervention provenant des ins-
tances piscopales nationales. Dans le diocse en question,
HWVDQVGRXWHDLOOHXUVHQFRUHOHVSDURLVVHVQRQWGpFRXvert
FHWWH QRXYHOOH YHUVLRQ GXQH SULqUH HXFKDristique que par
les catalogues des libraires et par des chroniques liturgi-
ques. Seuls ceux qui ont lu les introductions des ditions
difIXVpHV RQW SX SUHQGUH FRQQDLVVDQFH GH ODEURJDWLRQ GH
ODQFLHQQH YHUVLRQ VL WDQW HVW TXLOV GLVSRVDLHQW GXQH pGL-
tion comportant le dcret romain du 6 aot 1991.
/KLVWRLUHGHOD3(0&3HVWUpYpODWULFHGHVGifficults po-
ses par la pratique lgislative quant la rception des tex-
tes liturgiques. Elle met au jour des dficiences dans la pra-
tique actuelle du droit liturgique. On peut se demander,
FHSURSRVVLODVROXWLRQQHVWSDVjUHFKHUFKHUGDQVXQUe-
tour la coutume 4.

22QSHXWFRQVXOWHUOHVGRFXPHQWVDQQH[HVGDQVOpGLWLRQGHV Pri-
res eucharistiques (ajoutes au Missel romain aprs 1973), version fran-
aise publie chez Descle-Mame, fvrier 2002.
3. glise en Alsace, novembre 1996, p. 9-13 ; le titre comporte ce
SRLQWGLQWHUURJDWLRQ ; le dernier sous-titre de ce texte comporte gale-
PHQW XQ SRLQWGLQWHUURJDWLRQ : 8QH QRXYHOOHPLVHHQXYUH ? Les
qualits thologiques de la nouvelle version sont indniables.
4. Pour traiter de la prire liturgique, on emploiera habituellement
le mot euchologie .
Reprenons la question et les pistes indiques. Tous les
nouveaux livres liturgiques, demands par le concile Vati-
can II, ont t publis 5. Depuis plusieurs annes, la Con-
grgation du Culte divin a mme entrepris de rviser les
premires ralisations et de publier de nouvelles ditions ty-
piques 6. Cela a t fait pour les ordinations, le mariage, le
missel, etc. Mais, comme dans le cas expos plus haut,
propos de la prire eucharistique du synode suisse, on ne
peut exclure que des liturges continuent utiliser les pre-
mires ditions. quels arguments peut-on recourir pour
OHV SHUVXDGHU GDGRSWHU OHV QRXYHOOHV YHUVLRQV ? On en re-
tiendra deux, pour les discuter : la qualit des textes et la r-
fUHQFHjODXWRULWp

Le fait mme de produire de nouvelles traductions d-


PRQWUH j OpYLGHQFH TXDXFXQH WUDGXFWLRQ QHVW SDUIDLWH
FH TXH[SULPH ODGDJH LWDOLHQ : Traduttore, traditore ! Mais
qui peut garantir que les nouvelles versions sont meilleures
en tout point et que les prcdentes sont entirement re-
jeter ? Or, comme toutes les ditions liturgiques doivent
rWUH DSSURXYpHV ODXWRrit du Dicastre est chaque fois
engage, quelles que soient les subtilits du langage utilis,
comme pour la version 1974 de la prire eucharistique du
synode suisse. Les ditions indiquent, en effet, trois formes
RXGHJUpV GDXWRULVDWLRQ : approbation par les confrences
piscopales, confirmation par la Congrgation pour le

5. Une monumentale tude des rformes liturgiques, trs documen-


te, est parue sous la direction de Martin KLCKENER et Benedikt
KRANEMANN, Liturgiereformen. Historische Studien zu einem bleibenden
Grundzug des christlichen Gottesdienstes, 2 vol., Munster Aschendorff
Verlag (LQF 88) ; sur la publication des livres liturgiques aprs le
concile Vatican II, voir la contribution trs instructive de Reiner
KACZYNSKI, Anmerkungen zu den nachkonziliaren liturgischen B-
chern , vol. 2, p. 1003-1016.
6. Voir R. KACZYNSKI, $QPHUNXQJHQ , p. 1012-1016.
Culte divin et accord (Zustimmung) du Saint-Sige 7. Le d-
cret du 6 aot 1991, dans sa traduction franaise, qualifie
ces autorisations par les termes concession et approba-
tion .
Or, aucune dHFHVIRUPHVGDXWRULVDWLRQQHSHXWJDUDQWLU
la perfection et, pour le progrs de la prire liturgique en
ODQJXHIUDQoDLVHLO\DOLHXGDJLUFRPPHOHIRQWOHVpGLWHXUV
de traductions bibliques, de reprer les carences des textes
en cRXUV GXWLOLVDWLRQ SRXU SHUPHWWUH GDPpOLRUHU OHV YHU-
sions paratre. FHWWH ILQ MDWWLUHUDLODWWHQWLRQVXU TXHO-
ques dficiences, dont la premire concerne la traduction
DSSURXYpHGXQDXWUHIRUPXODLUHODSULqUHHXFKDULVWLTXH
et plus prcisment le membre de phrase suivant : (pour)
UDVVHPEOHUGXPLOLHXGHVKRPPHVXQSHXSOHVDLQWTXLWDS-
partienne .
&HODQJDJHQHVWSDVVDWLVIDLVDQWFDULOQHUHIOqWHSDVODO-
lusion biblique (populus acquisitionis, I Pierre  GHORULgi-
nal latin, populum tibi sanctum acquirens 8. De plus, dans le
verbe appartenir ODMHXQHVVHDFWXHOOHSHUoRLWOpYRFDWLRQ
GXQHPEULJDGHPHQWHWOLGpHGXQHSRVVHVVLRQTXLVDFFRU-
dent mal avec le thme de la libration. Certes, la traduc-
tion liturgique de I Pierre 2,9 utilise le mme verbe : le
peuple qui appartient Dieu (5e dimanche de Pques A).
En revanche, les traductions bibliques franaises les plus
utilises ont prserv la signification du latin acquisitionis et
acquirens de la Vulgate : un peuple acquis (Bible de Jru-
salem) et OHSHXSOHTXH'LHXVHVWDFTXLV (TOB). La fid-

7/pGLWLRQIUDQoDLVHFRPSRUWHFHWWHPHQWLRQ : Texte franais ap-


prouv par les confrences piscopales de Suisse et de France et confir-
m par la Congrgation pour le Culte divin, le 8 aot 1974 pour la
Suisse, le 27 janvier 1978 pour la France. /pGLWLRQDOOHPDQGH : Von
der Schweitzer Bischofskonferenz approbiert und von der Gottesdienst-
kongregation besttigt (8. August 1974). Mit Zustimmung des Apostoli-
schen Stuhles von der sterreichischen Bischofskonferenz bernom-
men.
8. Ce texte correspond la version latine de ce rglement ecclsias-
tique anonyme que la critique moderne a attribu tort Hippolyte, la
Tradition apostolique  MDL WUDLWp GH FHWWH TXHVWLRQ GDWWULEXWLRQ HQ
dernier lieu dans Tradition orale et tradition crite dans la pratique li-
turgique antique. Les recueils de traditions apostoliques , Robert F.
TAFT et Gabriele WINKLER (d.), Comparative Liturgy fifty Years after
Anton Baumstark (1872-1948), Rome, 2001 (OCA 265), p. 599-611.
lit au texte latin a t mieux prserve dans les traductions
italienne et allemande de cette prire eucharistique : (per)
acquistarti un popolo santo et (um) Dir ein heiliges Volk
zu erwerben /DSSUREDWLRQURPDLQHGHODWUDGXFWLRQIUDQ-
aise du missel cautionne donc une dficience, quant au
substrat biblique de cette prire eucharistique II.
3DUFHWH[HPSOHRQDYRXOXPRQWUHUTXDXFXQHLQVWDQFH
ne peut prpWHQGUH j OD SHUIHFWLRQ HW j OLQIDLOOLELOLWp GDQV
OpWDblissement des traductions, pas mme dans leur con-
WU{OH HW VL FHUWDLQV REMHFWHQW TXLO VDJLVVDLW GXQH GHV SUH-
mires ralisations en ce domaine, on peut rpondre, exem-
SOH j ODSSXL TXH OHV WUDductions rcentes ne sont pas
mieux garanties. Ainsi, comme pour la version de 1974, la
traduction franaise de la PEMCP, dj tudie plus haut, a
PDLQWHQXDYHFODSSUREDWLRQURPDLQHOHYHUEH partager ,
pour traduire fregit, dans le rcit de la Cne, en occultant
ainsi la force vocatrice de la fraction du pain par le Christ,
comme annonce de sa mort 9.
De mme, dans la version franaise du Directoire sur la
pit populaire et la liturgie 10 la Congrgation pour le Culte
divin et la discipline des sacrements a laiss passer la phrase
suivante : il faut affirmer galement que la vie spirituelle
GHV ILGqOHV QHVW SDV HQIHUPpH GDQV OD SDUWLFLSDWLRQ j OD
seule liturgie . Le verbe enfermer est manifestement
impropre dans ce contexte ; on ne saurait imaginer un ins-
tant que ce dicastre ait pu crire de tels propos en latin,
puisque, comme participation la rsurrection du Christ,
la liturgie libre les fidles de toutes les formes de mort. Si
OH &DWpFKLVPH GH OeJOLVH FDWKROLTXH GpILQLW OD OLWXUJLH
comme OH[HUFLFH GH OD IRQFWLRQ VDFHUGRWDOH GH -pVXV
Christ   TXLRVHUDLWpFULUHTXHOOHHQIHUPHOHVpar-
ticipants !

9. On repre cette dficience dans plusieurs traductions franaises


de prires eucharistiques ; voir notre contribution la Semaine litur-
gique de Saint Serge 2002, La fidlit au texte biblique dans quelques
productions liturgiques romaines rcentes , La Liturgie, interprte de
OeFULWXUH II, (Confrences Saint-Serge 2002), C.L.V. Edizioni liturgiche,
Rome 2003, p. 223-235 ; sur le vocabulaire de la fraction du pain, voir
p. 227-228.
10. Paris, Tqui, 2002, 282 p. Le propos contest se trouve sur la p.
4 de couverture.
Si un liturge refusait la nouvelle version de la PEMCP
VRXV SUpWH[WH TXHOOH QHVW SDV PHLOOHXUH TXH ODQFLHQQH
pourrait-RQ OH FRQYDLQFUH SDU ODUJXPHQW GH OREpLVVDQFH ?
&HWWHVROXWLRQULVTXHGHQrWUHJXqUHSOXVHIILFDFHSXLVTXH
GXPRLQVGDQVOHVSDURLVVHVRMDLHQTXrWpOLQVWLWXWLRQHF-
FOpVLDVWLTXH QD SDV SULV GH GLVSRVLWLRQV SDUWLFXOLqUHV SRXr
LPSRVHUOHSDVVDJHGXQHYHUVLRQjODXWUHHWTXHOHVSUrWUHV
XWLOLVHQWOHVOLYUHVOLWXUJLTXHVTXLOVWURXYHQWGDQVOHVVDFULV-
ties 11. Pourquoi les curs devraient-ils tre plus zls que les
vques en ce domaine ?
Quant la version autorise, si par ILGpOLWpjOLQVSLUDWLRQ
biblique du formulaire promulgu, un liturge remplace
partager par rompre , dans la version franaise de la
PEMCP, les autorits suprieures peuvent-elles le lui repro-
cher ",OSRXUUDLWUpWRUTXHUTXLOIDXW obir Dieu plutt
TXDX[KRPPHV (Ac  (QORFFXUUHQFHODILGpOLWpEL-
EOLTXH GDQV OHXFKRORJLH HVW GLQVWLWXWLRQ GLYLQH SXLVTXH
-pVXV OD LQVWLWXpH SDU VD SURSUH SULqUH PDLV ODSSUREDWLRQ
GHVWUDGXFWLRQVQHVWTXHGHGURLWHFFOpVLDVWLTXH
Par ailleurs, la multiplication des ditions remanies ris-
TXHGHQWDPHUODFUpGLELOLWpGHODXWRULWpVXSpULHXUHFDURQ
fera remarquer : si cette autorit modifie ou abroge des
textHV TXHOOH DYDLW HOOH-mme approuvs prcdemment,
YRLUH FRPSRVpV FHVW TXHOOH QHVt pas infaillible en la ma-
WLqUH 'DQV FHV FRQGLWLRQV OD QRXYHOOH YHUVLRQ QRIIULUDLW
pas plus de garanties que la prcdente ! Or, la crdibilit
en ce domaine exige que le correcteur justifie ses interven-
tions par rapport la pastorale 12 et que ses arguments puis-
VHQW rWUH UHoXV SDU OHV OLWXUJHV FDU LO VDJLW GH WUDGLWLRQV
dont le &DWpFKLVPHGHOeJOLVHFDWKROLTXH UDSSHOOHOpPLQHQWH
valeur : Aucun rite sacramentel ne peut tre modifi ou
manipul au gr du ministre ou de la communaut. Mme

11/DGLIIXVLRQGXQH QRXYHOOHYHUVLRQGXQH SULqUHHXFKDULVWLTXH


LPSOLTXHODFTXLVLWLRQGHFHWH[WH&HUWHVOHVGpSHQVHVQRQWSOXVULHQ
GH FRPSDUDEOH j FH TXHOOHV pWDLHQW DX WHPSV GHV PDQXVFULWV ,O QHP-
pche, une nouvelle version du missel est annonce ODWWHQWHGHFHWWH
SXEOLFDWLRQQLQFLWHJXqUHjVHSURFXUHUGHVIDVFLFXOHVSURYLVRLUHV
12. Voir &DWpFKLVPHGHOeJOLVHFDWKROLTXH 1205.
ODXWRULWpVXSUrPHGDQVOeJOLVHQHSHXWFKDQJHUODOLWXUJLHj
VRQJUpPDLVVHXOHPHQWGDQVOREpLVVDQFHGHODIRLHWGDQV
le respect religieux du mystre de la liturgie ( 1125).

/pODERUDWLRQGHWUDGXFWLRQV liturgiques approuves pla-


FH OHV DXWRULWpV SDVWRUDOHV GH OeJOLVH URPDLQH GDQV XQH VL-
WXDWLRQ DEVROXPHQW LQpGLWHWHOOHTXLOQHQDMDPDLV H[LVt
GHVHPEODEOHGDQVOHWHPSVHWOHVOLHX[(QHIIHWLOQHVDJLW
SDV VHXOHPHQW GH OD WUDGXFWLRQGXQ FRUSXV euchologique,
WUDQVSRVpHQOpWDWGDQVXQHDXWUHODQJXH ; cette exprience
est celle des glises orientales, qui jadis, en vanglisant de
nouvelles rgions, comme les pays slaves, et notre poque,
GDQVOHVVLWXDWLRQVGpPLJUDWLRQWUDGXLVHQWXQFRUSXVOitur-
JLTXHFRQVWLWXpGHORQJXHGDWHGDQVGDXWUHVODQJXHV0DLV
pour la liturgie romaine rnove par le concile Vatican II, il
VDJLW j OD IRLV GH FUpDWLRQV GH UpYLVLRQV HW GHWUDGXFWLRQV
portant sur des pices anciennes et nouvelles, pour une dif-
fusion simultane dans une multitude de langues.
'DQVOHGURLWOLWXUJLTXHGHOeJOLVHURPDLQHRQQHWURX-
YHDXFXQPRGqOHGHIRQFWLRQQHPHQWVXVFHSWLEOHGrWUHDS-
pliTXp j FHWWH LPPHQVH HQWUHSULVH GH WUDGXFWLRQ ,O QHVW
donc pas impossible que les responsables se laissent guider,
consciemment ou inconsciemment, par des modles vala-
EOHVHQGDXWUHVGRPDLQHVRXSDUOHGURLWOLWXUJLTXHHQXVD-
ge avant le concile Vatican II. Or, ce droit tait jadis inscrit
dans les livres liturgiques approuvs. Ceux-ci dterminaient
de faon explicite les rites accomplir et contenaient les
IRUPXODLUHVHXFKRORJLTXHVUHTXLV7RXWpWDLWFRGLILpHWOH[p-
cution ne laissait aucun choix ni aucune initiative aux litur-
JHV 'DQV FH IRQFWLRQQHPHQW HW VRXV OLQIOXHQFH GHV WKpR-
ries tutioristes en matire sacramentelle, les rites taient
WUDLWpVSDUODXWRULWpHFFOpVLDVWLTXHGHODPrPHIDoRQTXXQH
SURFpGXUHMXGLFLDLUHDYHFODSUpRFFXSDWLRQGpYLWHUWRXWFH
qui pouvait ressembler des vices de forme. Une telle con-
ception de la liturgie conduit fixer les rites et les formu-
ODLUHVGXQHIDoRQIRUPHOOHVDQVpJDUGSRXUODFRPmunica-
WLRQGDQVODVVHPEOpH
/HPSORLGXQYRFDEXODLUHMXULGLTXHGDQVOHGpFUHWGX
DRWHQORFFXUUHQce le verbe abroger , illustre une
tendance qui apparat aussi dans le Motu proprio du 28
mars 2001 sur les traductions liturgiques 13 et qui consiste
transposer dans la pastorale de la prire liturgique des fonc-
tionnements de type lgislatif. Or, si ODEURJDWLRQGXQHORL
est une pratique vidente dans les domaines politique et
juriGLTXHSRXU OHVIRUPXODLUHV GHSULqUHLOQHQHVWSDVGH
mme : peut-RQ DSSOLTXHU OH PpFDQLVPH GH ODEURJDWLRQ j
GHVWH[WHVTXLSHQGDQWXQHTXLQ]DLQHGDQQpHVRQWpWpGHV
dialogues entre des communauts liturgiques et Dieu lui-
mme " &HV WH[WHV QpWDLHQt-LOV SDV LQVSLUpV SDU O(VSULW
6DLQWTXLDpWpFRPPXQLTXpSDUORUGLQDWLRQpSLVFRSDOHj
ceux qui les ont composs et ceux qui les ont approuvs ?

La prire liturgique chrtienne ne peut tre assimile


des textes lgislatifs, elle reprsente un genre littraire parti-
culier, dont les traits dominants sont la fidlit la tradi-
tion et la capacit favoriser la communication entre les
orants et Dieu. En effet, la liturgie chrtienne est issue de la
UpYpODWLRQ HW GH OKLVWRLUH GX 3HXSOH GHV $OOLDQFHV -pVXV D
UHSULV j VRQ FRPSWH OKpULWDJH G,VUDsO HW SDU VRQ LQFDUna-
tion, il est devenu le mdiateur de la prire du Peuple de
Dieu. Bien plus, comme tte de son Corps (p 4,15-16), il
HQWUDvQHOeJOLVHGDQVVDSURSUHSULqUHGH)LOVGH'LHX 14. De
FH IDLW OD SULqUH OLWXUJLTXH HVW OH IUXLW GXQH WUDGLWLRQ LQ-
interrompue, dont la fidlit aux origines bibliques 15, chris-
tologiques et apostoliques est fondamentale.

13. Document consult par Internet. Voir aussi A. WARD, The


,QVWUXFWLRQ /LWXUJLDP DXWKHQWLFDP : Some Particulars , Ephemerides
liturgicae 116 (2002/2), p. 197-221.
14. Voir Marcel METZGER, Les Sources de la prire chrtienne, di-
WLRQVGHO$WHOLHU3DULVS
15. &HVWSDUOD3DUROHGH'LHXTXHO(VSULW6DLQWDSSUHQGDX[HQ-
fants de Dieu prier leur Pre (&DWpFKLVPH GH OeJOLVH FDWKROLTXH
2766).
4XDQW j OD FRPPXQLFDWLRQ PLVH HQ XYUH GDQV OD
prire, elle a t dfinie par le Christ lui-mme : Dans vos
prires, ne rabchez pas comme les paens LOVVLPDJLQHQW
TXHQ SDUODQW EHDXFRXS LOV VH IHURQW PLHX[ pFRXWHU
(Mt 6,7). Autrement dit, la prire doit tre formule dans
un langage compris par celui qui la profre, puisque Dieu,
TXLFRQQDvWOHIRQGGHVFXUV Ac 1,24 ; 15,8), veut un dia-
logue sincre et authentique, et non pas des mots pronon-
cs de faon formelle. Cette qualit du dialogue avait t
sous-estime pendant un millnaire, dans la prire litur-
JLTXHGHOeJOLVHURPDLQHMXVTXjFHTXHOHFRQFLOH9DWLFDQ
II mette fin une telle anomalie 16 et dcide une rforme
liturgique systmatique pour promouvoir la participation
active et consciente de tous les participants dans les clbra-
tions.
Sous cet aspect, la prire liturgique diffre fondamenta-
lement du langage lgislatif ou juridique des organes de
gouvernement, recueilli dans un code de droit canonique.
Celui-ci recourt un vocabulaire technique et prcis, qui
peut le rendre hermtique aux non-initis. Il est neutre et
objectif, excluant tout sentiment ou motion, il est formul
la troisime personne. En voici deux exemples :
Canon 906. Le prtre ne clbrera pas le sacrifice eucha-
ULVWLTXH VDQV OD SDUWLFLSDWLRQ GXQ ILGqOH DX PRLQV VDXI
pour une cause juste et raisonnable.
Canon 920. 1. Tout fidle, aprs avoir t initi la
WUqVVDLQWHHXFKDULVWLHHVWWHQXSDUOREOLJDWLRQGHUHFHYRLUOD
sainte FRPPXQLRQDXPRLQVXQHIRLVODQ
'XQHWRXWHDXWUHQDWXUHTXHOHODQJDJHGHVUqJOHPHQWV
ODSULqUHOLWXUJLTXHHVWOH[SUHVVLRQGXQHUHODWLRQLQWHUper-
sonnelle, comme rponse de la communaut ecclsiale
'LHXTXLVDGUHVVHjHOOHGDQV ODFpOpEUDWLRQSar sa Parole
proclame. Elle est formule la premire et la deuxime
personne. Elle est porteuse de toutes les motions suscites
SDU OD UHQFRQWUH GH 'LHX /HV SDUWLFLSDQWV GH ODVVHPEOpH
GRLYHQW SRXYRLU V\ LPSOLTXHU HW la faire leur, ce qui exige
TXelle puisse leur tre pleinement comprhensible. Cela
vaut tout spcialement pour la prire eucharistique, qui est

16. Voir Constitution sur la liturgie, 36, 54 et 63.


formule la premire personne du pluriel. En voici un
exemple, tir de la prire eucharistique pour les rassemble-
ments :
dans la version de 1974 : Nous te rendons grces,
Pre fidle et plein de tendresse, de nous avoir donn Jsus,
WRQ)LOVQRWUH6HLJQHXUHWQRWUHIUqUH
dans la PEMCP de 1996 : Vraiment, il est juste et
ERQ GH WH UHQGUH JORLUH GH WRIIULU QRWUH DFWLRQ GH JUkFe
toujours et en tout lieu 17, toi, Dieu fidle, Pre des mis-
ricordes. Car tu nous as donn ton Fils, Jsus, le Christ,
QRWUH6HLJQHXUHWQRWUHIUqUH

Le souci de rendre les traductions de la prire liturgique


pleinement comprhensibles avait t pris en compte ds
les premires mesures de la rforme conciliaire. On en trou-
ve une belle expression dans le dcret de la Congrgation
pour le Culte divin en date du 1er novembre 1974, relatif
au[PHVVHVGHQIDQWVSur la suggestion de plusieurs conf-
rences piscopales, ce dicastre avait ralis des prires eu-
chaULVWLTXHV SRXU OHV PHVVHV GHQIDQWV DFFRPSDJQpHV
GRULHQtations trs instructives propos des traductions
effectuer. Voici quelques extraits significatifs de ce docu-
ment 18.
La traduction peut tre faite avec une certaine libert
pour rpondre pleinement aux exigences et au caractre de
FKDTXHODQJXHHWGLIIpUHUTXHOTXHSHXGXWH[WHODWLQ>@,O
revient la confrence pLVFRSDOH >@ GH IDLUH UpGLJHU XQ
texte en langue populaire qui rponde pleinement aux exi-
JHQFHVSDVWRUDOHVSpGDJRJLTXHVHWOLWXUJLTXHV>@,OHVWVRX-

17. La formule habituelle des prfaces latines, Vraiment, il est


juste et bon de te rendre gloire, etc. , a t introduite dans les quatre
prfaces de la PEMCP de 1996. La deuxime prire pour la rconcilia-
WLRQ   FRPPHQFH SDUXQH DXWUH IRUPXOH GLQWURGXFWLRQ : Dieu,
notre Pre, nous te rendons grce .
18. Dcret du 1er novembre 1974. Le texte a t insr dans les di-
tions des prires eucharistiques ajoutes au Missel romain aprs 1973,
GRQW OpGLWLRQ SXEOLpH HQ IpYULHU  SRXU GLIIXVHU OD 3(0&3 ; voir
plus haut, note 2.
haitable que ce travail de rdaction soit confi un groupe
GKRPPHV HW GH IHPPHV SRVVpGDQW XQH FRPSpWence non
seulement liturgique, mais aussi pdagogique, catchtique,
littraire et musicale. Ce groupe aura toujours prsent
OHVSULWTXHOHWH[WHODWLQQHVWSDVFHWWHIRLVGHVWLQpjOXVDJH
OLWXUJLTXH HW TXLO QH VDJLW GRQF SDV GH OH WUDGXLUH SXre-
meQW HW VLPSOHPHQW /D ODQJXH ODWLQH >@ D VHV FDUDFtris-
WLTXHV SURSUHV >@ QXOOHPHQW j WUDQVSRVHU GDQV OHV WH[WHV
YHUQDFXODLUHVGHVWLQpVjOXVDJHOLWXUJLTXH

&HVRULHQWDWLRQVSRXUODUpDOLVDWLRQGXQHHXFKRORJLHHQ
languH YLYDQWH DYHF OH VRXFL GX ODQJDJH HW GH OH[SUHVVLRQ
propres des groupes humains particuliers, correspondent
la tradition liturgique des origines chrtiennes et la pra-
WLTXHGHFHTXRQDDSSHOpOLPSURYLVDWLRQGDQVODSULqUH,O
est fait mention de cette pratique dans des rglements eccl-
siastiques antiques et les principaux tmoignages ce sujet
sont bien connus, surtout celui de la Tradition apostoli-
que :
4XH OpYrTXH UHQGH JUkFHV FRPPH QRXV ODYRQV GLW
SOXVKDXW,OQHVWSDVGXWRXW QpFHVVDLUHTXLOSURQRQFHOHV
PrPHVPRWVTXHQRXVDYRQVGLWVFRPPHVLOVHIIRUoDLWGH
OHV GLUH  SDU FXU HQ UHQGDQW JUkFHV j 'LHX ; mais que
chaFXQSULHVHORQVHVFDSDFLWpV6LTXHOTXXQHVWFDSDEOHGH
prier assez longuement et (de dire) une prire solennelle,
FHVWELHQ0DLVVLTXHOTXXQTXDQGLOSULHGLWXQHSULqUH
PHVXUpHTXRQQHOHQHPSrFKHSDVSRXUYXTXLOGLVHXQH
SULqUHGXQHVDLQHRUWKRGR[LH 19.

19 6HORQ OpGLWLRQ GH %HUQDUG BOTTE, La Tradition apostolique


G+LSSRO\WH GH 5RPH (VVDL GH UHFRQVWLWXWLRQ Munster, 1989, LQF 39,
p. 29. Voir plus haut, n. 8. Ce document a connu un grand succs
OpSRTXHGXFRQFLOH9DWLFDQ,,HWVRXVOLPSXOVLRQGHVSULQFLSDX[DUti-
sans du mouvement liturgique, il a servi de rfrence et de modle dans
plusieurs domaines de la rforme liturgique ; son formulaire du cha-
SLWUHHVWODVRXUFHGHODFWXHOOHSULqUHHXFKDULVWLTXHHWVDSULqUHGRU-
dination piscopale, au chapitre 3, a t adopte de prfrence au for-
PXODLUHGRULJLQHURPDLQH'DQVOHFRQWH[WHGHODULYDOLWpDYHFOHVGRna-
WLVWHVOHVRXFLGHORUWKRGR[LHDpJDOHPHQWFRQGXLWOHFRQFLOHGH&DUWKD-
ge de 407 intervenir propos de la prire liturgique ; voir Martin
'DSUqVFHUqJOHPHQWODSULqUHOLWXUJLTXHFRPSRUWDLWjOD
fois des lments imposs ( que OpYrTXH UHQGH JUkFHV
FRPPHQRXVODYRQVGLW ) et une formulation libre ( prire
solennelle, prire mesure ). Quels taient les lments im-
poss ? Vraisemblablement la trame, ou les grandes lignes
de la prire, celles, par exemple, qui sont indiques dans le
ULWXHO EDSWLVPDO GXQ DXWUH UqJOHPHQW HFFOpVLDVWLTXH OHV
Constitutions apostoliques UpJLRQ G$QWLRFKH ILQ GX 4e si-
cle). En effet, pour la liturgie baptismale (VII, 39-44), ce
recueil ne propose pas de formulaires achevs, mais des
thmes dpYHORSSHU 3RXU OD EpQpGLFWLRQ GH OHDX EDSWLV-
male (VII, 43,2), par exemple, il indique les thmes sui-
vants :
(Le pontife) bnit et glorifie Dieu en rendant grce de
FH TXLODHQYR\pVRQ)LOV VLQFDUQHU jFDXVHGHQRXV SRXU
QRXV VDXYHU >@ LO DGRUH Oe Fils unique lui-PrPH >@ OXL
UHQGDQWJUkFHVGDYRLUHQGXUpODPRUWVXUODFURL[>@(WLO
UHQGJORLUHGHFHTXDXQRPGX&KULVWGDQVO(VSULW6DLQW
'LHXQDSDVUHMHWpOHJHQUHKXPDLQ 20
6XU FHV SUDWLTXHV TXL VDSSDUHQWHQW j OLPSURYLVDWLRQ
musicale sur des thmes connus , des historiens des litur-
gies juive et chrtienne ont pu apporter quelques nouveaux
clairages. Rcemment, Achim Budde a mis en vidence les
SDUHQWpV GDQV ODUWLFXODWLRQ GH WURLV SULqUHV HXFKDULVWLTXHV
et montrer comment les mmes thmes sont dvelopps de
IDoRQ GLIIpUHQWH GXQ IRUPXODLUH j ODXWUH 21 /HQULFKLVVH-
ment du propos a pour source principale la mmoire des
actions de Dieu, consigne dans la tradition biblique.
Les liturges du 21e sicle ont certainement autant de ca-
pacits que ceux du 4e, pour dire des prires solennelles
et des prires mesures GpYHORSSpHVjSDUWLUGXQJXLGH
thmatique et nourries par les connaissances bibliques.

KLCKENER, Liturgiereform in der nordafrikanischen Kirche des


4./5. Jahrhunderts , Liturgiereformen (voir n. 5), vol. 1, p. 146-148.
20. Dans notre dition, Sources Chrtiennes 336, p. 102-103.
21. Achim BUDDE, Improvisation im Eucharistiegebet. Zur Tech-
nik freien Betens in der Alten Kirche , Jahrbuch fr Antike und Chris-
tentum 44 (2001), p. 127-141.
La crativit admise dans la prire liturgique des pre-
miers sicles correspond la vritable nature de la liturgie
FKUpWLHQQHTXHGHVVLqFOHVGH[LORQWODLVVpHGDQVORPEUH :
la liturgie est communication de Dieu avec son peuple, elle
est change mutuel. La Parole de Dieu rvlHjODVVHPEOpH
OHYLVDJHHWOHVDFWLRQVGH'LHXHWODVVHPEOpHUpSRQGjFHWWH
communication dans une prire nourrie par cette mme
Parole de Dieu. La prsidence de la prire est donc un acte
minemment pastoral, ce qui exige de la part des prsidents
des communauts et des instances liturgiques, une totale
correspondance avec le portrait du pasteur que Jsus a con-
fi son glise.
Or, en prsentant le ministre pastoral, Jsus a rvl le
principe qui doit protger son glise de toute drive, dans
son orJDQLVDWLRQHWVRQIRQFWLRQQHPHQW&HSULQFLSHLOOD
expos de faon trs concrte dans les paraboles du Bon
pasteur, dans son message sur la connaissance mutuelle re-
quise dans les communauts de son peuple : Je suis le bon
pasteur, je connais mes brebis et mes brebis me connais-
sent (Jn 10,14). Les aptres et leurs successeurs des pre-
miers sicles ont bien compris ce message, car ils ont tabli
des communauts de taille approprie, dont les pasteurs
pouvaient connatre tous les membres et tre connuVGHX[
Le respect de ce principe fondamental devrait viter toute
drive vers des bureaucraties anonymes et, dans les clbra-
tions, il permet de faire entendre la Parole de Dieu et de la
commenter de faon personnelle et adapte la commu-
naut locale.
Ce message a t intgr dans le &DWpFKLVPHGHOeJOLVHFD-
tholique (1992 et 1998), qui rend compte en divers contex-
tes des implications de la communication de Dieu avec son
peuple. Ses propos peuvent donc guider trs judicieuse-
ment la ralisation de traductions liturgiques. En voici quel-
ques-uns, parmi les plus significatifs :
Dans la condescendance de sa bont, Dieu, pour se r-
vler aux hommes, leur parle en paroles humaines. (101)
La liturgie est le lieu privilgi de la catchse du Peu-
ple de Dieu. (1074)
/DQQRQFHGHOD3DUROHGH'LHXQHVDUUrWHSDVjXQHQ-
seignement : elle appelle la rponse de foi, comme consente-
PHQWHWHQJDJHPHQWHQYXHGHODOOLDQFHHQWUH'LHXHWVRQ
peuple. (1102)
Dans la liturgie, le Christ est l prsent dans sa parole,
FDUFHVW/XLTXLSDUOHWDQGLVTXRQOLWGDQVOeJOLVHOHV6DLQ-
tes critures. (1088, avec rfrence Vatican II, Liturgie
7).
/DOLWXUJLHUpDOLVHHWPDQLIHVWHOeJOLVHFRPPHVLJQHYL-
sible de la communion de Dieu et des hommes par le
Christ. Elle engage les fidles dans la Vie nouvelle de la
communaut. Elle implique une participation consciente,
active et fructueuse de tous. (1071, avec rfrence Vati-
can II, Liturgie 11)
travers les paroles, les actions et les symboles qui for-
PHQWODWUDPHGXQHFpOpEUDWLRQO(VSULW6DLQWPHWOHVILd-
les et les ministres en relation vivante avec le Christ, Parole
HW,PDJHGX3qUHDILQTXLOVSXLVVHQWIDLUHSDVVHUGDQVOHXU
YLHOHVHQVGHFHTXLOVHQWHQGHQWFRQWHPSOHQWHWIRQWdans
la clbration. (1101)
La catchse liturgique est du ressort des catchismes
locaux et rgionaux. (1075)
Mais cela exige aussi que la catchse aide les fidles
VRXYULUjFHWWHLQWHOOLJHQFHVSLULWXHOOHGHOpFRQRPLHGXVD-
lut, telle que la OLWXUJLH GH OeJOLVH OD PDQLIHVWH HW QRXV OD
fait vivre. (1095)

&HW HQVHPEOH GH[WUDLWV PHW HQ pYLGHQFH OD QpFHVVLWp


GDGDSWHUOHODQJDJHGHODOLWXUJLHjODFXOWXUHHWDX[FDSDFL-
ts des communauts locales, pour que chaque participant
SXLVVHVLPSOLTXHUSHUVRQQHOOHPHQWGDQVODIRUPXODWLRQGH
la prire liturgique. Dans les diocses de France, pour ne
SDVSDUOHUGDXWUHVSD\VORSSRUWXQLWpGHWHOOHVDGDSWDWLRQV
HVWUHFRQQXHDXPRLQVGHSXLVODPLVHHQuvre de la rfor-
me liturgique de Vatican II, ce qui reprsente une dure d-
passant dj les trente annes exiges pour la reconnais-
VDQFHGXQHFRXWXPH FDQRQ 
6HODLVVDQWJXLGHUSDUOHVRULHQWDWLRQVGHOpSRTXHFRQFL-
liaire 22, des pasteurs actualLVHQWOHVWH[WHVDXWRULVpVSDUODG-
jonction de paraphrases ou bien par des modifications du
YRFDEXODLUH 0rPH GHV FDUGLQDX[ HW GHV pYrTXHV VDXtori-
sent de telles initiatives et cela se produit aussi lors de cl-
brations trs mdiatises. Des revues spcialises proposent
des paraphrases des formulaires autoriss pour guider la
SULqUHSHUVRQQHOOHHWGHVOLWXUJHVVHQVHUYHQWSRXUOHVFpOp-
brations elles-PrPHV3DUIRLVLOVDJLWGHIDLUHOHOLHQHQWUH
les lectures bibliques et le formulaire euchologique dans la
mme clbration. Ainsi, le 24e dimanche A, aprs la lec-
ture de la parabole des deux dbiteurs (Mt 18,21-35), on
introduit le mot dette  VXJJpUp SDU OpYDQJLOH GDQV GHV
proclamations qui lui correspondent, ce qui peut conduire
cette formulation : 9RLFL O$JQHDX GH 'LHX TXL HQOqYH
la dette et le pch du monde .
'DXWUHV LQLWLDWLYHV GH FH JHQUH RQW SRXU FDXVH GHV UH-
tards dans la publication des traductions officielles, comme
FHVW OH FDV SRXU OH ULWXHO GX PDULDJH (Q HIIHWOOrdo cele-
brandi matrimonium publi en 1991 comporte une innova-
WLRQ UHPDUTXDEOH j VDYRLU XQH pSLFOqVH GH O(VSULW 6DLQW
dans la bndiction nuptiale 23. Mais, plus de dix ans aprs
ODSXEOLFDWLRQGHOpGLWLRQW\SLTXHODYHUVLRQIUDQoDLVHQHVW
pas encore disponible  RQ VDLW SRXUWDQW TXHOOH D GpMj pWp
faite 24. Comment empcher les liturges de rgions fronta-
lires, connaissant par consquent des traductions en

22. Par exemple : On doit dterminer les textes qui sont procla-
PpVGDQVODVVHPEOpHOLWXUJLTXHHQFRQVLGpUDWLRQGXQHSDVWRUDOHDGDS-
te, aussi que de la facult de choix laisse en ce domaine. (Prsenta-
tion gnrale du Missel, 320).
23. Voir Marcel METZGER, Mystre du mariage et fidlit de Dieu
(aspects liturgiques) , Revue de Droit Canonique 43 (1993), p. 149-164.
24. Les dlais pour la publication des traductions liturgiques en lan-
JXHIUDQoDLVHVRQWGXQHGXUpHH[FHVVLYHSDUUDSSRUWjODORQJXHXUGHV
textes concerns. Pour la PEMCP, prs de cinq annes se sont coules
entre la publication du texte latin (6 aot 1991) et la confirmation de la
version franaise par le dicastre concern (24 fvrier 1996), pour un
WH[WHGHQYLURQVLJQHVHWTXLRFFXSHSDJHVGX Missel des diman-
ches (format 12 x 19) ; comme rythme de production, cela faisait moins
GXQHSDJHSDUDQ !
GDXWUHV ODQJXHV 25, de faire bnficier leurs paroissiens de
tels progrs liturgiques en proposant eux-mmes une tra-
duction franaise de cette bndiction ?
Certes, les initiatives personnelles, dans la formulation
des prires liturgiques, ont ouvert la porte des drives de
tout genre. Celles-ci ont t dnonces systmatiquement
par certains milieux FDWKROLTXHV DX SRLQW GH IRFDOLVHU ODW-
tention des autorits suprieures sur les dviations et de les
HPSrFKHU GH SHUFHYRLU OD VLWXDWLRQ GXQH IDoRQ REMHFWLYH
Pour assainir ce climat perturb, un vque diocsain de-
mandait aux agents de la curie romaine de ne pas faire
constamment peser le soupon sur la vie liturgique des g-
lises particulires. Sa conclusion tait toute de bon sens :
Des drives il y en a eu et il y en a encore, pourquoi le
nier, on les combat plus par la formation que par la rpres-
VLRQ HW FHWWH WkFKH HVW GDXWDQW SOXV IDFLOH ORUVTXH OHVSHU-
VRQQHV FRQFHUQpHV FRPSUHQQHQW TXH OHIIRUW TXL OHXU HVW
GHPDQGp VH VLWXH GDQV OD SHUVSHFWLYH JOREDOH GH Oaggiorna-
mento voulu par le deuxime concile du Vatican.  ,O VLQ-
quitait aussi, j MXVWH WLWUH GH FKDQJHPHQWV GRULHQWDWLRQ
inopins propos des traductions liturgiques : En rcla-
mant de bonnes versions latines, le Saint-Pre comme le
cardinal, tout en respectant la lettre du Concile, ne vont-ils
SDVjOHQFRQWUHGHOLQGLVSHQVDEle inculturation de la litur-
gie que recommandait la Lettre apostolique du 4 dcembre
1988 ? 26

Dans cette situation indite de la liturgie romaine, dans


la mouvance du concile Vatican II, comment rguler au
PLHX[ OpODboration des traductions euchologiques ? Le di-
castre concern semble hsiter sur la voie suivre, comme
le montre la comparaison des dcrets de 1974 et de 1991,
tudis ci-dessus et que la juxtaposition dans un mme fas-

25. Par exemple la version allemande, Die Feier der Trauung in der
Messe, Herder, 1992.
26. Fr. Pierre RAFFIN, vque de Metz, propos du livre du cardi-
nal Ratzinger, /(VSULW GH OD OLWXUJLH , Esprit et Vie 54, 15 mars 2002,
p. 42-44.
cicule, largement diffus, rend GDXWDQW SOXV DFFHVVLEOHV
Dans le premier dcret, une certaine libert est recon-
nue aux Confrences piscopales, pour la traduction de
OpGLtion typique latine, tandis que dans le second dcret,
pour la prire eucharistique du synode suisse, la Congrga-
tion du Culte divin abroge les versions antrieures, rali-
ses avec une certaine libert , pour imposer un original
latin typique.
En faisant insrer ces deux dcrets, instituant des proc-
dures en sens inverse, le dicastre concern a peut-tre pro-
cd intentionnellement, pour informer les lecteurs de la
FRH[LVWHQFHGHSOXVLHXUVFRXUDQWVGDQVODGPLQLVWUDWLRQHF-
clsiastique, ou encore pour renouer avec une pratique tra-
diWLRQQHOOHGDQVOHQVHLJQHPHQWGXGURLWFDQRQLTXHHWGHOD
thoORJLH OD FRQIURQWDWLRQ Gauctoritates divergentes,
comme dans le Dcret de Gratien. Cependant, venant
GXQH LQVWDQFH GH JRXYHUQHPHQW HW QRQ GHQVHLJQHPHQW
une telle pratique comporte des inconvnients, car elle fait
apparatre un certaine inconstance dans la gestion de ce sec-
teur si important de la vie ecclsiale catholique. On entend
mme dire que certains piscopats attendent les prochains
FKDQJHPHQWV GH GLUHFWLRQ GX GLFDVWqUH DYDQW GHQWUHpren-
dre de nouvelles traductions.
Certes, on ne peut qXDGPLUHUODPDJQLILTXHERQQHYR-
ORQWp DIILFKpH SDU OH GLFDVWqUH FRQFHUQp 0DLV QHVW-ce pas
VHFKDUJHUGXQIDUGHDXLPSRVVLEOHjSRUWHUTXHGHYRXORLU
contrler la multitude des langues dornavant admises
pour la liturgie dite romaine ? La vigilance quLPSOLTXHXQH
telle perception de sa mission absorbe ce dicastre au point
GH OH GLVWUDLUH GXQH DXWUH DWWHQWLRQ SULPRUGLDOH SRXU XQ
lgislateur, le souci de la rception des documents promul-
JXpV2UODPLVHHQXYUHGHODUpIRUPHOLWXUJLTXHDGpMj
donnpOLHXjODSXEOLFDWLRQGXQHTXDQWLWpSKpQRPpQDOHGH
textes rglementaires, produits par les services du Saint-
Sige, au point que leur connaissance devient une affaire
de spcialistes hautement qualifis 27, une telle inflation

27. Ces textes ont dj t runis dans quelques compilations,


comPH OEnchiridion documentorum instaurationis liturgicae de Reiner
KACZYNSKI (ditions Marietti et C.L.V.), deux volumes parus, corres-
pondant respectivement la priode 1963-1973, avec 997 p. et 3216
dcourage les destinataireV HW OLPLWH GDXWDQW OD UpFHSWLRQ
des textes.
Dans une telle masse, la qualit des documents promul-
gus est ingale. Certaines argumentations et justifications
restent trop imprcises, ce qui nuit aussi leur rception.
Ainsi, le dcret du 6 aot 1991, concernant la PEMCP, ne
MXVWLILH OH QRXYHDX WH[WH TXH GXQH IDoRQ WUqV YDJXH :
tant donn que, depuis le dbut, le texte de cette Prire
eucharistique existe sous des formes diffrentes, en langue
allemande, franaise et italienne, il semble ncessairHGpWD-
blir un texte latin de cette prire qui soit propos tous
comme typique. Ce propos, il semble ncessaire QHVW
justifi par aucune rfrence.
2QpSURXYHODPrPHLQVDWLVIDFWLRQjODOHFWXUHGXQ Mo-
tu proprio du 15 aot 1972, Ministeria quaedam, concernant
FH TXRQ DSSHODLW MXVTXH Oj OHV RUGUHV PLQHXUV : Il con-
vient, eu gard la ralit elle-PrPHHWjODPHQWDOLWpGDX-
jourGKXL TXH OHV PLQLVWqUHV GRQW LO D pWp TXHVWLRQ QH
soient plus appels ordres mineurs, et que leur collation
soit dite non pas ordination , mais institution ; il con-
vient galement que soient tenus pour clercs seulement
ceux qui ont reu le diaconat. Par l apparatra mieux la
distinction entre clercs et lacs 28 La rfrence la men-
WDOLWpGDXMRXUGKXL tonne par son imprcision ; un tel ar-
gument ne parat justifi que par une convenance , dont
on aimerait mieux connatre la pertinence. Ces dcisions
SULVHV SDU ODXWRULWp URPDLQH DERXWLVVHQW j XQH UXSWXUH
dans la longue tradition des ordinations, des ministres et
du vocabulaire canonique. Pour une mutation aussi impor-
tante, les seuls arguments de convenance sont insuffisants,
des justifications plus substantielles seraient utiles 29.

paragraphes, et la priode fin 1973- fin 1983, avec 533 p. et 3212 para-
graphes.
28. Traduction insre dans l'dition franaise du Pontifical ro-
main, A.E.L.F., Les Ordinations, Paris Descle/Mame, 1986, p. 103.
29. Propos dvelopp dans notre article Le diaconat fminin dans
OKLVWRLUH , Mutter, Nonne, Diakonin, Frauenbilder im Recht der Ostkir-
che, (Kanon XVI, Jahrbuch der Gesellschaft fr das Recht der Ostkirche),
2000, p. 144-166.
3HQGDQWGHVVLqFOHVOpODERUDWLRQHWODUpFHSWLRQGHVWH[-
tes liturgiques ont t rgies par la coutume 30, pratique
EHDXFRXS SOXV VRXSOH HW PRLQV EUXWDOH TXXQ JRXYHUQH-
ment par des dcrets successifs, qui fait courir le risque de
conWUDGLFWLRQVFRPPHRQODVLJQDOpSOXVKDXW&HVWFHUWDL-
nement le modle de la coutume qui convient le mieux aux
missions actuelles des confrences piscopales, pour la rgu-
lation de la prire liturgique et de son expression dans les
langues parles. En ce domaine, en effet, les communauts
chrtiennes sont tributaires des usages locaux et de leurs
pYROXWLRQV SDUIRLV LPSUpYLVLEOHV2UODSUDWLTXHGXQHODQ-
gue ne se rgle pas par des mesures lgislatives. Pour une
mise jour rgulire des textes de prire, on peut souhaiter
un consensus sur quelques principes lmentaires, dont la
pULVH HQ FRPSWH GH OpYROXWLRQ GHV ODQJXHV GHV SURJUqV
dans les connaissances et les traductions bibliques et du pa-
triPRLQHOLWXUJLTXHGDXWUHVeJOLVHV

Dans les rflexions sur les modles pdagogiques ou po-


litiques, on recourt parfois la comparaison de la carapace
et de la colonne vertbrale. Une socit trop rglemente
HQWRXUH OLQGLYLGX GXQH FDUDSDFH TXL OH PDLQWLHQW HW OH
protge, mais bride ses mouvements. En notre poque de
PXWDWLRQV UDSLGHV HW GpFODWHPHQW GHV FXOWXUHV XQH FR-
lRQQHYHUWpEUDOHHVWSOXVDSSURSULpHTXXQHFDUDSDFH/DFD-
rapace, ce sont les interdits. La colonne vertbrale, ce sont
OHVSULQFLSHVGDFWLRQ3RXUWUDQVSRVHUODFRPSDUDLVRQGDQV
le registre chrtien, on peut considrer que la prsence du
Christ, tte de VRQ FRUSV HW OH GRQ GH O(VSULW 6DLQW DX[
baptiss affermissent la colonne vertbrale des communau-
ts, pour les rendre cratives dans la formation de coutu-
mes liturgiques.
&HWWH FRORQQH YHUWpEUDOHFHVWODORQJXHWUDGLWLRQGHOD
prire du peuple de Dieu, que le Christ a habite de sa

30. Voir Armando CUVA, article Droit liturgique , Domenico


SARTORE et Achille M. TRIACCA (dir.), Dictionnaire encyclopdique de
la Liturgie, DGDSWDWLRQ IUDQoDLVH VRXV OD GLUHFWLRQ G+HQUL DELHOU-
GNE, Brepols, 1992, vol. 1, p. 295.
prsence terrestre et que son Esprit a inspire aux diffren-
WHVpWDSHVGXQHKLVWRLUHTXLQHVDFKqYHUDTXjOD3Drousie.
Cette tradition doit tre connue et enseigne, comme
ODYDLW GHPDQGp OH FRQFLOH 9DWLFDQ ,, &Rnstitution sur la
liturgie, 23). Or, depuis quelques annes, en Europe du
moins, cet enseignement est devenu le parent pauvre dans
un nombre croissant de facults de thologie. Du fait des
UpGXFWLRQVGHEXGJHWFHVRQWOHVFKDLUHVGKLVWRLUHGHODOL-
turJLH TXRQ VDFULILH HQ FRQILDQW FHW HQVHLJQHPHQW j GHV
FROOqJXHVGRJPDWLFLHQV8QHWHOOHSROLWLTXHUpGXLWGDXWDQW
le potentiel de recherche dans une discipline que je conti-
nue prsenter comme la plus importante de toutes, puis-
que la liturgie est la source et le sommet de toute la vie des
communauts chrtiennes (Constitution sur la sainte Liturgie
10 et Dcret sur le ministre et la vie des prtres 5).

Marcel METZGER
Institut de droit canonique
Strasbourg
Auprs de mon arbre,
Je vivais heureux
-DXUDLVMDPDLVGPpORLJQHUGHPRQDUEUH
Auprs de mon arbre,
Je vivais heureux,
-DXUDLVMDPDLVGOHTXLWWHUGHV\HX[
Georges BRASSENS, Auprs de mon arbre

N
OUS DFINIRONS de faon lmentaire, dans
OH[SRVpTXLVXLWOLQWHUSUpWDWLRQFRPPHDttribu-
tion de signifi un texte 1. En droit, cette at-
tribution de signifi cette transforPDWLRQGXQHVpTXHQce
de signes en une autre squence de signes a pour but de
modiILHUODUpDOLWpHQGpWHUPLQDQWODFWLRQGHVGHVWLQDWDires

1. En gnral, les juristes ne se font pas prier pour indiquer dans le


WH[WH MXULGLTXH OREMHW GH OLQWHUSUtation (cf. R. SACCO, Interpreta-
zione del diritto. 'DWRRJJHWWLYRHVSLULWRGHOOinterprete , J. DERRIDA-
G. VATTIMO [dir.], Diritto, Giustizia, Interpretazione, Laterza, Roma-
Bari, 1998, p. 111 ; ID., Trattato di diritto civile, sous la direction de
R. Sacco, 2, /HIRQWLQRQVFULWWHHOLQWHUpretazione, UTET, Torino, 1999,
p. 163. /DXWHXU SUpFLVH TXH OLQWHUSUpWDWLRQ du droit ne peut pas tre
UpGXLWHjOLQWHUprtaWLRQGXWH[WH 'DXWUHSDUWGDQVQRWUHPHQtalit,
les coutumes ou les usages aussi sont dsormais rduits des textes :
TXLOVDJLVVHGHWH[WHVTXLOHVUHFXHLOOHQWHWOHVGpFUivent directement, ou
de textes qui recueillent les tmoignages, articuls en propositions, de
ceux qui les dcrivent (P. G. MONATERI, art. Interpretazione del dirit-
to , Digesto delle Discipline Privatistiche, Sezione Civile , X, UTET, Tori-
no, 1993, p. 33, note 3).
GXWH[WHWRXWHQQH[FOXDQWSDVTXLO\DLWGDXWUHVIRQctions
de cette lecture haute voix (dicere jus) comme par exem-
ple se donQHUGXFRXUDJHGDQVOREscurit de la nuit.
'DERUGXQHDOWHUQDWLYH
/DWWULEXWLRQGHVLJQLILpSHXWrWUHDUELWUDLUH QLKLOLVPH HW
impose aux autres, si on en a le pouvoir, avec un seul argu-
ment : quia nominor leo, auctoritas dixit 2. &HVWODUJXment le
SOXVHIILFLHQWHQSUDWLTXHPDLVGDSUqVV7KoPDVG$quin,
le plus faible en thorie (I, q. I, art. 8, sol. 2).
2XELHQDXFRQWUDLUHOLQWHUSUpWDWLRQSHXWrWUHIRQGpHVXU
des arguments autres que la force, qui sauront convaincre les
destinataires (et peut-rWUHODXteur lui-PrPHGHOLQWHUSUpWDWLRQ 
de la justesse de la dcision interprtative propose (de sa cor-
respondance ou de sa proximit, si vous voulez, la Vrit).
&HV DUJXPHQWV QRQ YLROHQWV TXL PRWLYHQW OLQWHUprta-
tion 3 QH VRQW GDSUqV *LRYDQQL 7DUHOOR TXH les figures
rhWRULTXHV XWLOLVpHV DILQ GH SHUVXDGHU OLQWHUSUqWH DXWRUL-
WDLUHGDWWULEXHUjXQWH[WHGHORLXQVLJQifi particulier 4.
(QVHUpIpUDQWjOH[SpULHQFHSURIHVVLRQQHOOHGHVMXULVWHVOH
profeVVHXU 7DUHOOR D H[DPLQp WUHL]H W\SHV GDUJXPHQWV TXL
perPHWWHQW GLQWHUSUpWHU OHV WH[WHV HQ IRQFWLRQ GH OLQWHQWLRQ

2. Parce que je suis le lion $UJXPHQWGDXWRULWp OH[SUHVVLRQVRQQH


comme un oxymore. Si, en effet, on se place dans le champ du savoir et si la
persSHFWLYHHQYLVDJpHHVWFHOOHGHFRQQDvWUHODYpULWpOH[SUHVVLRQ argument
GDXWRrit apparat comme contradictoire. /LQWHUYHQWLRQ GXQ DUJX-
PHQWGDXWRULWpFO{WODUJXPHQWDWLRQSURSUHPHQWGLWHHWVLJQHOLPSXLV-
sance convaincre : M. SACHOT, /DUJXPHQWGDXWRULWpGDQVOHQVHL-
gnement thologique au Moyen ge : lHVJUDQGVpWDSHVGXQHpYROXWLRQ
(XIe-XIIIe sicle) , Rhtorique et Pdagogie, sous la direction de O. REBOUL
et J.-F. GARCIA, Presses Universitaires de Strasbourg, 1991, p. 111-112.
Sur cet argument, voir aussi CH. PERELMAN-L. OLBRECHTS-TYTECA,
7UDLWpGHODUJXPHQWDWLRQeGLWLRQVGHO8QLYHUVLWpGH%UX[HOOHV%UX[HOOHV
19763, 70 ; R. PEREZ PERDOMO, /DUJXPHQWGDXWRULWpGDQVOHUDLVRQ-
nement juridique , Archives de Philosophie du Droit, 16 (1971), p. 227-
244 ; P. VASSART (dir.), ArguPHQWGDXWRULWpHWDUJXment de raison en droit,
Nemesis, Bruxelles, 1988.
3. Sur le lien interprtation-DUJXPHQWDWLRQDXVHQVRORQQHSHXWSDV
interprter sans argumenter, ni argumenter sans interprter, cf. P. R,&85,
Interprtation et / ou argumentation , ID., Le Juste, ditions Esprit, Paris,
1995, p. 163-184 ; F. VIOLA-G. ZACCARIA, Diritto e Interpretazione. Linea-
menti di teoria ermeneutica del diritto, Laterza, Roma-Bari, 1999, p. 98 et s.
4. G. TARELLO, art. Argomenti interpretativi , Digesto delle Disci-
pline Privatistiche, Sezione Civile, I, UTET, Torino, 1987, p. 420.
TXH ORQ DWWULEXH DX OpJLVOateur 5 (nous restons donc dans la
persSHFWLYHGHOintentio auctorisW\SLTXHGHOKHUPpneutique
traditionnelle et du droit canonique officiel ). La rcur-
rence constante de ces topiques en fait des universels du dis-
cours juridique.
Cham Perelman, dans son livre sur la Logique juridique, a
accept, en la consacrant, la liste fixe par Tarello 6, bien
TXHOOHQHVRLWSDVODVHXOHSRVVLEOH 7. La voici ODUJXPHQW
a contrario ;  ODUJXPHQW a simili (ou analogie)   ODUJX-
ment a fortiori ; ODUJXPHQWa completudine ; ODUJXPHQWa
coherentia ; ODUJXPHQWSV\FKRORJLTXH ODUJXPent histo-
rique   ODUJXPHQW DSDJRJLTXH ou de rduction
ODEVXUGH ODUJXPHQWWpOpRORJLTXH ODUJXPHQWpFRno-

5. ID, Communication sur la spcificit du raisonnement juridi-


que , Actes du Congrs de Bruxelles de 1971, Die juristische Argumen-
tation, Archiv fr Rechts und Sozialphilosophie, Beiheft, Neue Folge 7,
Steiner, Wiesbaden, 1972, p. 104-108.
6. CH. PERELMAN, Logique juridique. Nouvelle rhtorique , (1979),
Dalloz, Paris, 1999, p. 55-59.
7(QHIIHWODOLVWHGDUJXPHQWVLQWHUSUpWDWLIVIL[pHSDU7DUHOORHWDc-
cepWpH SDU 3HUHOPDQ QHVW SDV XQLYHUVHOOHPHQW UHoXH WHOOH TXHOOH
'DSUqV R. GUASTINI (art. Interpretazione, I. Interpretazione dei testi
normativi , Enciclopedia Giuridica, XVII, Treccani, Roma, 1989, p. 4),
par exemple, un inventaire complet des arguments utiliss par les inter-
prtes est hors discussion. Ce mme auteur, nanmoins, propose (p. 4-5)
XQHOLVWHGDUJXPHQWVTXLVHPEOHrWUH couverte par la liste de Tarello.
'DSUqV/LOMBARDI VALLAURI, Jurisprudence , Archives de Philosophie
du Droit, 35, 1990 (fascicule consacr au Vocabulaire fondamental du
droit  S  OHV W\SHV FRQFUHWV GLQWHUSUpWDWLRQ VRQW au moins dix-
huit, si on se borne aux combinaisons les plus plausibles entre les alterna-
tiYHVVLJQDOpHV . R. SACCO, Le fonti, op. cit., p. 205, rappelle aussi la
OLVWH GH /DUHQ] VL[ PR\HQV GLQWHUSUpWDWLRQ  HW OD VLHQQH RQ]H  (Q
UpDOLWpODGRFWULQHGHOutrumque ius avait dj rdig des listes de modi
arguendi , extraits du droit romain mais aussi du Dcret et des Dcr-
WDOHV/DXWHXUOHSOXVVHQVLEOHGDQVOHGRPDLQHGXGURLWFDQRnique est
peut tre Dino del Mugello, dit par S. CAPRIOLI  'H PRGLV DUJ-
venGLVFULSWDUDULRUD : 1. Dini opvsculum , Studi senesi, 3me srie, 12,
1963, p. 30-56 ; voir aussi ID'HPRGLVDUJYHQGLVFULSWDUDULRUD : 2.
Ranieri Summa super modo arguendi , ibid., p. 107-190. Caprioli est
revenu sur ce sujet dans un article rcent : 0RGLDUJXHQGL Testi per
lo studio della retorica nel sistema del diritto comune , Studi medievali,
3me srie, XLVI, fasc. I, juin 2005, p. 1-29. Je tiens remercier mon
FROOqJXH0DULR&RQHWWLKLVWRULHQGXGURLWHWWKpRORJLHQTXLPDVLJQa-
l ce genre littraire et son importance.
mique ; 11. ODUJXPHQW ab exemplo ODUJXPHQWV\VWpma-
tique ODUJXPHQWQDWXUDOLVWH
Ce sont les outils du juriste, les moyens employs depuis
toujours, de faon consciente ou inconsciente, par les inter-
SUqWHVDILQGHMXVWLILHUOHXUVFKRL[GDWWULEXWLRQGHVLJQifi
un texte 8.
Parfois, certains de ces arguments interprtatifs sont for-
maliss par le lgislateur dans le texte mme de la loi, les
autres resWDQW KRUV GX WH[WH &HVW OHFDVSDU H[HPSOHGHV
canons 6, 17 et 19 du CIC de 1983.
Dans le can. 6, 2 ( Les canons du prsent Code, dans
ODPHVXUHRLOVUHSUHQQHQWODQFLHQGURLWGRLYHQWrWUHLn-
terprts en tenant compte aussi de la tradition canonique
[ Canones huius Codicis, quatenus ius vetus referunt aesti-
mandi sunt ratione etiam canonicae traditionis habita ]), on
SRXUUD YRLU ODUJXPHQW KLVWRULTXH 9, mais aussi une sorte
GDUJXPHQWa simili ou par analogie 10.
Dans le can. 17 nous trouvons, immdiatement aprs
OpQRQciation du critre littral ( Les lois ecclsiastiques doi-
vent tre comprises selon le sens propre des mots dans le
WH[WH [ Leges ecclesiasticae intelligendae sunt secundum pro-
SULDPYHUERUXPVLJQLILFDWLRQHLQWH[WX @ ODUJXPHQWV\Vtma-
tique ( HWOHFRQWH[WH [ et contextu ]) ODUJXment a simili
ou par analogie ( il faut recourir aux lieux parallOHV [ ad
locos parallelos est recurrendum ]) ; ODUJXPHQW WpOpRlogique
( la fin de la loi [ ad legem finem ]) ODUJXment histori-
que ( aux circonstances de la loi [ ad circumstantias ]) ;

8/HVDUJXPHQWVLQWHUSUpWDWLIVVRQWXQHJULOOHGDQDO\VHSOXVVRSKLV-
tique que les quatre canons grammatical, logique, historique, syst-
matique codifis par Carl Friedrich von Savigny (cf. C.F. VON SAVI-
GNY, System der heutigen rmischen Rechts, d. Veit und Comp., Berlin,
1840, I, 33), qui peuvent tre ramens aux premiers. Les critres tradi-
tionnels de solution des antinomies par voie interprtative lex specialis
derogat legi generali ; lex superior derogat legi inferiori ; lex posterior derogat
legi priori QHVRQWTXXQHDSSOLFDWLRQGHODUJXPHQWa coherentia (cf. R.
GUASTINI, Interpretazione , op. cit., p. 36).
9. Cf. H. SCHNIZER, Traditio canonica und vigens disciplina, die
eine und die andere Kontinuitt im kanonischen Recht , L. C. MOR-
SAK-M. ESCHER (Hrsg), Festschrift fr Luis Carlen zum 60. Geburtstag,
Schulthess Polygraphischer Verlag, Zurich, 1989, p. 373.
10. Cf. G. MAY-A. EGLER, Einfhrung in die kirchenrechtliche Methode,
Pustet, Regensburg, 1986, p. 213-215.
ODUJXPHQW SV\FKRORJLTXH j OHVSULW GX OpJLVlateur [ ad
mentem legislatoris ]).
DanV OH FDQ  QRXV DYRQVGHQRXYHDXODUJXPHQW a
simili RXSDUDQDORJLHVRXVOHVGHX[IRUPHVGHOanalogia legis
( HQWHQDQWFRPSWHGHVORLVSRUWpHVSRXUGHVFDVVHPEOa-
bles [ DWWHQWLEXV OHJLV ODWLV LQ VLPLOLEXV@  HW GH Oanalogia
juris ( des prinFLSHVJpQpUDX[GXGURLW [JHQHUDOLEXVLXULV
prinFLSL])  HW ODUJXPHQW QDWXUDOLVWH TXRQ SHXW OLUH GDQV
la clause appliqus avec quit canonique ( cum aequi-
tate canonica servata  VL ORQ DFFHSWH OD UHODWLRQ GpTXLva-
OHQFH HQWUHOpTXLWpHWOa nature des choses dtermine par
Dieu (quivalence dont les passages seraient les suivants :
aequitas sive caritas sive Deus sive natura). Et enfin  ODUJX-
ment a simili ou analogie, encore, savoir la prfrence
pour une interprtation analogue celle donne prcdem-
PHQWSDUXQDXWUHLQWHUSUqWHSRXUYXGDXWRULWp MXJH ; admi-
nistrateur de la Curie romaine) ou qui fait autorit (com-
munaut des docteurs).
Revenons un instant sur le critre littral qui ouvre le ca-
talogue du can. 17, pour rappeler TXHGDSUqVODWKpRULHJ-
nrale contemporaine du droit, une chose comme le sens
propre des mots en tant que signifi incorpor  QH[LVWH
pas, le langage normatif, comme tout langage, tant vague et
ambigu 11 (ou, pour le dire avec les mots plus nuanFpVGXQH

11. Cf. par exemple R. GUASTINI, Interpretazione , op. cit., p. 3 ;


P. G. MONATERI, Interpretazione , op. cit, p. 34-35 ; R. SACCO, Le
fonti, op. cit., p. 175 et s. (et la bibliographie cite dans les notes), qui
considre comme un lieu commun dans la doctrine contemporaine la
FRPSDWLELOLWpGXQWH[WHLVROpGXFRQWH[WHDYHFSOXVLHXUVVLJQLILpV ; CH.
ATIAS, Philosophie du droit, Puf, Paris, 1999, p. 256, parle, propos du
VHQVOLWWpUDOGHODORLGXQSKDQWDVPH ; voir aussi les importantes pr-
cisions de M. BARBERIS, Seguire norme giuridiche, ovvero FRVDYUjPDLD
FKH IDUH :LWWJHQVWHLQ FRQ OD WHRULD GHOOLQWHUSUHWD]LRQH JLXULGLFD ? , Mate-
riali per una storia della cultura giuridica, 21 (2002), p. 248-249. Parmi les
canonistes, O. FUMAGALLI CARULLI, 6RJJHWWLYLWjGHOOLQWHUSUHtazione e
diritto della Chiesa , Il Diritto Ecclesiastico, 81, 1970, I, p. 108-109 ; H.
PREE, Ius divinum between normative text, normative content, and
material value structure , The Jurist, 56, 1996, p. 65 (qui dit que there
LVQRSURSHUPHDQLQJVRIZRUGV 9RLUDXVVL H. PREE, Die evolutive
Interpretation der Rechtsnorm in kanonischen Recht, Herder, Wien-New
York, 1980, p. 252-256 ; R. TORFS, Propria verborum significatio : de
OpSLVWpPRORJLHjOKHUPpQHXWLTXH , Studia canonica, 29, 1995, p. 181 ;
J. L. GUTIRREZ, La interpretacin literal de la ley , Ius canonicum,
approche hermneutique  OLQWHUSUpWDWLRQ OLWtrale est in-
conFHYDEOH j OpWDW pur ) 12 'R OD QpFHVVLWp GH UHFRXULU
immdiatement aux critres suivants du can. 17 13, que la
doctrine canonique no-exgtique ne considre que
comme subsidiaires 14.

35, 1995, p. 558- ODXWHXU VLJQDOH TXH OXWLOLVDWLRQ GHV WUDGXFWLRQV


du Code loigne la plupart des interprtes de la Lettre originelle du
texte : p. 554 et 557) ; A. PRIETO PRIETO, La interpretaFLyQDGPHQ-
WHP , ibid., 572-573 ; W. KOWAL, O. M. I., Some remarks on un-
derstanding the concept of propria verborum significatio , Studia ca-
nonica, 34, 2000, p. 489-504 ; ID., Understanding canon 17 of the
1983 Code of canon Law in light of contemporary hermeneutics, Edwin
Meller Press, Lewiston, 2000. Le clbre dbat entre les professeurs
Hart et Fuller est toujours une rfrence actuelle, bien que banale,
par rapport ce sujet$ILQGLOOXVWUHUOH[LVWHQFHGXQHDXUDGHSpQRP-
EUHDXWRXUGXQQR\DXFODLUGHVLJQLfi de la norme, H. L. HART ( Posi-
tivism and the Separation of Law and Morals , Harvard Law Review,
71, 1978, p. 593- pYRTXDLWOK\SRWKqVH suivante VLjOHQWUpHGXQ
SDUF LO \ D ODIILFKH entre interdite aux vhicules  OLQWHUSUpWDWLRQ
littrale ne rsout pas le doute de savoir si un vlo est compris dans la
dfense, tout tant la lettre un vhicule. Mais, ajoute L. FULLER
( Positivism and Fidelity to Law. A Reply to Professor Hart , Harvard
Law Review, 71, 1958, p. 630-633), si un camion militaire est plac dans
le parc comme monuPHQWFHFDPLRQQHVWSDVFRQVLGpUpFRPPH vhi-
cule DXVHQVGHODQRUPHGRQWOLQWHUprtation littrale est donc exclue.
Le signifi clair rsultant du contexte interprtatif, il y a donc des cas o
OLQWHUSUpWDWLRQOLWWpUDOHHVWLPSRVVible.
12. Cf. F. VIOLA-G. ZACCARIA, Diritto e Interpretazione, op. cit.,
p. 225-227 (mais voir aussi p. 116-117).
13. Ce qui tait admis par G. MICHIELS, Normae generales iuris canonici.
Commentarius libri I Codicis iuris canonici, editio altera penitus retracta et
notabiliter aucta, Descle et Socii, Paris, 1949, p. 516 : Jamvero credimus ex
sola formulae inspectione de facto numquam cum certitudine exurgere sensum
verum a legislatore reapse intentum, sed, ut certitudo illa omnimoda habeatur,
primam interpretationis regulam semper esse regulis subsidiariis complemdam .
R. TORFS, Propria verborum significatio , op. cit., p. 181, signale que
SRXU $9DQ+RYH DXVVL OHVHQVSURSUHGHVPRWVQDSDVXQHVLJQLfica-
WLRQ XQLYRTXH PrPH VLO SURSRVH OH UHFRXUV j GHV WHFKQLTXHV GLQWHU-
prtation pour la dterminer (cf. A. VAN HOVE, De legibus ecclesiasticis.
Commentarium Lovaniense in Codicem iuris canonici , I, I, Dessein, Mecli-
niae-Romae, 1930, p. 262, n 253). Cf. aussi R. PUZA, Katholisches Kir-
chenrecht, Heidelberg, C. F. Mller, 19932, p. 127.
143RXUORSLQLRQTXHOHFULWqUHOLWWpUDOVHWURXYHVXUXQSODQVXp-
rieur par rapport aux autres critres, cf. J. OTADUY, Los medios inter-
pretativos de la ley cannica (y su relacin con las distintas doctrinas de
la interprtacion) , Ius canonicum, 35, 1995, p. 495-497. Cf. aussi L.
Un autre aspect peut-tre relev par rapport au fait que
nous venons de considrer ensemble le can. 17, contenant les
critres interprtatifs , et le can. 19, consacr au droit sup-
pltoire FHVWFHOXLGXGURLWTXLYDVXppler aux lacunes
de la loi. Malgr le sujet apparemment diffrent des deux dis-
posiWLRQVOHFDQQDSDVIRUFpPHQWTXXQHIRQction sup-
plWRLUHPDLVDXVVLXQHIRQFWLRQGLQterprtation de la loi 15,
SRXUQHSDVGLUHTXHOLQWpJUDWLRQGHODORLest interprtation 16,
RXTXHOLQWHUSUpWDWLRQHVWHQUpDOLWpFUpDWLRQ17.

MLLER, Codice di Diritto Canonico e Concilio. La dottrina del Con-


FLOLR9DWLFDQR,,TXDOHFRQWHVWRSHUOLQWHUSUHWD]LRQHGHOOHQRUPHFDQR-
niche , Annuario DiReCom, 1/2002, Diritto canonico e interpretazione,
sous la direction de L. Gerosa, A. Neri, L. Mller, p. 62-63.
15. Pour la WKqVHVHORQODTXHOOHOHVGLVSRVLWLRQVGXFDQQRQWSDV
seulement la fonction intgrative de combler les lacunes de la loi, mais
DXVVL OD IRQFWLRQ GLQWHUSUpWDWLRQ GH OD ORL YRLU J. M. GONZLEZ DEL
VALLE, Dottrina, giurisprudenza e prassi nella costruzione del sistema
canonico , J. I. ARRIETA-G. P. MILANO (dir.), Metodo, fonti e soggetti del
diritto canonico. Atti del Convegno Internazionale di Studi La Scienza
FDQRQLVWLFDQHOODVHFRQGDPHWjGHO)RQGDPHQWLPHWRGLHSURVSHWWLYH
LQ '$YDFN /Rmbardia, Gismondi e Corecco . Roma, 13-16 novembre
1996, Libreria Editrice Vaticana, Citt del Vaticano, 1999, p. 394-402.
'DSUqVFHWDXWHXULOIDXW GLVWLnguer les vritables lacunes (comme par
exemple les cas o le lgislateur pose une norme programmatique sans
disSRVHUOHVQRUPHVGDSSOLFDWLRQ GHVK\SRWKqVHVROLQWHUSUqWHFRQsi-
dre une loi existante irrationnelle, donc inapplicable. Mais on pourrait
parler, pour dcrire les deux situations, de lacunes formelles et de
lacunes matrielles (cf. S. BERLING, Diritto canonico, Giappichelli,
Torino, 1995, p. 57 et 141). Au fond, nous retrouvons le problme de
la nature GHOLQWHUSUpWDWLRQ VLPSOHUpSpWLWLRQGXQWH[WHHQGDXWUHV
mots, ou production du sens juridique " 6XU ODYDOHXU GLnterprtation
de la praxis et de la jurisprudence, voir aussi J. OTADUY, Los medios ,
op. cit. S  TXLUDSSHOOHOHVGLVFRXUV GX SDSH jOD5RWHRORQUe-
FRQQDvW j OD MXULVSUXGHQFH GH OD 5RWH XQ U{OH GLQWHUprtation authen-
tique. On remarquera combien, en droit canonique, la doctrine tradi-
tionQHOOH VH FRQFHQWUH VXU ODVSHFW FRJQLWLI GH OLQWHUprtation, ne re-
connaissant que celui-FLHWVpSDUHQHWWHPHQWOLQWHUprtation de la loi de
ODSSOLFDWLRQ FIH. PREE, Le tecniche di flessibilizzazione del diritto :
possibilit e limiti ecclesiali di impiego , Ius Ecclesiae, 12, 2000, p. 389,
QRWHDYHFGDXWUHVUpIpUHQFHV 
16. On peut combler une lacune par voie interprtative, savoir en
modiILDQW OLQWHUSUpWDWLRQ SUpFpGHQWH GHV GLVpositions en question, de
faon que la lacune ne se prsente plus : on emploie cette fin, gnra-
lePHQWODUJXPHQW a completudine. Ou bien on peut combler la lacune
en intgrant le droit, savoir en crant une nouvelle norme ; dans ce
/ars interpretandi DORUV QH VHUDLW ULHQ GDXWUH TXH Oars
combinatoria qui joue avec les arguments interprtatifs.
3RXUWDQWLO\DGHVUDLVRQVGHFURLUHTXHOLQWHUSUptation,
plXW{WTXXQHVFLHQFHHVWQRQVHXOHPHQWXQDUWPDLVDXVVL
un art dramatique.

cas, les interprWHV SUpIqUHQW FDFKHU OLQWpJUDWLRQ / FUpDWLRQ GXQH QRu-


YHOOHQRUPHVRXVOHVSqFHGXQH VLPSOHLQWHUSUpWDWLRQGHVQRUPHVH[Ls-
tantes  RQ HPSORLH JpQpUDOHPHQW ODUJXPHQW a simili ODUJXment a
contrario, les recours aux principes gnraux, les normes obtenues de la
combinaison ( sur le fondement ) de deux ou plusieurs dispositions :
cf. R. GUASTINI, Interpretazione , op. cit. S  ,O VDJLW WRXMRXUV
GDSSOLTXHUGHVDUJXPHQWVLQWHUSUWDWLIVGRQFGLQWHUSUpWDWLRQDXVHQV
large. En plus, on peut remarTXHU TXLO \ DGHVFDVROLQWHUprtation
(extenVLYH  QH SHXW SDV rWUH GLVWLQJXpH GH OLQWpJUDWLRQ DQDORJLH : cf.
encore R. GUASTINI, Interpretazione , op. cit., p. 7.
17. Ce qui est admis mme par des canonistes probati tels que O. FUMA-
GALLI CARULLI, Soggettivit , op. cit.S SRXUODTXHOOHORUJDQHHFFOp-
siasWLTXH HQDSSOLTXDQWOHGURLWGLYLQMRXLWGXQHOLEHUWpSOXVJUDQGHTXH
FHOOH GH OLQWHUSUqWH GX GURLW FLYLO , ou G. LO CASTRO, Conocimiento y
interpretacin del derecho , Ius canonicum, 35, 1995, p. 401 et 405.
'DQV OH VHQV GXQH LQWHUSUpWDWLRQ GH OD ORL FDQRQLTXH IRUFpPHQW FUpD-
tive, voir aussi G. MAY-A. EGLER, Einfhrung, op. cit., p. 183-186 ; H.
PREE, Ius divinum , op. cit., p. 64-65 ; L. RSY, The Interpreter and his
Art, The Jurist, 40, 1980, p. 51 ; ID., Integrated Interpretation ; or, the
Role of Theology in the Interpretation of canon Law , Studia canonica,
22, 1998, p. 255 ; A. ALBISETTI, Ermeneutica giurisprudenziale,
diritto canonico e common law , Il diritto ecclesiastico, 112 (2001),
p. 403-412. 'DSUqV J. OTADUY, Los medios , op. cit., p. 476, Pero
hay siempre una frontera entre interpretacin del derecho y creacin
del derecho, por mucho que esa frontera en ciertas ocasiones se haga
tenue . Sur la crativit ncessaire  GH OLQWHUSUqWH HW GH OD MXULVpru-
dence, voir particulirement L. LOMBARDI VALLAURI, Interprtation ,
op. cit.SHWV/DUWGHOLQWHUSUqWHGXGURLWVHUDLWXQDUWFUpDtif de
OD PrPH IDoRQ TXH ODUW GX PXVLcien et du comdien, qui, eux aussi,
VRQWDSSHOpVjIDLUHUHYLYUHXQWH[WHQHSRXYDQWSDVVpSXLVHU au con-
WUDLUHGHOXYUHGXQSHLQWUHRXGXQVFXOSWHXU dans la simple ins-
tallation GDQVOHPRQGHSDUODXWHXU : cf. O. CAYLA, La souverainet
dH ODUWLVWH GX VHFRQG WHPSV  Droits. Revue franaise de thorie juri-
dique, 16, 1990, p. 129-147, qui applique au droit une distinction la-
bore par le philosophe du thtre H. GOUTHIER, Le Thtre et les arts
deux temps, Paris, Flammarion, 1989.
/HSUREOqPHGHOLQWHUSUpWDWLRQFRQVLVWHGDQVOHIDLWTXH
QRXVQDYRQVSDVGHPpWD-critre qui nous permette de choi-
sir parmi les diffrents critres abstraitement employables
TXLOV VRLHQW FRGLILpV RX SDV ; nous ne savons pas quel cri-
tre prfrer 199RLFLOHSUHPLHUGUDPHSRXUOLQWHUSUqWHDX
PLOLHX GXQ FDUUHIRXU R VL OH ERQ VHQV lui interdit cer-
taines voies comme impraticables 20 SOXV GXQH GLUHFWLRQ
est nanmoins possible 216LORQVHERUQHSRXUOLQVWDQWj

181RXVFRQWUHIDLVRQVELHQpYLGHPPHQWOHWLWUHGXQFpOqEUHDUWL-
cle de J. CARBONNIER, /D SDUW GX GURLW GDQV ODQJRLVVH FRQWHPSo-
raine  TXRQ SHXW OLUH GDQV ID., Flexible droit. Pour une sociologie du
droit sans rigueur, Paris, 200110, p. 201 et s.
19. Dj Carl Friedrich von Savigny, auquel nous devons la pre-
mire codiILFDWLRQGHTXDWUHFDQRQVGLQWHUSUpWDWLRQ FI System, op. cit.,
loc. cit. DYDLWDGPLVTXLOQ\DSDVXQRUGUH a priori parmi ces critres.
/LQXWLOLWp GHVFULWqUHVLQWHrprtatifs, DILQGHFRQGXLUH VUHPHQWOLQWHU-
prte la solution conforme au droit, est remarque avec des accents
diffrents par plusieurs auteurs qui ont contribu au volume Diritto,
Giustizia, Interpretazione, op. cit. /XQGHFHVDXWHXUVVHVWLOOXVWUpUcem-
ment sur le sujet de faon systmatique, dans Le fonti, op. cit., p. 201 et
V /DQDO\VH GHV WHFKQLTXHV GDUJXPHQWDWLRQ FKH] GHV WKpRULFLHQV WHOV
TXH5'ZRUNLQ5$OH[\0$WLHQ]DFRQGXLWHSDU3DXO5LFXU GDQV
Interprtation et / ou argumentation , op. cit.) est trs problmatique,
et finalement tragique, mais pas nihiliste. Les canons interSUpWDWLIV>@
VRQWLQFHUWDLQVGDQVOHXUVLQGLYLGXDWLRQDLQVLTXHGDQVORUGUHGHSULR-
rit de leur usage. Ils dpendent de la communaut interprtative et de
la culture juridique commune : F. VIOLA-G. ZACCARIA, Diritto e Inter-
pretazione, op. cit., p. 102.
20. Cf. U. ECO, /HV/LPLWHVGHOLQWHUSUpWDWLRQ, tr. fr., Grasset, Paris,
GqVOLQWURGXFWLRQ SHW HW passim6XUOLPSUDWLFDELOLWpGH
OLQWHUprtation aberrante en droit, voir R. SACCO, Le Fonti, op. cit.,
p. 204-205, 262, 280-281.
21. Les explications par des exemples pratiques sont infinies. Elles
concernent le champ du droit matrimonial canonique le domaine le
plus frquent par les interSUqWHVGXGURLWGHOeJOLVH et on pourra se
VRXYHQLU GH ODQDO\VH GH - T. Noonan, Jr. sur la jurisprudence de la
Rote. Son tude sur les arguments interprtatifs employs par ce tribu-
nal montre que les expressions utilises par la jurisprudence sont in-
comprhensibles par les fidles ( Sexual, but limited in procreative in-
tent ; consummated by sexual intercourse ; Impermanent by intention,
custom, or assumption ; contracted by two baptized persons ). La dcla-
ration ou non de nullit du maULDJH UpVXOWH GXQ FKRL[ DSSDUHPPHQW
une perspective tout fait technique, la plus grande erreur
a t RQ OD GLW GDYRLU FUX TXLO \ DYDLW XQH KLprarchie
entre analogie, principes gnUDX[ HWF GH IDoRQ TXRQ
pouvait se rfrer aux principes gnraux seulement quand
ODQDORJLHQHUsolvait pas la question, etc., la dernire place
pWDQW j ORSLQLRQ FRPPXQH HW FRQVWDQWH GHV GRFWHXUV 22.
En effet, dans la liste du can. 19 (analogie, principes gn-
UDX[DSSOLTXpVVHORQOpTXLWpFDQRQLTXHMurisprudence, pra-
xis de la Curie romaine, opinion commune et constante des
docteurs), OpTXLWpQHVWTXXQSDUDPqWUHTXLOIDXWDSSOLquer
en recourrant aux principes gnraux, et ne semble pas avoir,
GDSUqVOHWH[WHGXFDQRQXQHIRQFWLRQpPLnente par rapport
aux autres facteurs. Mais les docteurs (les interprtes !) rcu-
prent ce rle minent en faisant interveQLUOpTXLWpGDQVOHV
cas o ils trouvent la loi ou la coutume irrationnelle 23 (ce qui
dterPLQH GDSUqV FHUWDLQV DXWHXUV XQH ODFXQH mat-
rielle ), ou bien, en sortant du texte, en considUDQWOpTXLWp
comme une source KRUVGHORUGUH ( fons extra ordinem
ou extraordinaire ) 24. Donc, on quitte la norme tablie

alatoire de la cour ( indissoluble or invalid at the option of the courts ) :


cf. J. T. NOONAN, Jr., Power to Dissolve. Lawyers and Marriages in the
Courts of the Roman Curia, The Belknap Press of Harvard University
Press, Cambridge, Mass., 1972, p. 403.
22. J. M. GONZLEZ DEL VALLE, Dottrina , op. cit., p. 401. Contra,
G. FELICIANI, /$QDORJLD QHOORUGLQDPHQWR FDQRQLFR, Giuffr, Milano,
 S  GDSUqV OHTXHO ODQDORJLH HVW WRXMRXUV j SUpIpUHU HQ WDQW
TXXWLOLVDWLRQ GXQH ratio dj prsente dans le systme, et non pas
craWLRQ GXQH QRXYHOOH ratio GHODSDUWGHOLQWHUSUqWH ; pour une liste
GDXWHXUVTXLWRXWHQQH FRQVLGpUDQWSDVREOLJDWRLUHORUGUHGXFDQRQ
20 CIC 1917 (le prcurseur du can. 19 CIC 1983), donnent leur prf-
UHQFHjODQDORJLHibid., p. 130-131, en note.
23. Cf. O. FUMAGALLI CARULLI, art. Equit, III), Equit cano-
nica , Enciclopedia Giuridica, Treccani, Roma, XII, 1989, p. 2.
24. 3RXU OpTXLWp FRPPH VRXUFH extraordinaire , cf. S. BERLING,
Diritto canonico, op. cit., p. 30. Cet auteur a illustr dans ses travaux (infra
note 61), depuis La Causa pastorale della dispensa, Giuffr, Milano, 1978,
le paralllisme entre la tradition latine de la dispensatio  GRQWOaequitas
HVWOH[SUHVVLRQSDUH[FHllence) et la tradition orienWDOHGHO oikonomia .
'DQV OH VHQV GXQH pTXLYDOHQFH HQWUH aequitas non scripta et oikonomia,
voir aussi T. SCHLLER, Die Barmherzigkeit als Prinzip der Rechtsapplica-
tion in der Kirche im Dienste der salus animarum. Ein Kanonistischer Bei-
trag zu Methodenproblem der Kirchenrechtstheorie, Wrzburg, 1993,
p. 433-438. M. WIJLENS, Salus animarum suprema lex : merci as a legal
SRXUODQRXYHOOHQRUPHTXHOLQWHUSUqWHYLHQWGHSRVHUHQVH
fondant VXUGDXWUHVFULWqUHV, extra-textuels.
Par ailleurs, on parvient reconnatre un rle prdomi-
QDQWjOaequitas GDQV ODSHUVSHFWLYHGHOLQWHUSUqWHcomme
reconstructeur de la volont du lgislateur : VLOIDXWVXUOD
base du can. 17, recourir au critre de la mens legislatoris, et
si la mens du lgislateur ne peut tre que raisonnable 25 (du
moins celle du Lgislateur divin), et si rationabilitas = caritas
= aequitas = Deus, il faudra touMRXUVDSSOLTXHUOaequitas 26.
Mais, dans ce cas, sur quels critres se fonder ?
%LHQVUFHODHVWYUDLVLOaequitas quivaut la caritas, sur
le fondement de la UqJOHGRU GHODPRXUGXSUochain 27.
Mais, malheureusement, ce principe directif peut se rvler
WUqV GLIILFLOH GDSSOLFDWLRQ HQ SUDWLTXH GX IDLW TXH ORQ QH
peut tre pas tre certain du chemin par lequel on atteindra
OH ELHQ GHODXWUH ,OQHVWSDV GKRPPHDVVH]MXVWHVXUOD
terre pour faire le bien sans jamais pcher : Eccl 7,20).
Il est bien connu notamment chez Isaiah Berlin, que la
problmatique de la morale est finalement rductible la
problmatique des choix tragiques 28. On pourrait penser la
mme chose du droit qui, tout comme la mRUDOH VLO QH
veut pas trahir sa vocation de science pratique, ne peut pas
VHSDVVHUGHOLQWHUSUpWDWLRQTXLO actualise et le rend dy-
naPLTXHHQSDVVDQWSDUOHWRXUPHQWGXFKRL[/LQWHUprta-

principle in the application of law ? , The Jurist, 54, 1994, qui propose
(p. 583- GHFRPELQHUODWKpRULHGH6FKOOHUDYHFFHOOHGgUV\H[DOWH
aussi la supriorit axiologique de la salus animarum GDQV OLQWHUprta-
tion / application de la loi.
25. Cf. E. G. SARACENI, /$XWRULWjUDJionevole. Premesse per uno stu-
dio del diritto canonico amministrativo secondo il principio di ragionevo-
lezza, Milano, Giuffr, 2004. Pour une prsentation des doctrines qui
considrent la rationnalit du lgislateur comme un mythe, cf. E. DIENI,
Finzioni canoniche. Dinamiche del come se tra diritto sacro e diritto pro-
fano, Milano, Giuffr, 2004, p. 98 et s.
26. Cf. O. FUMAGALLI CARULLI, ibid. 9RLUDXVVLSRXUOLGpHGHOae-
quitas comme interprtation contra litteram mais secundum mentem legis-
latoris, A. PRIETO PRIETO, La interpretacin , op. cit., p. 579-583.
276XUODUqJOHGRUYRLUOHFROOHFWLIGLULJpSDU&9LJQDHW6=DQDr-
do, /DUHJRODGRURFRPHHWLFDXQLYHUVDOH, Milano, Vita & Pensiero, 2005.
28. Cf. I. BERLIN, The Pursuit of the Ideal , The Crooked Timber of
Humanity : Chapters in the History of Ideas, Princeton (NJ), Princeton
University Press, 1990, spcialement p. 13 et 17.
WLRQHVWGRQFHQFHVHQVDFWLRQGXGURLW6LOQ\D alors pas
GDFWLRQVDQVLQWHUprtation 29HWVLOLQWHUSUpWDWLRQHVWWRX-
jours douloureuse, nous pourrions parler, en contrefaisant
Simone Weil et Paul RiFXU GX WUDJLTXH GH OLQWHUpr-
tation 30 (W FpWDLW XQ JUDQG MXULVWH Fatholique comme
FranoRLV *pQ\ TXL GDQV VRQ FKHI GXYUH VXU OD Mthode
GLQWHUSUpWDWLRQ, montrait que, si le principe de justice guide
OLQWHUSUqWH LO QH VXIILW SDV SRXU OXLGLQGLTXHUFRQFUqWHPHQW
FRPPHQW PHWWUH HQ XYUH FH SULQcipe dans des situations

29. Depuis Vrit et Mthode de H. G. Gadamer, la gnralisation


de la noWLRQ GLQWHUSUpWDWLRQ MXVTXj OD FRwQFLGHQFH DYHF OH[SpULHQFH
PrPHGXPRQGHHVWODERXWLVVHPHQWGXQHWUDQVIRUPDWLRQGHODIDoRQ
GHFRQFHYRLUODYpULWpSURSUHGHOKHUPpQHXWLTXHFRPPH koin de notre
poque : cf. G. VATTIMO, /D YRFD]LRQH QLFKLOLVWLFD GHOOHUPHQHXWLFD ,
2OWUHOLQWHUSUHtazione. ,OVLJQLILFDWRGHOOHUPHQHXWLFDSHUODILORVRILD, Laterza,
Roma-Bari, 1994, p. 7.
30. Une conception faillibiliste des croyances morales , une libert
GHVSULWUpIUDFWDLUHDX[HIIHWVGLQWLPLGDWLRQFRPPHDX[SURSRVOpQLILDQWV
incantatoires ou consolants FHVW la leon que les Modernes peuvent
retenir de notre recours ce que Simone Weil dnommait la source
KpEUDwTXH HW OD VRXUFH JUHFTXH FRQFHUQDQW OH WUDJLTXH GH ODFWLRQ
(P. R,&85, Vie examine, vie justifie. Monique Canto-Sperber et
ODFWXDOLWpGHODSHnse morale , EspritS 'DSUqV3DXO
5LFXUOH WUDJLTXHGHODFWLRQ HVWOHVWDGHRORQLQWLPHjODFRQs-
FLHQFHPRUDOHGHSRVHUGHVGpFLVLRQVVLQJXOLqUHVGDQVXQFOLPDWGLQFHU-
titude et de grave conflictuaOLWp FIOLQWHUOXGHGHOD Neuvime tude de
Soi-mme comme un autre, Seuil, Paris, 1990, p. 281 et s.)  OH MXVWH
qualifie en dernire instance une dcision singulire prise dans un
FOLPDWGHFRQIOLWHWGLQFHUWLWXGH FI Le Juste, op. cit., p. 24) OpTXLta-
EOHHVWOHQRPGXMXVWHVXUOHSODQGHODVDJHVVHSUDWLTXHRORQH[HUFH
le jugement en situation. /pTXLWDEOHHVWODILJXUHTXH UHYrWOLGpHGX
MXVWHGDQVGHVVLWXDWLRQVGLQFHUWLWXGHHWGHFRQIOLWRXSRXUWRXWGLUH
sous le rgime ordinaire et extraordinaire du WUDJLTXH GH ODFWLRQ (op.
cit., p. 27 O$XWHXU VRXOLJQH 5LFXU RSLQH TXH 5'ZRUNLQ FI La
chane du droit , Droit et socit, 1985, n 1, p. 59 et s.) est all trop
ORLQHQDIILUPDQWTXLO\DWRXMRXUV one right answer pour les questions
poses par les hard cases : Interprtation et/ou argumentation, op. cit.,
p. 182 et s. Cette ide, en tant que variante de la thse rcurrente selon
laquelle il existerait un sens vritable GXWH[WHTXLODSSDrWLHQGUDLWjOLQWHU-
prte GHGpFRXYULUFRPPHRQH[KXPHXQWUpVRUDXFUHX[GXQYLHX[PXU ,
est critique aussi par F. OST et M. VAN DE KERCHOVE, art. Interprta-
tion , Archives de Philosophie du Droit, 35, 1990, p. 190. Peut-tre, plutt
TX une seule rponse juste , il faut chercher la rponse meilleure parmi les
plusieurs possibles, sans prtenGUHTXHOOHVRLWGpILnitive.
donnes 31. Devant les bifurcations directionnelles , plutt
TXj QRXV OLYUHU j OLUUDWLRQDOLVPH LO QH QRXVUHVWHTXjFKHU-
FKHU OD UDWLRQDOLWp GDQV OpPRtiYLWp GXQH VHQVLELOLWp HPSDthi-
que pour le prochain, en espUDQWrWUHLQVSLUpVSDUO(VSULW32.
/LQWHUSUpWDWLRQ science du choix de la solution politique-
ment, axiologiquement la meilleure parmi celles qui sont logi-
quement, juridico-logiquement possibles 33 se prsenterait
alors comme choix rationnellement motif sympathetiks
et la motivation comme affabulation hermneutique charge
GDSDLVHU ODQJRLVVH GH OLQWHUSUqWH 34.  OD OLPLWH FHVW YUDL
OLQWHUprtation pourrait apparatre comme acte de foi, affir-
mant la tenGDQFHGHOkPHjVRULHQWHUYHUVOHELHQHWjVpORL-
gner du mal, ce que la Scolastique appelait synderesis 35.

31. Cf. F. GNY, 0pWKRGHGLQWHUSUpWDWLRQHW6RXUFHVHQGURLWSULYpSosi-


tif, essai critique, 2e dition revue et mise au courant, Librairie gnrale de
droit et jurisprudence, Paris, 1919 (rimpression 1954), II, p. 114. Le
cathoOLFLVPH GH *pQ\ HVW UHPDUTXp SDUPL GDXWUHV SDU CH. JAMIN,
Franois Gny GXQVLqFOHjODXWUH Franois Gny : mythe et ralits :
1899-1999 centenaire de 0pWKRGH GLnterprtation et sources en droit
priv positif, essai critique, sous la direction de Cl. Thomasset-J. Vander-
linden-Ph. Jestaz, Montral-Paris-Bruxelles, Yvon Blais-Dalloz- Bruylant,
2000, p. 17-19 ; Ph. JESTAZ, Franois Gny : une image franaise de la loi
et du juge , ibid., p. 44.
32 &HVW OH FKRL[ GH *pQ\ TXL SDUOH GHOpTXLWp FRPPH GXQH
VRUWHGLQVWLQFWTXLVDQVIDLUHDSSHOjODUDLVRQUDLVRQQDQWHYDGHOXL-
mme et tout droit, la solution la meilleure et la plus conforme au but
de toute orgaQLVDWLRQ MXULGLTXH >@ -HVWLPH TXH OpTXLWp SXUHPHQW
instincWLYH UHVWH GDQV OH GRPDLQH GH OLQWHUSUpWDWLRQ VFLHQWLILTXH VH
mouvant hors des faits et cherchant tablir des types de dcisions con-
crtes. Dira-t-RQ TXHOpTXLWpGRQWLOVDJLWQDXUDSDVOLHXGHVH[HU-
cer, ou demeurera forcment strile ? Ce serait une erreur certaine. Je
IDLVDSSHOjOH[SpULHQFHGHWRXVFHX[TXLRQWUpIOpFKLDX[SURblmes du
droit positif, pour affirmer que, dans nombre de ces problmes, la solu-
tion juste est acquise, par sentiment instinctif plus que par raisonnement ;
et cela, indpendamment de toutes circonstanFHVGHVSqFHGDQVODVHXOH
FRQVLGpUDWLRQ GHVpOpPHQWVJpQpUDX[GXQHTXHstion. Bien plus, certains
SUREOqPHV QH SHXYHQWVpOXFLGHU que grce cette mthode (op. cit., p.
111).
33&HVWODGpILQLWLRQGHODMXULVSUXGHQFHGRQQpHSDUL. LOMBARDI
VALLAURI, Interprtation , op. cit., p. 195 et 205.
34. P. G. MONATERI  Correct our watches by the public clocks.
/DVVHQ]DGLIRQGDPHQWRGHOOLQWHUSUHWD]LRQHGHOGLULWWR, Diritto, Gius-
tizia, Interpretazione, op. cit., p. 205.
35. Cf. la Somme de Saint Thomas, I-I, q. 94, art. 1.
Cette version tragique  GH OLQWHUSUpWDWLRQ QH YHXW SDV
GLUHTXHQRXVUHWRPELRQVGDQVODOLEHUWpDUELWUDLUHGHOLQWHU-
prte nihiliste : il y a un progrs par rapport cette situa-
tion de pouvoir arbitraire GLQWHUSUpWDWLRQ SDUFH TXH VL OHV
arguments interprtatifs sont les figures rhtoriques utilises
afin de perVXDGHU OLQWHUSUqWH DXWRULWDLUH GDWWULEXHU j XQ
texte de loi un signifi particulier, il faut choisir les argu-
ments qui seront plus facilement apprcis par celui-ci, en
VLGHQtifiant de faon empathique avec sa personnalit. On
SRXUUDGDXWDQWSOXV SDUOHUGH personnalisme  GHOLQWHU-
prWDWLRQTXHORQUHJDUGHUDDXVVLOHVDUJXPHQWVLQWHUprta-
tifs comme les figures rhtoriques utiliseV SDU OLQWHUprte
autoritaire afin de persuader les destinataires de la perti-
nence de son choix, ou par un membre de la communaut
afin de persuader les autres membres de la commuQDXWp
1RXVSDVVRQVGRQFGHODUELWUDLUHVROLSVLVWH TXLSHXWrWUH un
dlire narcissique, un autisme interprtatif) une forme dialo-
JLTXHGLQWHUSUpWDWLRQSDUFHTXHOLQWHUSUqWHDGHYDQWOXLGRUp-
naYDQWODILJXUHGHO$XWUHDYHFOHTXHOLOGRLWVWLpuler le signi-
ILpGHVPRWVDILQGHQWUHUHQFRPmunication, et ensuite, grce
cette communication, essayer de le convaincre avec les ar-
guments interprtatifs les plus adapts sa personnalit de
donner un certain signifi un certain texte de loi. Le dialogue
DYHFO$XWUHDILQGHFR-dterminer avec lui OLQWHUprtation, est
aussi une thUDSLH SOXVRXPRLQVSDOOLDWLYH FRQWUHODQJRLVVH
du choix solitaire.
/LQWHUSUpWDWLRQ tragique serait alors une interprtation
raliste, parce que consciente des limiWHV GH OLQWHUprte 36, et
aussi, malgr les apparences, optimiste, parce que la conscience
WUDJLTXHGHVOLPLWHVQLPplique pas la renonciation chercher,
DYHFGDXWUHVLQWHUSUqtes, la meilleure interprtation possible,
prfrer la vie avec ses risques plutt que le calme immobile de
OLQDction.
Il y a bien videmment une autre solution possible qui
FKHUFKHjUpGXLUHODQJRLVVHGXFKRL[LQWHUSUpWDtif au mini-
PXPjGpIDXWGHOHIIDFHUHQWLqUHPHQW2QREWLHQWFHUpVXO-
WDW HQ UpVHUYDQW OLQWHUSUpWDWLRQ DX[ DXWRULWpV FHQWUDOHV
'DQV OeJOLVH URPDLQH LO VDJLW SRXU FH TXL FRQFHUQH OH

36 6XU OHV OLPLWHV GH OLQWHUSUqWH FI G. LO CASTRO, Conocimi-


ento , op. cit., p. 413.
droit universel, les tribunaux, la Curie, et, en particulier, du
&RQVHLOSRQWLILFDOSRXUOLQWHUSUpWDWLRQGHVWH[WHVOpJLVOatifs.
Ce dernier a le mrite irremplaable de dcharger les cano-
nistes du travail et GH OD VRXIIUDQFH GH OLQWHUSUpWDWLRQ
( Beaucoup de sagesse, beaucoup de chagrin ; plus de savoir,
plus de douleur : Eccl  ,OIDXWVRXOLJQHUOHIIRUWUHPDU-
quable de certains auteurs romains pour faire obstacle aux
thories craWLYHV GH OLnterprtation en droit canonique, en
particulier celle de Ladislas rsy 37, the leading thinker in
canonical hermeneutics 38.
2Q SRXUUDLW SHQVHU TXH OD FRQFHSWLRQ WUDJLTXH GH OLQWHU-
prtation, ici esquisse, avec au centre de la scne un inter-
prte-+DPOHWDQJRLVVpVRLWOLpHjOLQFHUtitude et aux doutes des
PDOKHXUHX[TXLVRQWKRUVGHOD9pULWp,O\DSRXUWDQWGDXWUHV
WUDJpGLHV&HVWOHFDVGHFHOXLTXLHVWFRQYDLQFXGHSRVVpGHUOD
Vrit de celui qui sait savoir HWTXLVXELWOLPposition par
O$XWRULWpGXQH9pULWpRIILFLHOOH&HVWSDUH[HPSOHODWUDJpGLH
des hrtiques qui ne cessent de penser : et pourtant elle
tourne ! , mais qui sont rduits au silence ou brls selon les
cas ou les poques 39. 2XHQFRUHFHVWOHFDVGHO$XWRULWpHOOH-
mme qui ne fait point autorit et qui ne russit affirmer sa
9pULWp TXH SDU OLPposition (tragdie de la grandeur incom-

37. R. CASTILLO LLARA, De iuris canonici autentica interpreta-


tione in auctuositate Pontificiae Commissionis adimplenda Communi-
cationes, 20, 1988, p. 282 et s. ; B. FERME, I principi interpretativi e
OLQYHQtiva interpretativa , Periodica de re canonica, 87, 1998, p. 191-
213 ; J. OTAUDY, Los medios , op. cit., p. 447-500 ; C. M. POLVANI,
Authentic Interpretation in Canon Law, PUG, Roma, 1999; ID., Evolu-
]LRQH GHOOLQWHUSUHWD]LRQH DXWHQWLFD QHO GLULWWR FDQRQLFR , Periodica de
re canonica, 89, 2000, p. 3-43 ; C. M. ERRZURIZ M., Il diritto e la giusti-
zia nella Chiesa: per una teoria fondamentale del diritto canonico , Giuffr,
Milano, 2000, p. 81. Sur le lien entre transcendance de la loi divine et
FRQFHSWLRQV GpFODUDWLYHVGHOLQWHUSUpWDWLRQYRLU G. LO CASTRO, Co-
nocimiento , op. cit., p. 384 et 410  PDLV SRXU OpYROXWLRQ GX GURLW
canonique qui tend prfrer la lgiVODWLRQ j OLQWHUSUpWDWLRQ FI S.
FERRARI, Lo Spirito dei diritti religiosi. Ebraismo, cristianesimo, islam a
confronto, Il Mulino, Bologna, 2002, p. 199-201.
38. Dfinition de J. M. HUELS, O. S. M., Interpreting Canon Law
in Diverse Cultures , The Jurist, 47, 1987, p. 249.
39. Voir D. FARIAS, Laicit e verit , Ripensare la laicit. Il proble-
PDGHOODODLFLWjQHOOHVSHULHQ]Dgiuridica contemporanea, sous la direction
G. Dalla Torre, de Giappichelli, Torino, 1993, p. 164.
SULVH (QILQRQSHXWFRQVLGpUHUTXLO\DODWUDJpGLHGHO$XWR-
rit qui russit facilement imposer sa Vrit ses sujets enfan-
tins, incaSDEOHV GLQWHUprtations critiques (la tragdie de la
VROLWXGHGXSRXYRLUGHO,QTXLsiteur des Karamazov).

La doctrine a remarqu la concidence chronologique du


dvelRSSHPHQW GH OpFROH GX GURLW OLEUH HQ GURLW FLYLO HW GX
modernisme en thologie 40 (deux mouvements qui ont perdu
au moins apparemment leur pari). Pour notre part, nous
pouvons constater la concidence chronologique, aujourGKXL
des thories interprtatives qui, en droit civil, dplacent
ODFFHQW GH Ointentio auctoris j Ointentio lectoris, et du climat
post-moderne qui touche aussi les thologies non officielles de
OeJOLVHFDWKROLTXH
2UOLQIOXHQFHGHVKHUPpQHXWLTXHV gadamriennes et
dialogiques est bien visible dans la doctrine canonique plus
avance 411RXVYRXGULRQVWRXWHIRLVPHWWUHjOpSUHXYHXQH

40. W. CESARINI SFORZA, Il modernismo giuridico , Il Filangeri ,


1912, p. 373 ; L. LOMBARDI VALLAURI, art. Diritto libero , Digesto delle
Discipline Privatistiche, Sezione Civile, VII, UTET, Torino, 1990, p. 280..
2Q D DXVVL FODVVp OHV GRFWULQHV GH OLQWHUSUpWDWLRQ HQ GURLW FLYLO VHORQ
OLPSRUWDQFH TXHOOHV DWWULEXHQWUHVSHFWLYHPHQWjODXWHXU HW DX OHFWHXU
GXWH[WHQRUPDWLIFRPPHLQVSLUpHVGHOLGpH WKpLVWLTXHGXQ'LHXSHU-
sonQHO SUpYDOHQFHGHODXWHXU GHODWKpRORJLHGHODPRUWGH'LHX SUp-
YDOHQFHGHOLQWHUSUqWH GXSDQWKpLVPH pJDOLWpHQWUHDXWHXUHWOHcteur) :
C. LUZZATI, /LQWHUSUHWH H LO OHJLVODWRUH Saggio sulla certezza del diritto,
Milano, Giuffr, 1999, p. 526-528. Mais il y aussi des thologies visant
OLPDJHGH'LHXGDQVFKDTXHSHUVRQQHKuPDLQH
41. Cf., par exemple, L. RSY, Theology and Canon Law. New Hori-
zons for Legislation and Interpretation, Collegeville (Minnesota), Liturgi-
cal Press, 1992 ; R. BERTOLINO, Sensus fidei  FDULVPL H GLULWWR QHO
popolo di Dio , Antropologia, fede e diritto ecclesiale, sous la direction
de L. Gerosa, Jaca Book, Milano, 1995, p. 93 ; S. BERLING, Diritto
canonico, op. cit., p. 45 (sur lequel voir R. PUZA, Rezension zu : Salvatore
Berling, Diritto canonico, NomoK@non-Webdokument : http://www.-
nomokanon.de /rezensionen/010.htm) ; R. MAZZOLA, Il diritto vivente
QHOORUGLQDPHQWR JLXULGLFR GHlla Chiesa , Diritto per valori e ordina-
mento costituzionale della Chiesa, Giappichelli, Torino, 1996, p. 310 et s. ;
H. J. GUTH, Jrgen Habermas : ein anonymer Kanonist ? , Archiv fr
katholisches Kirkenrecht, 168, 1999, p. 431 et s. ; W. KOWAL, Understand-
ing, op. cit. ; L. MLLER, Kirchenrecht als kommunikative Ordnung ,
association plus audacieuse, qui nous semble justifie non
seuOHPHQW SDUFH TXHOOH FRQFHUQH XQ FRXUDQW SKLORVRSKL-
que dont la popularit est croissante chez les thoriciens de
OLQWHUSUpWDWLRQ HQ GURLW FLYLO QL VHXOHPHQW  SDU OH SODLVLU
perYHUV GpYRTXHU XQH SKLORVRSKLH DSSDUHPPHQW WUqV ORLQ
de la splendeur de la Vrit , mais parce que la concep-
tion de la justice de cette philosophie semble prsenter,
finalement, des convergences significatives avec la concep-
tion chrtienne et donc canonique. Et mme, bien videm-
ment, cause de la prgnance du tragique trs lev de cette
conception.
Nous pensons ici certains aspects de la pense de
Jacques Derrida, ou du moins certaines interprtations de
VD SHQVpH GDQV OH VHQV GXQ FRPEOHPHQW GH OD GLIIrence
HQWUH OH VRL HW ODXWUH TXL VHPEOH XQH TXHVWLRQ WRXW j IDLW
thologique et, par consquent, canonique.
'DSUqV OH GpFRQVWUXFWLRQQisme de Derrida, un texte
QHVWSDVXQHSXUHSUpVHQFHTXLUpYqOHGHIDoRQLPPpGLDWH
le signifi prcis entendu par son auteur. Toute criture
HQJOREHXQHWHQWDWLYHpFKRXpHGHFRQFLOLHUOLGHQWLWpHWODGLI-
fUHQFH OH VRL HW ODXWUH 0rPH VL XQH criture peut donner
OLPSUHVVLRQ GDYRLU UpDOLVp FHWWH UpFRQFLOLDWLRQ GpVLUpH FHWWH
LPSUHVVLRQQHVWTXHOHSURGXLWGXQHGLVWRUVLRQLGpRORJLTXH
de la suppression de la diffrence ou de la soumisVLRQGHOXQ
jODXWUH 42.
&HWWH FRQFHSWLRQGHOLQWHUSUpWDWLRQQRus semble essen-
tielOHPHQW WUDJLTXH SDUFH TXHOOH QH SHXW SDV SHUPHWWUH
ODSDLVHPHQW GH OLQWHUSUpWDWLRQ GpILQLWLYH Elle est tragique
DXVVLSDUFHTXHOOHPHWjQXODYLROHQFHGHODFWHGLQWHUprta-
tion : le soi qui peut imposer son interprtation jODXWUHTXL
IDLWODYLROHQFHjODXWUH ; de mme, le soi qui renonce son
interprtation pour accepWHUFHOOHGHODXWUHVHIDLWYLROHQFHj
soi-mme 43.

Archiv fr katholisches Kirkenrecht, 172/II, 2003, p. 353 et s. Pour ce


TXLFRQFHUQHOHGURLWFLYLOQRXVVLJQDORQVXQOLYUHGLQVpiration ouver-
tement dialogique : M. CAVINO, Interpretazione discorsiva del diritto.
Saggio di diritto costituzionale, Milano, Giuffr, 2004.
42. M. ROSENFELD, Just Interpretations. Law between Ethics and Poli-
tics, University of California Press, Berkeley, 1998, p. 14, qui suit la
trace de CH. NORRIS, Derrida, Harvard University Press, Cambridge
(Mass.), 1987, p. 18 et s.
43. M. ROSENFELD, Just Interpretations, op. cit., p. 60.
'HSOXVVLRQODSSOLTXHjXQGURLWIRQGpVXUODUpYpODtion
divine comme le droit canonique, les consquences sont rava-
geuses : tant donn que le droit manant de la rvlation
divine implique aussi plusieurs critures, effacements et col-
laborations intersubjectives ODGRSWLRQ GH ODUgument inter-
prtatif intention originaire du lgislateur ne peut que
conduire vers une idoltrie pour une entit arbitraire et inef-
fable, empchant la dcouverte des liaisons intertextuelles
ncessaires pour attribuer un signifi aux actes juridiques 44.
Il y a toutefois une interprtation possible de la thorie
GpFRQVWUXFWLRQQLVWH GH OLQWHUSUpWDWLRQ TXL QDPqQH SDV IRU-
cment conclure que toute attribution de signifi serait
arbitraire, et qui pourrait tre intressante pour le canoniste.
&HWWHLQWHUSUpWDWLRQHQVHIRQGDQWVXUORQWRORJLHGX ren-
YRL LQILQL GH OD UpFRQFLOLDWLRQ FRPSOqWH GX VRL HW GH ODXtre,
UpYqOH OpWKLTXH MRLQWH j FHWWH RQWRORJLH GH OLQclusion et du
VRXFL SRXU ODXWUH 8QH LQFOXVLRQ MDPDLV Dccomplie, tension
VDQVFHVVHYHUVODXWUH 45. Dans ce cadre, bien que le signifi
QH SXLVVH SDV rWUH IL[p GpILQLWLYHPHQW LO QHVW SDV VLPSOH-
PHQW DUELWUDLUH ,PPHUJpHV GDQV OKLVWRLUH ORQtologie et
OpWKLTXHSHXYHQWjFKDTXHLQVWDQWGpWHUPLQHUOpYHQWDLOGHV
signifis imaginables, sans imposer de faon dfinitive un
seul VLJQLILp 'DSUqV FHWWH FRQception dconstructiviste
htrodoxe, sur le prsuppos de la nature intertextuelle de
WRXWH pFULWXUH OH VHXO PR\HQ GpYLWHU ODUELWUDLUH FRQVLVWHj
affronter le texte au niveau approSULp GDEVWUDFWLRQ 46 (ou,
par ricochet, la distance juste par rapport la condition
existentielle de chaque destinataire de la loi).
(QRXWUHODWKpRULHGH'HUULGDSXLVTXHOOHFRQoRLWFKa-
que cas comme une exception chaque cas est autre, cha-
que dcision est diffrente et requiert une interprtation
DEVROXPHQW XQLTXH TXDXFXQH UqJOH H[LVWDQWH HW FRGpH QH
peut ni doit absolument garantir 47 , semble particulire-

44. A. JAKOBSON, The Idolatry of Rules : Writing Law According


to Moses with Reference to other Jurisprudence , Cardozo Law Review,
11, 1990, p. 1079 et s.
45. M. ROSENFELD, Just Interpretations, op. cit., p. 19-20.
46. Ibid., p. 20.
47. J. DERRIDA, Force de la loi, d. Galile, Paris, 1994, p. 51 (cf. sur
ce passage, M. ROSENFELD, Just Interpretations, op. cit., p. 57). Cette
ment intressante pour le droit canonique le moins lga-
liste des droits lgalistes 48 toujours dispos sacrifier la
rgle jOH[FHSWLRQ
Ce sont autant de provocations pour un interprte qui,
comme le canoniste, doit la fois chercher la vrit et fuir
la violence.

/DFRQFHSWLRQLQWHUVXEMHFWLYHGHOLQWHUSrtation de type
GpFRQVWUXFWLRQQLVWH TXH QRXV YHQRQV GpYRTXHU DERXWLW j
une soluWLRQSUDWLTXHTXLVDYqUHGLIILFLOHjVXLYUHGDQVXQH
dmocratie moderne, partage entre plusieurs conceptions
du bien. Elle devrait tre, en revanche, plus facile suivre
dans la communaut des fidles du Christ, o la communio
autour du principe fondateur cre une unit olon 49 et
OH SDUWDJH GXQH UHVSRQVDELOLWp : communitas = cum-munus.
La tragdie FHVWTXHPrPHGDQVFHWWHFRmmunaut il y a
diffrentes visions du bien, diffrentes interprtations 50

affirmation de Derrida est reprise par Luigi Mengoni, professeur de


GURLWFLYLOjO8QLYHUVLWpFDWKROLTXHGX6DFUp&XUGH0LODQHWHQVXLWH
juge la Cour constitutionnelle italienne, qui repousse touteIRLVOLGpH
que le juge va improviser la dcision hors de toutes rgles et principes :
OHV UqJOHV GH ODUJXPHQWDWLRQ MXULGLTXH WRXW HQ QDVVXUDQW SDVODFHUWL-
WXGH GX GURLW VDWLVIRQWDX PRLQVODWWHQWH GXQH GpFLVLRQUDLVRQQDEOH
fonde sur des raisons plus probables, donc meilleures par rapport
GDXWUHV : cf. L. MENGONI, Le aporie decostruttive del diritto secondo
Jacques Derrida , Rivista Trimestrale di Diritto e Procedura Civile, 53,
1999, p. 354-355.
48. A. ALBISETTI, Ermeneutica giurisprudenziale , op. cit., p. 407 ;
ID., Considerazioni sulla dottrina del precedente nella giurisprudenza
canonica , Studi in onore di Cesare Grassetti, I, Giuffr, Milano, 1980,
p. 9.
49'DSUqVO. FUMAGALLI CARULLI, Soggettivit , op. cit., p. 128-
129, la Weltanschauung partage par une socit est le meilleur critre
pour choisir parmi plusieurs solutions interprtatives, ce critre valant a
fortiori SRXU OD VRFLpWp HFFOpVLDOH /XQLWp GH OD FRPPXQDXWp qui de-
vient communio HVW OXQH GHV LGpHVIRUFH GH L. GEROSA, /LQWHUprta-
tion de la loi daQV O(JOLVH 3ULQFipes, paradigmes, perspectives, Le Plan,
2004.
50&HTXLGDXWUHSDUWHVWFRQVWLWXWLIGXQHFRPPXQDXWpLQWHUSUta-
tive, dont les caractres essentiels sont la fois la coopration interpr-
GR OD YLROHQFH TXDQG FHUWDLQV Lmposent leur interprta-
WLRQjGDXWUHVTXLODVXELsse). Mieux : la tragdie est moins
GDQVODSOXUDOLWpGHVYLVLRQVGXELHQTXHGDQVOLQFRPpatibi-
lit de ces visions contraires au pluralisme interprtatif pr-
n par saint Paul : Que conclure, frres ? Lorsque vous vous
assemblez, chacun peut avoir un cantique, un enseignement,
une rvlation, un discours en langue, une interprtation. Que
tout se passe de manire difier . (1 Co 14, 26).
2QSHXWIDFLOHPHQWVRXSoRQQHUTXHOHFRQIOLWGLQWHUpr-
tations dans le catholicisme contemporain est li au conflit
GHFFOpVLRORJLHVDSSDUXDYHF9DWLFDQ,, 51 : dans les reprsenta-
tions officielles OeJOLVH QHVW SOXV VLPSOHPHQt une societas
inaequalisROLQWHUSUpWDWLRQYDGXKDXWYHUVOHEDVQLXQH
hermeneutica communio 52ROLQWHUSUpWDWLRQHVWFLUFXlaire :
elle est une hierarchica communio 53, o le sens vertical 54 et
le sens horizontal 55 des courants interprtatifs se croisent,
donnant lieu des perturbations.

tative et le dsaccord ou conflit (cf. F. VIOLA, La comunit interpretativa


nel diritto e nella teologia , Hermeneutica, 1998, p. 25) ; la communaut
interprtative nat quand le dsaccord accepte la forme du discours (cf. F.
VIOLA-G. ZACCARIA, Diritto e Interpretazione, op. cit., p. 68).
51. R. TORFS, Propria verborum significatio , op. cit., p. 182-183,
remarque que la signification des mots devient quivoque lorsque le
conte[WH QHVW SDV LPSOLTXp GDQV OLQWHUSUpWDWLRQ ; il signale deux
UDLVRQV SRXU ODIIDLEOLVVHPHQW GH FH FRQWH[WH >@ j savoir la nouvelle
position du droit canonique depuis Vatican II et la pluriformit crois-
VDQWHVXUOHSODQGHODSHQVpHDXVHLQGHO(JOLVH .
52. Cf. P. SGROI, La Chiesa come comunit ermeneutica. Una
prospettiva etica , Studi ecumenici, 18, 2000, p. 39-54.
53. Cf. R. PUZA, Perspektiven auf dem Weg zu einem diakoni-
schen Kirchenrecht in der Communio , Communio Ideal oder Zerr-
bild von Kommunikation?, hrsg. B. J. Hilberath, Freiburg-Basel-Wien,
Herder, 1999, p. 123-135 (qui critique ce concept la lumire du dbat
conciliaire).
54. La voluntad legislativa no es neutra sino que concreta, a travs
del carisma jerrquico, con la voluntad divina : J. OTADUY, op. cit., p.
473 (cf. aussi p. 484). Voir aussi J. HERRANZ, La interpretacin autn-
tica : el consejo pontificio para la interpretacin de los textos legislati-
YRVIus canonicum, 35, 1995, p. 503.
55'DSUqVFHUWDLQVDXWHXUVODWKpRORJLHGHODFRPPXQLRQUHTXLHUW
une praxis juridique dialogique, savoir que tous les destinataires de la
norme estiment rationnelle la connexion norme / FDV REMHW GH ODFWH
GLQWHUSUpWDWLRQ : cf. H. PREE, Die Evolutive, op. cit., p. 231.
3RXUWDQW WDQGLV TXHQ WKpRORJLH OD UpSUHVVLRQ SDU ODXWR-
ULWp GH OLQWHUSUpWDWLRQ KpWpURGR[H HVW SOXV IUpTXHQWH FHV
perturbations , semblent gnralement moins visibles en
droit canonique 56. En droitODSOXUDOLWpGLQWHUprtes auto-
ULVpVHWODSRVVLELOLWpRXOREOLJDWLRQGXQVHFRQGMXJHPHQW
(dans les causes matrimoniales) rendent concret le conflit
des interprtations.
Toutefois, au-del du droit canonique officiel , o les
oppositions sont rarement dramatiques ELHQ TXHOOHV OH
soient parfois , il serait intressant de relever les circuits le
long desquels les diffrents acteurs du processus interprta-
tif font agir leurs interprtations.
1RXVQHSRXYRQVLFLTXHGRQQHUTXHOTXHVDSHUoXVGune
reprsentation raliste qui fait merger des courants submer-
gs.
6LORQUHJDUGHOH'URLWFRPPHXQHQVHPEOHGLQVWLWXWLRQV
DLQVL TXH FRPPH XQ HQVHPEOH GH SURSRVLWLRQV HW VL ORQ
retient que les propositions expliquent et conduisent les insti-
tutions, on peut convenir, finalement, que ceux qui ont le
pouvoir de manipuler les propositions ont aussi le pouvoir
de manipuOHUOHVLQVWLWXWLRQV/HSUREOqPHGHOLQterprtation
HVW DORUV OH SUREOqPH GH Oallocation aux diffrents types
GLQWHUprtes des pouYRLUV GDWWULEXHU XQ VHQV DX[ WH[WHV
normatifs. Autrement dit toute composante du droit essaye
de lier les autres composanWHV DILQ GHQ OLPLWHU OH SRXYRLU
GLQWHUprtation, ce qui est particulirement vident dans les
systmes o le pouvoir lgislatif est spar des autres compo-
santes, dclasses du rang de sourFHVjFHOXLGLQWHUprtes 57,
OLQWHUprte tant, dans ces systmes, conu comme le simple
excuteur du droit produit par la source.
Si nous appliquons ces remarques au droit canonique,
nous trouvons, au moins dans les propositions de ce droit,
un certain quiliEUHSDUPLOHVDFWHXUVTXLSDUWLFLSHQWjOLQWHU-

56. On pourrait penser malicieusement que les juristes, proches du pou-


voir par dfinition, sont plus soumis aux vouloirVGHODXWRULWpSDUYRFDWLRQ ;
ou bien que les juristes, gens pratiques, savent trouver des solutions indirec-
WHVTXLQLQTXLqWHQWSDVODXWRULWp RXHQFRUHTXHQPR\HQQHOHVFDQRQLVWHV
sont de meilleurs catholiques que les thologiens...
57. Nous avons suivi, quasi-textuellement, P. G. MONATERI, Inter-
pretazione , op. cit., p. 32-33.
prtation, mme en comparant avec certains systmes juridi-
ques de droit civil : la jurisprudence, ainsi que la doctrine
commune et constante (can. 19 CIC 1983), sont considres
comme une source du droit (suppltoire PDLVFHVWDX[MXJHV
GpWDEOLUquand il y a une lacune combler). 'DXWUHSDUWVLO
Q\ D SDV GH VpSDUDWLRQ GHV SRXvoirs au sens de Montes-
quieu, il y a une rserve du pouvoir lgislatif la hirarchie,
WDQGLVTXHOHSRXYRLUGLQWHUprter en tant que juge ou doc-
teur peut tre exerc par des non-hirarques, et cette rserve
trace une ligne de sparation entre source et inter-
prte plus avance ou inclusive 3DUDLOOHXUVVLOHVW
vrai, en gnral, que la meilleure faon de lier les interpr-
tes HVWGHOHVDQFUHUjOLQWHUprtation littrale des textes la
GRFWULQH FXULDOH DWWULEXH j OLQWHUprtation littrale un statut
privilgi , il est aussi vrai que le moyen infailliEOHGLQfluen-
FHUOHVMXJHVHVWPRLQVOLQWHUprtation littrale que la sugges-
WLRQ TXL YLHQW GHQ KDXW 58 ; HW ORQ FRQVWDWH TXH OHV MXJHV
ecclsiastiques sont insrs dans une structure o les sug-
gestions ont surtout la forme du conformisme culturel. Si,
de plus, on considre que les interprtations de la Curie
URPDLQH\FRPSULVFHOOHVGHOD5RWHRQWXQU{OHGLQWHUpr-
tation authentique 59, la ligne de sparation se dplace de
IDoRQjH[FOXUHGHOLQWHUprtation certains acteurs.
2UOHVWKpRULFLHQVVLJQDOHQWTXHOLQWHUSUpWDWLRQOLWWpUDOH
IRUFHOLQWHUSUqWHjUHPDUTXHUOLQFRPSDWLELOLWpGHODQRUPH
par rapport la norme suprieure VLOHQWURXYHXQHFRQ-
traire , au lieu de chercher une interprtation non littrale
compatible avec celle-FL&HVWSHXW-rWUHFHTXLVRSqUHGDQV
le droit canonique face des dispositions dont le signifi est
LPSRVpSDUOHOpJLVODWHXUSDUOHVPR\HQVGHOLQWHUSUpWDWLRQ
OLWWpUDOH GH OLQWHUSUpWDWLRQ DXWKHQWLTXH GHV Gocuments
pastoraux ou thologiques qui rpliquent le signifi choisi
SDU ODXWRULWp 1RXV SHQVRQV MXVWHPHQW DX[ DFWHV contra
legem RXGepikie TXLFRPPHXQHGpFODUDWLRQGLQFRQVWLtu-
tionnalit dans le droit civil, refuVHQWODYDOHXUGXQHQRUPH
en tant que contraire une norme plus haute 60.

58. P. G. MONATERI, Interpretazione , op. cit., p. 49.


59. Supra, note 15.
60. Nous renvoyons nos travaux : La Coutume dans le droit cano-
nique de la post-modernit : quelques ides sommaires , Revue de droit
'DSUqVXQHYLVLRQUpDOLVWHPDLVDXVVLGpRQWRORJLTXH RX
mieux, axiologique) du droit une vision qui trouve le
GURLW GDQV VD FDSDFLWp GRULHQWHU OD FRPPXQDXWp YHUV FHU-
taines valeurs le droit canonique effectif ne serait que le
rsultant des interprtations des sujets qui participent de
fait la manipulation des normes, y compris les destinatai-
res GHQ EDV  (Q GDXWUHV WHUPHV HQ SDssant du law in
books au law at work, on remarquera que certains courants
GLQWHUSUpWDWLRQV qui vienQHQW GHQ KDXW VH PrOHQW DYHF
les interprtations des destinataiUHV VHQULFKLVVHQW GH VHQV
ou, parIRLVVpWHLJQHQWSDUFHTXLOVQHVRQWSDVUHoXV
Des tudes thoriques, entre thologie et droit, plaident
pour une telle conception (partiellement) crative de
OLQWHUprtation, o tous les sujets concerns sont habilits
participer la dtermination de la rgle 61 /LGpH-force de
FHV pWXGHV HVW TXH OH 'LHX FKUpWLHQ QHVW SDV XQ PRQRSo-
liste de la loi, mais partage avec ses enfants le pouvoir de la
produire : chaque fidle, dans le for de sa conscience, est
appel co-dterminer avec Dieu la rgle pour le cas singu-
OLHU TXL VH SUpVHQWH HQ VRSSRVDQW OH FDV pFKpDQW j GHV
UqJOHVGHODXWRULWpTXLOQHFRQVLGqUHSDs comme des appli-
cations de la rgle des rgles, le commandement de la cha-
rit (paraGLJPHGHOepikie).
/H[SpULHQFH GX GURLW FDQRQLTXH DYDQW OD FRGLILFDWLRQ
nous offre, peut-tre, des illustrations techniques par rap-
port cette conception partage du pouvoir de dire le
droit VRXVOHQRPMXVWHPHQWG interprtation .
Durant la priode du droit commun, savoir durant la
tradition du droit romain, interprtation tait la dter-

canonique, 53/2, 2003, p. 241-265 ; Finzioni canoniche, op. cit., p. 193 et


s., 304 et s., 341 et s., 384 et s.
61. Nous renvoyons, pour un cadre thorique, S. BERLING, La
Causa pastorale, op. cit. ; ID., *LXVWL]LD H &DULWj QHOOEconomia della
chiesa, Giappichelli, Torino, 1991, p. 67 et s.; ID., Diritto canonico, op.
cit. ; ID., /8OWLPR'LULWWR, op. cit. ; ID., Ecclesiologia tridentina e prassi
dispensatoria nella tarda scolastica spagnola , Ius Canonicum in Oriente
et Occidente. Festschrift Carl Gerold Frst zum 70. Geburtstag , Hrsg.
Von H. Zapp, A. Wei, S. Korta, Peter Lang, Berlin-Berne-Bruxelles-
New York-Oxford-Wien, 2003, p. 157-165.
PLQDWLRQ GH SUpFHSWHV GRQQpV GDXWUHV SUpFHStes 62. Et,
GDSUqVODGRFWULQHFDQRQLTXHSOXVDQFLHQQHTXLVHVWIRUme
dans la tradition du droit romain, mme le pouvoir de dispen-
ser des lois ou de concder des privilges tait une forme
G interpretari 63. Une forme de mdiation, dirions-nous,
eQWUH GHX[ YDOHXUV FHVW OXQH GHV pW\PRlogies possibles
GLQWHUprtation : inter-pres) RXGHX[VXMHWV FHVWOpW\mologie
suggre par Isidore de Sville : inter-partes) 64, entre le cas
singulier et le principe normatif. Les papes des dcrtales
QRQWULHQIDLWGDXWUHTXHMRXHUOHU{OHGHPpGLDWHXUHQWUH
la Valeur suprme du systme (la salus animarum) et la va-
leur de chaque exprience existentielle qui tait soumise
leur jugement, la recherche de la solution la plus apte
raliser la premire dans le contexte de la seconde. Cette
interpretatio pWDLWXQHUHFKHUFKHGHOpTXLWpGHODMXVWHPe-
sure pour chaque cas, de la caritas discreta /DFFXPXlation
de prcdents produira un systme juridique casuistique qui
est le conWUDLUHGXne lgislation gnrale et abstraite : ce sera la

62. Cf. S. CAPRIOLI, art. Interpretazione nel diritto medievale e


moderno , Digesto delle Discipline Privatistiche, Sezione Civile, X, UTET,
Torino, 1993, p. 13. 9RLUDXVVLVXUOLGpHGLQWHUSUpWDWLRQPpGLpYDOHHW
tout particulirement de la part du lgislateur par rapport un droit
dj donn, P. GROSSI, /RUGLQHJLXULGLFRPHGLevale, Laterza, Roma-Bari,
200310, p. 13 et s. ; 39 et s. ; 142 et suiv. ; 168 et s.
63. Cf. L. DE LUCA, La nozione della legge nel Decreto di Gra-
ziano : legalit o assolutismo ? , Studia Gratiana, XI, 1967, p. 425-426 ;
it has also been said more then once that in the early phases of cano-
nistic thought the boundary lines remained rather fluid between inter-
preting the law, dispensing from its observance, granting a privilege,
and altering the old law by legislation : S. KUTTNER, Urban II and
the Doctrine of Interpretation : a turning point ? , Studia Gratiana, XV
(Post Scripta: Essays on Medieval Law and the Emergence of the European
State in Honor of Gaines Post, Rome, 1972), voir aussi dans S. KUT-
TNER, The History of Ideas and Doctrines of Canon Law in the Middle
Ages, Variorum, Aldershot (Hampshire)-Brookfield (Vermont), 19922,
p. 55, qui renvoie A. VAN HOVE, De privilegis. De dispensationibus.
Commentarium Lovaniense in Codicem iuris canonici, I, 5, Dessein, Me-
cliniae-5RPDHSHWVSRXUGDXWUHVUpIpUHQFHV
64. Cf. par exemple F. OST et M. VAN DE KERCHOVE, Interprtation ,
op. cit., p. 165. Pour la priode avant Gratien, voir J. M. SALGADO, Il
metodo di interpretazione del diritto dei canonisti , Verit in questione. Il
problema del metodo in diritto e in teologia nel XII secolo, a cura di P. Faltrin et
M. Rossini, Bergamo, Pierluigi Lubrica Editore, 1992, p. 221-238.
WkFKHGHODGRFWULQHGHGpGXLUHGXQFRUSXVGHGpFLVLRQVVXU
des cas concrets les rgles gnrales 65. On remarquera le ren-
versement des rles qui nous sont familiers : le lgislateur in-
terprte , en statuant sur des cas particuliers ; les interprtes,
savoir la communaut des docteurs, posent la rgle gnrale !
Tout cela devrait donc nous autoriser rcuprer, pour le
GURLW FDQRQLTXH XQH LGpH ODUJH GH OLQWHUSUpWDWLRQ /LQWHU-
prtation comme mdiation entre la valeur fondamentale et
le cas singulier, dont les auteurs sont pluriels ODXWRULWpTXL
a la charge de coordonner la communaut en lui proposant
et en tmoignant des valeurs vangliques dans les normes
gnrales 66 et particulires, et ses spcialistes : administra-
teurs et juges ; la communaut elle-mme, qui opre une m-
diation spontane entre les valeurs vangliques et la vie sociale
en produisant des coutumes et en appliquant ou en rejetant les
lois, et ses spcialistes , les docteurs 67 (qui donnent lieu aussi
des coutumes interprtatives) ; chaque fidle, qui a toujours
ODFKDUJHGpYDOXHUODFRQformit de la rgle ecclsiale la rgle
des rJOHVFHOOHGHODPRXUGXSURchain.
Tous ces acteurs, donc, participent de faon crative la
FRQFUpWLVDWLRQ GXQH ORL RX PLHX[ GXQ SULQFLSH  IRQGD-
mentale. Cette concrtisation 68GDSUqVODWHQGDQFHKHrm-

65. J. M. GONZLEZ DEL VALLE, Dottrina , op. cit., p. 404. Sur le


GpJDJHPHQW GH OLGpH GH ORL FRPPH SUpFHSW JpQpUDO YRLU P. LANDAU,
OHYROX]LRQH GHOOD QR]LRQH GL legge  QHO GLULWWR FDQRQLFR FODVVLFR 
Lex et iustitia QHOOXWUXPTXHLXVUDGLFLDQWLFKHHSURVSHWWLYHDWWXDOL. Atti
del VII colloquio internazionale romanistico-canonistico (12-14 maggio
1988), Libreria Editrice Vaticana - Libreria Editrice Lateranense, Citt del
Vaticano-Roma, 1989, p. 263-280.
66. Dans le micro-systme des canons 16-17, les mots interpretatio et
interpretari se rfrent DXVVL jO$XWRULWpHQWDQW TXH/pJLVODWHXU-XJH
HW$GPLQLVWUDWHXUWDQGLVTXHOLQWHUSUqWH commun doit intelligere les
ORLV 'X /pJLVODWHXU HQ WDQW TXDXWHXU GHV ORLV FRPPH SUHPLHU LQWHU-
prte du droit, divin et humain, voir G. LO CASTRO, Conocimiento ,
op. cit., p. 400-404.
67. S. BERLING, Diritto canonico, op. cit., p. 145, GpYHORSSHOLGpH
que les docteurs sont les reprsentants de la communaut des fidles en
YXH GXQH SURMHFWLRQ G\QDPique ou in progress  GX GURLW GH OeJOLVH
tandis que les juges et administrateurs sont concerns plutt par une pro-
MHFWLRQ VWDWLTXH GH ORUGUH MXULGLTXH /LGpH GHV MXULVWHV FRPPH techni-
ciens  GX SHXSOH YLHQW FRPPH LO HVW ELHQ FRQQX XQH LGpH GH OpFROH
allemande historique du droit.
68. ConcrWLVDWLRQTXLUDSSURFKHMXVTXjODIXVLRQSHXW-tre, interpr-
tation et application : ODWkFKHGLQWHUSUpWHUFHVWODWkFKHGHFRQcrtiser
neutique de la thorie contemporaine du droit, ne serait ni
une production ex nihilo GXQVLJQLILpQRXYHDX Vcepticisme
raliste extrme), ni la dcouverte de la seule interprtation
possible (entre autres, positivisme traditionnel) 69. Elle serait
plutt la recherche en commun, dialectique et jamais ache-
ve, de la meilleure solution possible un moment donn,
poursuivie dans le respect de toutes les raisons qui ont t
verses dans le circuit du dialogue. Peut-tre cette dialecti-
que est-HOOHSOXVULFKHTXHORQQHOHSHQVHHQFRQVLGpUDQWOH
IOX[SOXVYLVLEOHGLQWHUSUpWDWLRQVTXLYLHQWGHKDXWHQEDV
et parcourt les canaux officiels : GDXWUHVIOX[TXLVH[SUL-
ment dans la rception des lois, dans les coutumes, dans les
actes contra legemHWFIRQWGpMjGHOeJOLVHXQHFRPPXQDut
hermneutique articule, vivace et parfois conflictuelle 70.

la loi (Koncretisierung GDQVFKDTXHFDVSDUWLFXOLHU&HVWGRQFODWkFKHGH


ODSSOLFDWLRQ (H. G. GADAMER, Vrit et Mthode. Les grandes lignes
GXQH KHUPneutique philosophique, tr. fr., Seuil, Paris, 1976, p. 148). Ce
QHVWSDVSRXUULHQSUREDEOHPHQWTXHFHWWHPrPHLGpHGLQWHUprtation
TXL JOLVVH GDQV ODSSOLFDWLRQ HVW OH leitmotiv GX WKpRULFLHQ GH OLQterpr-
tation juridique plus ouvertement gadamrienne : J. ESSER, Vorver-
stndnis und Methodenwahl in der Rechtsfindung : Rationalittsgrundlagen
richterlicher Entscheidungspraxis, Scriptor Verlag, Kronberg/Ts., 1975.
69. Cf. F. VIOLA-G. ZACCARIA, Diritto e Interpretazione, op. cit.,
p. 132-133.
70'DSUqVF. VIOLA, La comunit , op. cit., la communaut eccl-
siale se diffrencie de la communaut politique-MXULGLTXHSDUFH TXHOOH
QDvWGXQHFRQYRFDWLRQHWVRQIDFWHXUGDJUpJDWLRQHVWODSDUticipation
la forme de vie du Christ, norme fondamentale de la communaut. La
FRQYRFDWLRQpWDQWjORULJLQHGHODFRPPXQDXWpHWODUpIOH[LRQVXUFHWpYp-
QHPHQW pWDQW ODFWLYLWp IRQGDPHQWDOH GH OD FRPPunaut, la communaut
ecclsiale est par essence une communaut interprtative, dans toutes ses
composantes OLQWHUSUpWDWLRQ GX 0DJLVWqUH OLQWHUSUpWDWLRQ GH OD WKpRORJLH
OLQWHUSUpWDWLRQ GX sensus fidelium pWDQW OHV WURLV IRUPHV GH OLQWHUSUpWDWLRQ
anime par le soufIOHGHO(VSULWVHORQODGLYHUVLWpGHs charismes) (p. 28-33).
/DXWHXU UHPDUTXH FRPPHQW GDQV OD FRPPXQDXWp MXULGLTXH OLQWHUprta-
tion est plus inventive que dans la communaut ecclsiale : ici il faut savoir
incarQHUOHVSULWGX&KULVWGDQVOHVVLWXDWLRQVOHVSOXVGLYHUVHVOjLOIDXWWrou-
ver les solutions les plus convenables et justes (p. 36). Quid du droit cano-
nique, qui est la fois une communaut ecclsiale et juridique ? En tant
TXH VFLHQFH GH ODFWLRQ OH GURLW FDQRQLTXH HVW MXVWHPHQW OD UHFKHUFKH
des solutions les plus convenaEOHV HW MXVWHV HQ HVVD\DQW GLQFDUner
OHVSULW GX &KULVW GDQV FKaTXH VLWXDWLRQFH TXLSHXWUpGXLUH OpYHQWDLO
des choix interprtatifs abstraitement possibles mais, malheureusement,
ne nous soustrait pas toujours la tragdie du choix. Sur le rapport entre
interprtation thologique et interprtation juridique, voir, entre autres, Ars
Se pose, alors, le problme de dpasser les conflits plus
graves, qui se traduisent en violence (la violence souple des
institutions dpourvues de bras sculier). Nous ne voyons
que deux solutions possibles : 1) un supplment de dialogue,
afin de dterminer une interprtation intersubjective qui
puisse teindre la violence grce la conversion spontane de
OXQjOLQWHUSUpWDWLRQUHFRQQXHPHLOOHXUHGHODXWUHRXjXQH
troisime interprtation, dgage en commun la fin du dia-
logue, de faoRQTXRQSXLVVHGLUHFRmme la fin du concile de
Jrusalem (Ac 15,28) : /(VSULW 6DLQW HW QRXV-mmes avons
GpFLGp  OLQWHUruption du dialogue, afin de se soustraire
la violence, quand les diffrentes interprtations sont incompa-
tiEOHVHWTXXQHSDUWLHSUptend imposer la sienne.
(QWRXVOHVFDVRQQHGHYUDLWSDVVHPpILHUGXQHLQWHrprta-
tion continue, infinie 71 FRPPH OHIIRUW GH FRPEOHU OD GLIf-
rence enWUHOHVRLHWODXWUH GDQVOHPRQGHGLFL-bas on ne peut
que se contenter de faire tous les efforts pour atteindre la Jus-
WLFHGDQVOHVSRLUGHSRXYRLUODFRQWHPSOHUGDQVO$X-del.
)LQDOHPHQW VL OLQWHUSUpWDWLRQ juste  QHVW SDV WRXjours
facile trouver, en revanche il est facile de trouver une solu-
tion simple et rassurante  FHVW OD VROXWLon conformiste dj
prpare pour nous. Le choix du canoniste se situe donc entre
deux possibilits RXELHQUHVWHUjORPEUHUDssuUDQWHGHODUEUH
mais sans aller nulle part RXELHQVpORLgner le long de la
prairie, en assumant le statut inquiHWGHOH[SORrateur de la vie
PRUDOHRXYHUWDX[DYHQWXUHVGHOLQWHUprtation.

Edoardo DIENI
Facult de Droit
Universit de Milan-Bicocca

interpretandi, 4, 1999, fascicule consacr /LQterpretazione del sacro e


OLQWHUSUHWD]LRQHJLXULGLFD .
71. Voir le livre de P. BORI, /,QWHUSUHWD]LRQHLQILQLWD/HUPHQHXWLFD
cristiana e le sue trasformazioni, Il Mulino, Bologna, 1987 ; D. BANON,
/D/HFWXUHLQILQLH/HVYRLHVGHOLQWHUSUpWDWLRQPLVGUDVKLTXH , Seuil, Paris,
1987 ; C. LUZZATI, La giustificazione infinita , Sociologia del diritto,
24 (1997), pp. 5-44 ; mais assi G. LO CASTRO, Conocimiento , op.
cit., p. 414.
L
E PROFESSEUR Louis de Naurois remarquait que
relativement diverses et nombreuses sont les
hypothses o le droit canonique est invoqu
devant les juridictions tatiques 1.
Les juridictions tatiques peuvent tre conduites pren-
dre en compte le droit interne des religions dans le cadre de
leur apprciation des faits. 8Q DUUrW GH OD FRXU GDSSHO GH
Bruxelles du 25 septembre 1998 souligne que le Code de
droit canonique HQ WDQW TXLO rgle notamment les rap-
SRUWVHQWUHOHFXUpHWVRQpYrTXH>@FRQWLHQWGHVQRUPHVj
FDUDFWqUH MXULGLTXH VXVFHSWLEOHV GpFODLUHU OD FRXU TXL GRLW
en tirer, au niveau du droit belge, les consquences utiles
au rglement du litige 2.
Une place particulire GRLW rWUH IDLWH j FH TXH ORQ SHXW
DSSHOHU OH FRQWU{OH GH OLGHQWLWp ,O VDJLW GX FDV R il faut
dterminer si une personne morale, ou un ministre du culte,
UHOqYH GXQH UHOLJLRQ GpWHUPLQpH 3. Par exemple, lorsque le
juge franais se prononce sur un conIOLW GDWWULEXWLRQGpGL-
fice cultuel revendiqu par plusieurs collectivits religieuses,
LOWUDQFKHFHOLWLJHHQRSpUDQWXQFRQWU{OHGHOLGHQWLWp

1. Louis de NAUROIS, Le droit canonique devant les juridictions


tatiques , A. C. 1982, p. 301.
2. Bruxelles 25 septembre 1998, arrt n JB40763.
3. Sur cette possibilit, cf. Francis LYALL, Of Presbyters and Kings,
Church and State in the Law of Scotland, Aberdeen, Aberdeen Univer-
sity Press, p. 77.
Il est plus rare que les autorits sculires appliquent le
droit canonique en tant que rgle de droit. Mais cela peut
arriver 4.
Quels que soient les motifs qui les conduisent prendre
en compte le droit canonique, les autorits sculires sont
confrontes des normes qui peuvent leur sembler baro-
ques. Et elles GRLYHQW LQWHUSUpWHU FHVW--dire discerner le
vritable sens 5, de normes qui, en gnral , ne posent pas
de problme au canoniste. Les juges et les fonctionnaires de
OeWDWQRQWQLODIRUmation, ni la comptence, ni la lgitimit
pour interprter le droiWFDQRQLTXH,OHVWpYLGHQWTX ils sont
mal quips 6.
(Q UpDOLWp LO VDJit moins pour les autorits sculires
GHVVD\HUGHUpVRXGUHXQSUREOqPHGRFWULQDOTXHGHWHQWHU
de comprendre ce que signifie la rgle canonique. La diffi-
cult est de la replacer dans son contexte EUHIGavoir un
aperu gnral permettant de ne pas dnaturer le droit de
Oglise. 3RXU OHVVHQWLHO OD TXHVWLRQ GH OLQWHUSUpWDWLRQ GX
droit FDQRQLTXH SDU OHV RUJDQHV GH OeWDW VLGHQWLILH DYHF
celle de sa comprhension.
,O QHVW SRVVLEOH GDQV OH FDGUH GXQH Welle tude, que de
dresser un bref tableau de la question. Pour tre complet, il
IDXGUDLW DQDO\VHU OHQVHPEOH GHV GpFLVLRQV UHQGXHV SDU OHV
RUJDQHV GH OeWDW TXL FRQFHUQHQW Oeglise catholique. En
outre, le dveloppement de la jurisprudence de la Cour euro-
SpHQQHGHVGURLWVGHOKRPPHHWGHVHVHIIHWVHQGURLWIUDQ-
ais justifie sa prise en compte. Enfin, il a sembl ncessaire
GHUHFRXULUDXGURLWFRPSDUpDILQGpFODLUHUODVLWXDtion fran-
aise.
Les autorits tatiques et inter-tatiques ont interprt le
droit canonique dans plusieurs domaines. Elles ont analys
la nature et le fondement du droit canonique (1re partie), la
FRQVWLWXWLRQ KLpUDUFKLTXH GH Oeglise (2me partie), le droit

4. Voir Emmanuel TAWIL, Norme religieuse et droit franais, Aix-en-


Provence, P.U.A.M. 2005, 318 pages.
5. Grard CORNU, Vocabulaire juridique, Paris, P.U.F., coll. Qua-
drige , 2000 p. 475.
6. Louis de NAUROIS, Le droit canonique devant les juridictions
tatiques , loc. cit., p. 303.
matrimonial (3me partie) et la procdure canonique (4me
partie).

Les organes de certains tats reconnaissent la spcificit


ecclsiale.
3DU H[HPSOH ODUUrW GH OD FRXU GDSSHO GH %UX[HOOHV GX
25 septembre 1998 affirme que le droit canonique actuel
a pour objet les relatLRQVVRFLDOHVH[LVWDQWGDQVOglise et de
nature ecclsiale et est une science la fois de nature sacre
HWMXULGLTXH>@ ; que dj avant la rforme du droit canon
de 1983, ce droit entendait rgler notamment la constitu-
WLRQGHOeglise catholique, son administration disciplinaire
et son organisation 7.
(Q ,WDOLH FHVW OH &RQVWLWXDQW OXL-mme qui a pris en
FRPSWH OD QDWXUH GH Oeglise, et consquemment, son droit.
/DUWLFOH  GH Oa Constitution prvoit que OeWDW HW Oeglise
catholique sont, chacun dans son propre domaine, indpen-
dants et souverains  &pWDLW Oj QRQ VHXOHPHQW JDUDQWLU OD
libertas ecclesiae, mais galement reconnatre, au moins impli-
citePHQWODGRFWULQHGHOeglise-Societas perfecta 8.
0DLV WHOOH QHVW SDV OD VLWXDWLRQ IUDQaise. Au contraire,
comme en Angleterre 9 ou en Irlande 10, la rduction du

7. Bruxelles 25 septembre 1998, arrt n JB40763.


8. Sur le droit italien, voir Emmanuel TAWIL, Les relations conven-
tionQHOOHVHQWUHOeWDWHWOHVFRQIHVVLRQVUHOLJLHXVHVHQ,WDOLH , Cahier de
la recherche sur les droits fondamentaux, 2005, p. 139-156.
9. En Angleterre, le droit canonique peut tre appliqu par les juri-
dicWLRQVpWDWLTXHVHQWDQWTXLOFRQVWLWXHGHVGLVSRVLWLRQVGHQDWXUHFRQ-
tractuelle (Norman DOE, The legal framework of the Church of England,
Oxford, Clarendon Press, 1996, p. 24-25).
10. En Irlande, au-GHOjGXOHSULQFLSHGDXWRQRPLHGHVFROOHFWLYLWpV
religieuses, une habilitation normative peut tre trouve dans le droit
contractuel. Ainsi, le juge Sullivan affirmait-il dans une opinion rdige
pour la Cour suprme, que OH VWDWXW GXQH eJOLVH QRQ pWDWLTXH HVW
selon les terme de Barry J., dans le cas 2.HHIHY&XOOHQOHVWDWXWGXQH
association volontaire, dont les membres reconnaissent ou approuvent
FHUWDLQHVUqJOHVHWSUHVFULSWLRQVHWVREOLJHQWHX[-mmes mutuellement
se conformer certaines lois et principes (James CASEY, tat et
droit canonique aux concepts et catgories tatiques est une
tendance des organes tatiques. Ainsi la comptence nor-
maWLYHGHOeglise ne trouve plus son fondement que dans
la libert contractuelle. De mme, le Saint-Sige est con-
IRQGXDYHFOtat de la Cit du Vatican.

Louis de Naurois remarquait que si effectivement les


exigences du droit canonique sont sauves dans les dcisions
des tribunaux, on ne peut pas ne pas tre frapp parfois,
par une tendance ramener les institutions canoniques aux
LQVWLWXWLRQVpWDWLTXHVDXSUL[OHFDVpFKpDQWGXQHFHUWDLQH
distorsion ; le caractre des UHODWLRQVFDQRQLTXHVVHVWRPSH
DXSURILWGXQHVWUXFWXUHSXUHPHQWFRQWUDFWXHOOHSOXVSUp-
cisment parfRLV GH OD VWUXFWXUH GH FRQWUDWV FODVVLTXHV
dont les liens canoniques sont en ralit assez loigns 11.
En effet la jurisprudence franaise considre que le droit
canonique nHVW LQVpUp GDQV OH GURLW GH Oetat que par le
ELDLV GX GURLWFRQWUDFWXHO$LQVL ODFRXU GDSSHOGH&KDP-
bry, dans un arrt du 15 janvier 1964, a prcis que les
normes de droit canonique peuvent tre insres dans
ORUGUHMXULGLque franais, dans la mesure o elles sont com-
patibles avec les principes du droit civil. La Cour souligne
TXH OHVMXULGLFWLRQV GH Oetat GRLYHQW>@OHVGLVSRVLtions
GXGURLWFDQRQLTXHQD\DQWHQODPDWLqUHULHQGLOOLFLWHOHV
tenir pour valables GDQVOHFDGUHGHODUWLFOHGX&RGH
FLYLOHWGXSULQFLSHGHODXWRQRPLHGHODYRORQWpFRPPHHVW
valable toute convention conclue entre particuliers dont
OREMHWQHVWFRQWUDLUHQLjODORLQLDX[PXUV 12.

glise en Irlande , Gerhard ROBBERS et al., WDWHWeJOLVHVGDQVO8QLRQ


europenne, Baden-Baden, Nomos, 1997, p. 166).
11. Louis de NAUROIS, Le droit canonique devant les juridictions
tatiques , loc. cit., p. 301.
12. Chambry 15 janvier 1964, note Jean D AUVILLIER, D. 1964, J.,
p. 605.
/DUUrW GH OD &RXU HXURSpHQQH GHV GURLWV GH OKRPPH
rendu le 20 juillet 2001, Pellegrini c. Italie 13 est un exemple
de la confusion entre Saint-Sige, glise catholique et tat
de la Cit du Vatican.
Les juges de Strasbourg qualifient expressment les tri-
bunaux du Saint Sige de MXULGLFWLRQVGXQSD\V :
/D&RXUQRWHGHPEOpHTXHODGpFODUDWLRQGHQXOOLWpGX
mariage de la requrante a t mise par les juridictions du
Vatican, puis rendue excutoire par les juridictions italien-
QHV 2U OH 9DWLFDQ QD SDV UDWLILp OD &RQYHQWLRQ HW SDU
DLOOHXUV OD UHTXrWH HVW GLULJpH FRQWUH O,WDOLH : la tche de la
Cour consiste ds lors non pas examiner si la procdure
VpWDQW GpURXOpH GHYDQW OHV MXULGLFWLRQV HFFOpsiastiques tait
conforme ODUWLFOHGHOD&RQYHQWLRQPDLVVLOHVMXULGLF-
WLRQVLWDOLHQQHVDYDQWGHGRQQHUOH[HTXDWXUjODGLWHGpFOD-
ration de nullit, ont dment vrifi que la procdure rela-
tive remSOLVVDLW OHV JDUDQWLHV GH ODUWLFOH  ; un tel contrle
VLPSRVH HQ HIIHW, lorsque la dcision dont on demande
OH[HTXDWXUpPDQHGHVMXULGLFWLRQVGXQSD\VTXLQDSSOLTXH
pas la Convention ( 40).
Or, la Rote et la Signature apostolique (qui ont connu
GHODIIDLUH3HOOHJULQL QHVRQWSDVGHVWULEXQDX[GHOetat de
la Cit du Vatican, mais des tribunaux du Saint-Sige.
Ceux-ci exercent un pouvoir vicaire, tirant leur autorit de
celle du souverDLQ SRQWLIH HQ WDQW TXLO HVW pvque de
5RPHHWQRQHQWDQWTXHFKHIGetat du Vatican.

ORFFDVLRQGHOHXrs activits, les autorits GHOetat sont


amenes analyser la FRQVWLWXWLRQKLpUDUFKLTXHGHOeglise.
Elles font rfrence la communion hirarchique, aux
comptences des autorits ecclsiales, au lien entre le prtre

13. C.E.D.H. 20 juillet 2001, Pellegrini c. Italie, note Edoardo


DIENI, RDC 2001, p. 127- 161.
diocsain et son vque, et au lien entre le religieux et son
suprieur.

Le juge franais a interprt la rfrence aux rgles g-


nrales du culte , sur la base desquelles doivent tre attri-
bus les difices affects au culte catholique et appartenant
au domaine public en vertu des lois du 9 dcembre 1905 et
du 2 janvier 1907.
Les SUHPLqUHVGpFLVLRQVQpWDLHQWSDV WRXWHVUHVSHFWXHXVHV
GHV SULQFLSHV FDQRQLTXHV TXL GpWHUPLQHQW ODSSDUWHQDQFH
ecclsiale. Un jugement a ainsi considr comme prtre catho-
lique XQSUrWUHVFKLVPDWLTXHDXUHJDUGGXGURLWGHOglise 14.
Mais assez rapidement, la jurisprudence a considr que
ces difices ne pouvaienWrWUHDIIHFWpVTXDX[SUrWUHVLnsrs
GDQVODKLpUDUFKLHGHOeglise catholique FHVWjODFRPPu-
nion hirarchique que le juge franais a fait, plus ou moins
expressment, rfrence.
$LQVLGqVODUUrWGHODFRXUGDSSHOGH%DVWLDGXIpYULHU
1908, il tait affirm, au sujet des associations cultuelles
TXHOOHV doivent tre en communion avec Opvque, uni lui-
mme au souverain pontife 15. Or, le pape ayant interdit
aux catholiques de former des associations cultuelles, il est
impossible que de telles associations soient en communion
DYHFOpYrTXH lui-mme en communion avec le pape.
Il a t JDOHPHQW VRXOLJQp TXXQ SUrWUH VFKLVPDWLTXH
npWDLWSDVHQFRPPXQLRQDYHFOeglise catholique 16.

14. $WWHQGX>@TXHODEEp&DYDLOOpHVWFXUpGH3X\PDVVRQTXLO
parat tre le seul prtre en France qui ait constitu parmi les catholi-
ques une association cultuelle et qui se soit conform ainsi la loi du 9
dcembre 1905 ; que dans ces conditions, il serait difficile de ne pas lui
reconnatre la qualit de ministre du culte catholique (Tribunal civil
de Nrac, 9 novembre 1907, Abb Duprat et al. c. Abb Cavaill, D.
1910, 2me partie, p. 25).
15. Bastia 17 fvrier 1908, Flix Colonna et Forcioli c. Antoine
Colonna, D. 1908, 2me partie, p. 89 et S. 1909, 2me partie, p. 273.
16 7ULEXQDO FLYLO G$JHQ  PDUV  : Un maire avait pass une
FRQYHQWLRQDYHFODEEp&DYDLOOpSUrWUHVDQFWLRQQpSDUVRQpYrTXHSRXU
ORFFXSDWLRQGXQHpJOLVHOpJDOHPHQWDIIHFWpHDXFXOWHFDWKROLTXH/HGHV-
Une autre dcision a constat TX tre vieux catholi-
TXHFHQHVWSDVrWUHFDWKROLTXHURPDLQ 17.

serYDQWQRPPpSDUOpYrTXHVHVWRSSRVpjFHSUrWUHVFKLVPDWLTXH&HWWH
affaire a donn au juge ORFFDVLRQGLQWHUSUpWHUOHGURLWFDQRQLque.
$WWHQGXTXHODEEp&DYDLOOp>@DpWpIUDSSpSDUVHVFKHIVD\DQW
TXDOLWp SRXU OD SURQRQFHU GXQH VXVSHQVH WRWDOH GRQW LO QH SHXW QLHU
avoir eu connaissance >@
$WWHQGX TXH ODEEp &DYDLOOp FRQWLQXDQW clbrer les offices du
FXOWHFDWKROLTXHPpFRQQDvWODXWRULWpGHVHVFKHIVKLpUDUFKLTXHV ; et par
VXLWH OH WULEXQDO TXHOV TXHQ VRLHQW OHV PRWLIV QH SHXW TXH FRQVWDWHU
un fait, savoir que Cavaill est un prtre schismatique ;
$WWHQGXTXHQFHWWH TXDOLWpLOQDSRLQWOHGURLWGHSDUODORLGH
clbrer dans une glise qui, telle que celle de Saint-+LODLUHQDMDPDLV
FHVVpGrWUHDIIHFWpHDXFXOWHFDWKROLTXH>@
$WWHQGXHQFRQVpTXHQFHTXLOHVWFHUWDLQTXHODEEp&DYDLOOpSUr-
tre schismatiTXH QDYDLW SDV OH GURLW GRIILFLHU GDQV OpJOLVH GH 6DLQW-
+LODLUH HW TXH OH PDLUH GH OD FRPPXQH QDYDLW SDV OH SRXYRLU OpJDO
GDWWULEXHUODMRXLVVDQFHGHOpJOLVHDXGLW&DYDLOOp
$WWHQGX TXLO QHVW SRLQW FRQWHVWp TXH ODEEp &DUGRQQH GHVVHU-
vant depuis vingt ans de la paroisse de Saint-Hilaire, est rest cur de
ladite paroisse par la volont de son vque, lequel a t nomm par le
pape  TXLO VXLW GH Oj TXH ODEEp &DUGRQQH HVW XQ SUrWUH FDWKROLTXH
URPDLQ DXTXHO OpJOLVH GH 6DLQW-+LODLUH QD FHVVp GrWUH DIIHFWpH (Tri-
EXQDOFLYLOG$JHQPDUV Abb Cardonne et al c. Cavaill et al.,
D. 1910, 2me partie ; p. 251) .
Agen 19 juillet 1909 :
Autre affaire, impliquant le mme prtre.
$WWHQGXTXLOUpVXOWHGHVIDLWVGHODFDXVHHWGHVGRFXPHQWV verss aux
GpEDWVTXHODEEp&DYDLOOpGHVVHUYDQWGHOpJOLVHGH3X\PDVVRQFRPPXQH
de Clermont-Dessous (Lot-et-Garonne) a t frapp, le 10 octobre 1905, par
OHVYLFDLUHVFDSLWXODLUHVGXUDQWODYDFDQFHGXVLqJHpSLVFRSDOGXQHVXVSHQVH
totale, qui a entran la rvocation de ses fonctions TXHODGPLQLVWUDWLRQ
FDSLWXODLUH D\DQW SULV ILQ OpYrTXH G$JHQ FRQILUPD FHWWH VXVSHQVH OH 
mars 1906  >@ TXXQH DVVRFLDtion cultuelle ayant t constitue Puy-
PDVVRQ HW D\DQW UHFRQQX ODEEp &DYDLOOp FRPPH Gesservant de cette
SDURLVVHOpYrTXHG$JHQDUHQGXOHPDLXQHRUGRQQDQFHSRUWDQW
LQWHUGLWGHOpJOLVHGH3X\PDVson TXHGDQVFHVFRQGLWLRQVODEEp&DYDLOOp
ne saurait tre considr actuellement comme prtre catholique romain, et
TXRQ QH SHXW TXH FRQVWDWHU TXLO HVW XQ SUrWUH VFKLVPDWLTXH (Agen 19
juillet 1909, D. 1910, 2me partie, p. 25).
17. $WWHQGXHQOHVSqFH TXH ODTXDOLWp GHFDWKROLTXHV URPDLQVTXH
revendiquent Dumas et consorts ne leur est pas conteste TXDXFRQWUDLUH
Fatme se dit lui-PrPH FDWKROLTXH UHOHYDQW GH OeJOLVH G8WUHFKW HW QH
UHFRQQDLVVDQWSDVFHUWDLQVGRJPHVDX[TXHOVVHVWVRXPLVHOeJOLVHGH5RPH
WHOVTXHO,PPDFXOpH FRQFHSWLRQHWOLQIDLOOLELOLWp SRQWLILFDOH ; TXRQ FKHU-
/D MXULVSUXGHQFH LQVLVWH VXU OLPSRUWDQFH GH OD VRXPLV-
sion la hirarchie 18. La Cour de cassation elle-mme y a

che vainement quivoquer sur le mot FDWKROLTXH  TXrWUH YLHX[


cathoOLTXHFHQHVWSDVrWUHFDWKROLTXHURPDLQ TXHOHWULEXQDOQDSDV
rechercher si la confession ou secte laquelle est affili Fatme est
plus orthodoxe que la secte ou confession romaine, plus respectueuse
de la doctrine du Christ et des enseignePHQWV GH OeJOLVH SULPLWLYH ;
TXLO QD SDV QRQ SOXV j VH SUpRFFXSHU GHV TXHVWLRQV GH KLpUDUFKLH HW
GRUganisation intrieure de chacune des deux glises TXLOOXLVXIILWGH
consWDWHU TXLO HVW HQ SUpVHQFH GH GHX[ UHOLJLons distinctes, profrant
des dogmes diffrents (Tribunal civil de Brive 23 dcembre 1908,
Dumas et al. c. Chouzenoux, D. 1910, 2me partie, p. 25).
18. Seuls sont catholiques, apostoliques et romains, ceux qui sont
reconnus par le pouvoir ecclsiastique SDUOpYrTXHHQFHTXLFRQFHUQH
le prtre, et par le prtre en ce qui concerne les fidles (Tribunal civil
de Ribrac, 3 juin 1909, Abb Capoul c. Guionie et al. D. 1910, 2me par-
tie, p. 25) ; 3DUOH[SUHVVLRQPLQLVWUHGXFXOWHODORLGpVLJQHpvidem-
PHQWTXDQGLOVDJLWGX FXOWHFDWKROLTXHOH SUrWUHTXLHVW HQFRPPX-
QLRQ DYHF VHV VXSpULHXUV KLpUDUFKLTXHV  TXHQ GHKRUV GH FHOD OD ORL
QLQGLTXHDXFXQHFRQGLWLRQSDUWLFXOLqUHHWQHIDLWDOOXVLRQQLjODQpFHV-
sit du titre de cur, ni la nature des crmonies religieuses que le
prtre peut tre appel clbrer TXLO\DOLHXPrPHGREVHUYHUTXH
VLOHVWQpFHVVDLUHTXHOHSUrWUHVRLWFKDUJpSDUODXWRULWpGLRFpVDLQHGDG-
miQLVWUHUODSDURLVVHFHQHVWTXHQFDVGHFRQIOLWDYHFXQDXWUHSUrtre ;
>@ TXLOVXIILWjXQSUrWUHGrWUHFKDUJpSDUVRQpYrTXHGXVHUYLFHGXQH
SDURLVVHSRXUrWUHLQYHVWLGHVGURLWVFRQIpUpVSDUODUWLFOHGHODORLGX
janvier 1907 (Tribunal civil de Moissac, 20 juin 1910, Abb Lacroix,
D. 1911, 2me partie, p. 105) ; le lgislateur de 1905 a voulu permettre
OD SUDWLTXH HW OH[HUFLFH GH FKDTXH FXOWH GDQV OHV PrPHV FRQGLWLRQV
TXDYDQW OD VpSDUDWLRQ GHV eJOLVHV HW GH OeWDW FHVW--dire suivant les
UqJOHVGRUJDQLVDWLRQHWGHGLVFLSOLQHSURSUHVjFKDFXQGHX[GRUpVXO-
tent pour les fidles, le droit de pntrer dans les glises et de prier
indiYLGXHOOHPHQWjWRXWHKHXUHHWVLOVDJLWGXFXOWHFDWKROLTXHURPDLQ
GRQWOHVUqJOHVIRQGDPHQWDOHVQpFHVVLWHQWOLQWHUYHQWLRQGXSUrWUHSRXU
les chants et les prires liturgiques, le droit exclusif pour le ministre de
FHWWHUHOLJLRQGHVHVHUYLUGHVREMHWVPRELOLHUVDIIHFWpVDXFXOWHGDXWRri-
VHU OHV FpUpPRQLHV G\ SUpVLGHU HW GHQ UpJOHU OD SRPSH HW OHV GpWDLOV
(Pau 27 juin 1910, Abb Lacroix, D. 1911, 2me partie, p. 105) ; par
PLQLVWUH GX FXOWH FDWKROLTXH RQ GRLW HQWHQGUH QRQ OH UHSUpVHQWDQW
des fidles, mais le prtre investi de la qualit de ministre du culte par
ODXtorit diocsaine et en communion avec elle (Pau 15 mars 1911,
Abb Somlhve c. Lembeye, maire de Sainte-Colome, S. 1911, 2me partie,
p. 116) ; OH[HUFLFHGDQVOpJOLVHGH*UDQJHV-G$QVGXFXOWHFDWKROLTXH
VXLYDQW OHV UqJOHV GH FHWWH UHOLJLRQ FHVW--dire sous la direcWLRQ GXQ
SUrWUHGpVLJQpSDUOpYrTXHGXGLRFqVHGpVLJQpOXL-mme par le pape de
5RPHFKHIGHOeJOLVHFDWKROLTXHHVW GRQFODGHVWLQDWLRQH[FOXVLYHGH
fait rfrence ds ses arrts du 5 fvrier 1912 : Attendu
TXH>@OHOpJLVODWHXUDHQWHQGX>@DVVXUHUPrPHHQGHKRUV
de toute concession et de tout contrat, le libre exercice de
chaque culte dans les difices qui lui taient consacrs, et,
par suite, en ce qui concerne les difices affects au culte
catholique, l'exercice d'un culte pratiqu selon les prceptes
de l'glise catholique par des prtres reconnaissant la hirar-
chie et faisant partie de cette hirarchie 19 ; au cas o un
conflit s'lve entre deux prtres pour l'occupation d'une glise
catholique, l'attribution de celle-ci doit tre exclusivement
rserve celui qui se soumet aux rgles d'organisation gn-
rale du culte, dont il se propose d'assurer l'exercice, notam-
ment celles de la hirarchie ecclsiastique et qui demeure en
communion avec son vque 20.
/H&RQVHLOGeWDWQDIDLWUpIpUHQFHTXHSOXVWDUGLYHPHQW
la communion hirarchique. Avant la premire Guerre
monGLDOHODQRWLRQQDSSDUDLVVDLWSDVH[SOLFLWHPHQW 21. Mais
GDQV ODUUrW GX  MDQYLHU  Abb Barraud et al., le
&RQVHLOGtat relve :
&RQVLGpUDQW TXHQ YHUWX GH FHW DUWLFOH OHV pGLILFHV UHOL-
gieux doivent rester affects au culte qui y tait clbr sous
la priode concordataire ; que la disposition et le jouissance
QHQSHXYHQWGRQFrWUHOpJDOHPHQWDWWULEXpTXHQFRQformit

OpJOLVHGH*UDQJHV-G$QV (Tribunal civil de Prigeux, Abb Chaumette


et autres c. Vigier et Bardet, maire de Granges-d'Ans S. 1912, 2me partie,
p. 133).
19. Civ., 5 fvrier 1912, Forcioli c. Colonna, D. 1912, 1re partie,
p. 121.
20. Civ., 6 fvrier 1912, Esdoluc c. Journiac, D. 1912, 1re partie,
p. 121.
21  &RQVLGpUDQW TXj OD GDWH R HVW LQWHUYHQX OH GpFUHW DWWDTXp
ODVVRFLDWLRQTXLVpWDLWFRQVWLWXpj6DLQV-les-Fressin avait fait appel pour
la clbration du culte un prtre qui ne reconnaissait pas la hirarchie
HFFOpVLDVWLTXH HW VpWDLW PDLQWHQX HQ SRVVHVVLRQ GH OpJOLVH SDURLVVLDOH
PDOJUpXQHGpFLVLRQGHOpYrTXHGpVLJQDQWXQDXWUHSUrWUHSRXUGHVVHU-
vir la paroisse ; que dans ces conditions, les requrants sont fonds
VRXWHQLU TXHOOH QH VpWDLW SDV FRQIRUPpH DX[ UqJOHV GRUJDQLVDWLRQ GX
FXOWH FDWKROLTXH VXLYDQW OHV SUHVFULSWLRQV GH ODUWLFOH  GH OD ORL GX 
dcembre 1905 (C. E. 28 juillet 1912, Sieur Rougegr et autres, Leb.,
p.   'RQF OpJOLVH QH SHXW rWUH DWWULEXpH TXj XQ SUrWUH GpVLJQp
par OpYrTXH
GHV UqJOHV GRUJDQLVDWLRQ JpQpUDOH GH FH FXOWH OHVquelles
comprennent, en ce qui concerne la religion catholique, la
soumission la hirarchie ecclsiastique 22.
La jurisprudence est toujours fidle ces principes 23.

/HVRUJDQHVGHOetat analysent galement les compten-


ces des autorits ecclsiales.

1) Lapprciation dans le cadre du recours pour abus

Dans le cadre du rHFRXUV SRXU DEXV OH &RQVHLO Getat


avait pour mission de garantir le respect de certaines rgles
intra-ecclsiales, rHODWLYHVjODVWUXFWXUHGHOeglise. Il appr-
hendait, comme le lgislDWHXUGHODYDLWYRXOXOeJOLVH
qui est en France comme glise gallicane, dont il devait
protger les liberts, franchises et coutumes.
/H&RQVHLOGetat interprtait les comptences des orga-
QHVGHOeglise. Il prcisait ainsi quel devait tre le contenu
des lettres pastorales des vques :
Aux termes de la Dclaration de 1682, il est de maxime
fondamentale, dans le droit public du royaume, que le chef
GH OeJOLVH HW OeJOLVH PrPH QRQW UHoX GH SXLVVDQFH TXH
sur les choses spirituelles, et non pas sur les choses tempo-
relles et civiles >@VLODSSDUWLHQWDX[pYrTXHVGXUR\DXPH
GH >@ VRXPHWWUH >DX 5RL@ UHODWLYHPHQW DX[ DFWHV >@ TXL
WRXFKHQWDXWHPSRUHOGHOHXUVpJOLVHVOHVUpFODPDWLRQVTXLOV
FURLHQW MXVWHV HW XWLOHV FH QHVW SRLQW SDU la voie des lettres
SDVWRUDOHVTXLOVSHXYHQWH[HUFHUFHGURLWSXLVTXHOOHVQHGRL-

22. C. E. 23 janvier 1920, Abb Barraud et autres, Leb., p. 75.


23. &RQVLGpUDQWTXLOHVWGHMXULVSUXGHQFHFRQVWDQWHTXDXFDVR
un conflit s'lve, quant l'utilisation d'une glise, l'attribution de celle-
ci doit tre exclusivement rserve, en vertu de l'art. 5, 1er, de la loi
du 2 janv. 1907, aux prtres et aux fidles qui veulent y pratiquer leur
religion en soumettant aux prceptes de l'glise catholique, et notam-
ment aux rgles de la hirarchie ecclsiastique et en demeurant en
communion avec l'vque (Paris 13 juillet 1977, Abb Coache c. Abb
Bellego et autres, D. 1977, J., p. 458).
YHQW DYRLU SRXU REMHW TXH GLQVWUXLUH OHV ILGqles des devoirs
religieux qui leur sont prescrit 24.
De mme, OH&RQVHLOGetat considrait que les pouvoirs
des vques sont enferms dans les limites de leurs diocses.
,ODHQFRQVpTXHQFHGpFLGpTXLO\DYDLWDEXVGDQVODGpOL-
bration commune de plusieurs vques et archevques, sui-
YLHGHGpFLVLRQVFRPPXQHVHWGHODSXEOLFDWLRQGXQHOHWWUH
pastorale collective 25.
,OIDXWpJDOHPHQWUDSSHOHUTXHOH&RQVHLOGtat refusait
GH UHFRQQDvWUH ODXWRULWp GHV GLFDVWqUHV URPDLQV ,O D DLQVL
GpFODUpTXHODPLVHjH[pFXWLRQSDUXQpYrTXHGXQHGpFL-
VLRQGHOD&RQJUpJDWLRQGHO,QGH[pWDLWFRQVWLWXWLYHGXQH
atteinte aux privilgeV IUDQFKLVHV HW FRXWXPHV GH Oeglise
gallicane 26.
Ces rgles sont toujours en vigueur, en principe, en
Alsace-Moselle 27.

 /DSSUpFLDWLRQGDQVOHFDGUHGHODORLGH

Depuis 1905, il y a trs peu de dcisions interprtant


OpWHQdue des comptences des autorits ecclsiales.
On peut citer un jugement de 1910 qui remarque que les
ILGqOHVSDUFHODVHXOTXLOVVHGpFODUHQWFDWKROLTXHVUHFRQnais-
VHQWOHPLQLVWUHGXFXOWHFRPPHOHGLUHFWHXUHWORUGRQnateur
des crmonies cultuelles 28. Un DUUrWGHODFRXUGDSSHOGH
Pau du 27 juin 1910 considre galement que les principes de
la liturgie catholique QpFHVVLWHQW OLQWHUvention du prtre
pour les chants et les prires liturgiques 29.

24. C. E. 21 mars 1837, Mgr de Qulen, S. 1837, 2me partie, p. 196.


25. C. E. 23 juillet 1863, Bodez, Leb., p. 1004 ; C. E. 5 mai 1892,
vTXHV G$YLJQRQ GH 0RQWSHOOLHU GH 1vPHV GH 9DOHQFH HW GH 9LYLHUV ,
Leb., p. 1013.
26. C. E. 26 avril 1883, YrTXHVG$QQHF\GH9LYLHUVGH/DQJUHVGH
Valence et archHYrTXHG$OEL, Leb., p. 990.
27. Emmanuel TAWIL, Le recours pour abus dans les trois dparte-
ments concordataires franais , RDC 2000, p. 89-111.
28. Tribunal civil de Moissac, 20 juin 1910, Abb Lacroix, D. 1911,
2me partie, p. 105.
29. Pau 27 juin 1910, D. 1911, 2me partie, p. 105.
'HPrPHXQMXJHPHQWGHDIILUPHTXXQHFpUpmo-
nie catholique doit tre prside par un prtre dsign par
OpYrTXHGXGLRFqVHGpVLJQpOXL-mme par le pape de Rome,
FKHIGHOeglise catholique 30.

/HVRUJDQHVGHOetat se sont prononcs sur les rapports


entre le prtre et son vque.

 /DEVHQFHGHFRQWUDWGHWUDYDLOOLDQWOHSUrWUHGLRFpVDLQHWVRQpYrTXH

3RXUOHVMXULGLFWLRQVGHOetat, par le jeu des institutions


de l'glise catholique, le prtre sculier, tenu envers son
vque d'une simple promesse d'obissance ne contracte pas
avec lui 31.

 /HVUDSSRUWVHQWUHOHFXUpHWVRQpYrTXHDXUHJDUGGHODUWLFOH
du Code civil

/DUWLFOHGX&RGHFLYLO en vigueur en France et en


Belgique, prvoit une prsomption de responsabilit des
commettants pour les dommages causs par leurs prposs.
/DFRXUGDSSHOGH%UX[HOOHVDGXDQDO\VHUHWLQWHUSUpWHUOH
GURLWFDQRQLTXHSRXUFRQFOXUHTXHFHWH[WHQHVWSDVDSSOL-
FDEOH DX UDSSRUW HQWUH XQ SUrWUH HW VRQ pYrTXH /DUUrW
interprte les dispositions du Code de 1983 relatives aux
prrogatives des vques :
Attendu qu'il n'est pas contestable que l'vque a auto-
rit sur le cur ; que notamment l'vque rige, supprime
ou modifie les paroisses, nomme les curs, peut les trans-
frer, les rvoquer ou accepter leur renonciation (cf. notam-
ment canons 515, 523, 538 et 1740 et suivants) ; qu'il
exerce le pouvoir lgislatif, excutif et judiciaire (canon 391)

30. Tribunal civil de Prigueux, Abb Chaumette et autres c. Vigier et


Bardet, maire de Granges-d'Ans, S. 1912, 2me partie, p. 133.
31. Chambry 15 janvier 1964, D. 1964, J., p. 605.
et veille la discipline ecclsiastique (canon 392) ; qu'il peut
en outre rglementer certains aspects de la vie paroissiale et
tablir des rgles de prdication et certaines rgles relatives
au catchisme (voir notamment canons 535 4, 536, 772
2 et 775 1) ; que les prcisions donnes par l'vque ...U...
durant l'enqute ou devant le premier juge ne contredisent
pas l'ensemble de ces normes ;
Que cependant, d'autres rgles du droit canon consa-
crent, par ailleurs, l'aXWRQRPLHGXFXUpGpFULWFRPPHSDV-
WHXUSURSUH et qui a la charge pastorale de sa communaut
(cf. canons 515 et 519) >@ ; Qu'en outre, parmi les rgles
numres dans le code actuel de droit canon figurent entre
autres :
1) le principe de la stabilit du cur, qui ne peut tre
nomm pour un temps limit (canon 522) et qui ne peut
tre rvoqu que pour des causes graves et selon la proc-
dure lgale (canon 193) ;
2) outre les tches pastorales gnrales numres aux
canons 528 et 529, le cur est spcialement investi de sept
fonctions numres et dfinies au canon 530, consistant
notamment en l'administration de certains sacrements, la
clbration de divers rites et l'octroi de bndictions sp-
ciales, et reoit d'autres comptences particulires dcrites
aux canons 767, 1196 et 1245 ; ces comptences dcoulent
du droit canon et non d'une dcision particulire manant
de l'vque >@;
Attendu qu'il se dduit de ces considrations que l'v-
que a autorit sur les curs et encadre ceux-ci par des direc-
tives essentiellement gnrales et des mesures disciplinaires,
sans cependant avoir le droit de leur donner des ordres sur
la manire dont ils exercent leur ministre propre ; que la
large sphre d'autonomie des curs est en effet assure par
leur stabilit ds leur entre en fonction, la spcificit de
leurs comptences qu'ils puisent dans le droit canon et
l'loignement gographique, par rapport l'vch, du lieu
de leur ministre et de rsidence ;
Qu'il ne peut y avoir ds lors de lien de subordination
entre le prvenu d'une part et les cits comme civilement
responsables d'autre part 32.
/LQWHUSUpWDWLRQFRUUHVSRQG-elle vraiment au droit positif
GHOglise "/D&RXUQLQWHUSUqWH-t-elle pas de manire exag-
UpHOLQGpSHQGDQFHGRQWMRXLWOHSUrWUH qui est ce que ne
GLWSDVODUWLFOH tenu par une obligation spciale tmoi-
gner respect et obisVDQFH >@ j VRQ RUGLQDLUH SURSUH
(canon 273) 33 ?

8QHMXULVSUXGHQFHFRQVWDQWHIRQGpHVXUOLQWHUSUpWDWLRQ
que donne le juge civil des rapports entre le religieux et son
VXSpULHXU FRQVLGqUH TXH OHXU OLHQ QHVW SDV XQ FRQWUDW GH
travail 34PrPHORUVTXXQUHOLJLHX[DUHoXGHVRQVXSpULHXU
la mission d'enseigner dans une cole 35.

/HVRUJDQHVGHOetat ont galement interprt les princi-


pes du droit matrimonial GH OeJOLVH TXDQW j OH[LVWHQFH
GXQH FpUpPRQLH GH PDULDJH DX SULQFLSH GLQGLVVROXELOLWp
et aux consquences de la dclaration de nullit.

32. Bruxelles 25 septembre 1998, arrt n JB40763.


33. La Cour de cassation franaise, dans un arrt du 6 juin 1958
avait galement considr qu'aucun lien de commettant prpos
n'existe entre l'archevque et l'ecclsiastique directeur d'un patronage,
dclar responsable de l'accident survenu un enfant lui confi dans
une colonie de vacances (Civ. 2me 06 juin 1958, Cons. Di Florio c. Mgr.
Delay, D. 1958, J., p. 695).
34. Chambry 15 janvier 1964, D. 1964, J., p. 605.
35. Soc. 13 mars 1964, Caisse prim. scur. soc. de Villefranche-sur-
Sane c. Demoiselle Jouve, D. 1964, J., p. 357. Cf. galement Ass. pln.,
17 dcembre 1965, Allain c. Caisse primaire de scurit sociale du Morbi-
han, D. 1966, J., p. 97 ; Soc. 15 mars 1966, Becquet c. Caisse primaire de
scurit sociale du Morbihan et autre, Bull. civ. 1966, IV n276, p. 239 ;
Soc. 12 mai 1966, Abb Chambon c. Caisse primaire de scurit sociale de
Montpellier, Bull. civ. 1966, IV n452, p. 379.
Le droit pnal sanctionne le fait pour un ministre du
FXOWH GDYRLU FpOpEUp XQ PDULDJH UHOLJLHX[ DQWpULHXUHPHQW
au mariage civil. Le Code pnal de 1810 punissait tout
PLQLVWUHGXQ FXOWHTXL SURFpGHUDDX[FpUpPRQLHV UHOLJLHX-
VHV GXQ PDULDJH VDQV TXLO OXL DLW pWp MXVWLILp GXQ DFWH GH
mariage pralablePHQW UHoX SDU OHV RIILFLHUV GH OpWDW
civil 36&HWWHUqJOHDYDLWSRXUILQDOLWpGDVVXUHUODSUppPL-
nence du mariage civil 37. Lors du dbat sur le nouveau
Code pnal, tandis que le projet gouvernemental ne pr-
YR\DLW SOXV OLQFULPLQDWLRQ GH OD FpOpEUDWLRQ GXQ PDULDJH
religieux antrieurement au mariage civil, les dputs ont
UpLQWURGXLW FHWWH LQIUDFWLRQ (W ODUWLFOH -21 du Code
pnal de 1992, entr en vigueur en 1994, dispose :
7RXW PLQLVWUH GXQ FXOWH TXL SURFpGHUD GH PDQLqUH
habituelle, aux crmonies religieuses de mariage sans que
QH OXL DLW pWp MXVWLILp ODFWH GH PDULDJH SUpDODEOHPHQW UHoX
SDUOHVRIILFLHUVGHOpWDWFLYLOVHUDSXQLGHVL[PRLVGHPpri-
sonQHPHQWHWGHIUDQFVGDPHQGH .
Afin de dterminer en pratique ce qui constitue une
crmonie religieuse du mariage au sens du Code pnal, il
faut se reporter au droit interne des collectivits religieuses,
HWGRQFVDJLVVDQWGHV FDWKROLTXHVDXGURLWFDQRQLTXH/H
professeur Revet note ainsi que OD UpIpUHQFH TXRSqUH

36. Article 199 du Code pnal de 1810.


37. /HEXWTXHVHSURSRVDLWOHOpJLVODWHXUpWDLWGDERUGGHEULVHU la
UpVLVWDQFHGHODWUDGLWLRQHWGHIDLUHSUpYDORLUGDQVOHVSULWGHODSRSXOD-
WLRQOLGpHQRXYHOOHTXHOHPDULDJHHVWXQHLQVWLWXWLRQODwTXHHWTXHVD
valeur lgale ne peut pas rsulter du seul sacrement religieux : il fallait
donc empcher que les ministres du culte fassent croire que la clbra-
tion religieuse pouvait suffire crer, entre les futurs poux, un lien
YDODEOH /HOpJLVODWHXUYRXODLWGDXWUHSDUWpYLWHUTXHWURPSpVVXUOD
porte du mariage religieux et maris seulement par le minisWUH GXQ
FXOWH XQ KRPPH HW XQH IHPPH QDLHQW SDV FUpp GXQLRQ OpJDOH HW VH
WURXYHQW QDYRLU TXH OH VWDWXW GH FRQFXELQV HW OHXUV HQIDQWV FHOXL GH
naturels non reconnus, avec toutes les consquences fcheuses qui en
dcouleraient pour les uns et pour les autres. Il fallait empcher que de
telles situaWLRQVDERXWLVVHQWjFRPSURPHWWUHOpWDWFLYLOGHVSHUVRQQHV
(Andr VITU, &pOpEUDWLRQ GXQ PDULDJH UHOLJLHX[ VDQV PDULDJH FLYLO
pralable : Article 433-21 , Jurisclasseur Pnal, 1995, n5, p. 2-3).
lDUWLFOH  GX &RGH SpQDO DX[ crmonies religieuses
GXQPDULDJH vaut renvoi pour leur caractrisation aux con-
fessions considres. Toute dfinition lgale tant exclue,
OH[DPHQGHVQRUPHVHFFOpVLDVWLTXHVVDYqUHLQGLVpensable. Le
juge conserve toutefois un ODUJH SRXYRLUGDSprciation per-
PHWWDQWGDERXWLUjXQHLQWHUSUpWDWLRQGHVULWHVUHOLJLHX[ 38.
,OHVWpYLGHQWTXHFHTXLHVWLQFULPLQpFHQHVWSDVOHPD-
ULDJHUHOLJLHX[HQWDQWTXHWHOPDLVODFpUpPRQLHTXLODFcom-
pagne : pour les catholiques, est donc vise la forme canoni-
que du mariage. Ce QHVWSDVOHSDFWHPDWULPRQLDOLQGLVsocia-
EOHGXVDFUHPHQWTXLHVWFRQGDPQp&HVWODFWHOLWXUgique.
Or, il est des situations dans lesquelles les catholiques peu-
vent contracter mariage indpendamment de toute crmonie
religieuse, soit que les conditions prvues par le canon 1116
du Code de 1983 soient runies, soit que les conjoints aient
obtenu une dispense de la forme canonique du mariage.
Le mariage clbr selon la forme extraordinaire du
mariage, dans le cadre du canon 1116 du Code 39 FHVW--
GLUHHQODEsence de ministre du culte, devrait chapper au
droit pnal.
Mais une trs curieuse affaire a entran la condamna-
tion du cur et du vicaire gnral du diocse qui avaient
organis une clbration selon la forme extraordinaire, en
prsence seulement de deux tmoins 40. En appel, le cur a

38. Thierry REVET, 'H ORUGUH GHVFpOpEUDWLRQV civile et religieuse


du mariage , J.C.P.G. 1987, I-3309, n25.
39. 1 S'il n'est pas possible d'avoir ou d'aller trouver sans grave
inconvnient un assistant comptent selon le droit, les personnes qui
veulent contracter un vrai mariage peuvent le contracter validement et
licitement devant les seuls tmoins :
1) en cas de danger de mort ;
2) en dehors du danger de mort, pourvu qu'avec prudence il soit
prvu que cette situation durera un mois.
2 Dans les deux cas, si un autre prtre ou diacre peut tre pr-
sent, il doit tre appel et tre prsent avec les tmoins la clbration
du mariage, restant sauve la validit du mariage devant les seuls
tmoins 39.
40. Tr. Pol. Dunkerque 9 mars 1972, note R. de LESTANG, J.C.P.G.
1972, II-17215.
t condamn, mais le vicaire gnral, qui tait complice et
non co-auteur, a t relax 41.
Le juge pnal franais a donc, implicitement, interprt le
droit canonique comme si le prtre avait clbr le mariage.
Or, le prtre qui permet et organise une crmoQLHQDVVLVWH
pas au mariage au regard du droit canonique.

/H SULQFLSHGLQGLVVROXELOLWpHWODSURKibition du rema-


ULDJHFLYLOGHVGLYRUFpVDpWpOREMHWGLQWHUSUpWDWLRQSOXVRX
moins correctes.

 /DSULVHHQFRPSWHGXSULQFLSHGLQGLVVROXELOLWpORUVGHODPLVHHQ
XYUHGHODUWLFOHGH&RGHFLYLOIUDQoDLV

La jurisprudence civile semble admettre qXH OH[LVWHQFH


GXQ HPSrFKHPHQW FDQRQLTXH SXLVVH GDQV FHUWDLQV FDV
rWUH XQH FDXVH GH QXOOLWp FLYLOH /DUWLFOH  DOLQpD  GX
Code civil prvoit que VLO\DHXHUUHXUdans la personne,
RX VXU XQH GHV TXDOLWpV HVVHQWLHOOHV GH OD SHUVRQQH ODXWUH
poux peut demander la nullit du mariage .
La jurisprudence admet que sur ce fondement puisse
rWUHGpFODUpHODQXOOLWpGXQPDULDJHFLYLOFRQFOXDORUVTXH
OXQH GHV GHX[ SDUWLHV LJQRUDLW TXH ODXWUH FRQMRLQW DYDLW
dj contract un mariage canonique et avait divorc post-
rieurement celui-ci 42.

41. Douai 24 janvier 1973, cit dans Louis de NAUROIS, Le


PDULDJHHQIRUPHFDQRQLTXHH[WUDRUGLQDLUHHWODQWpFpGHQFHGXPDULDJH
civil , RDC 1974, p. 39.
42. Civ. 1re 2 dcembre 1997 : Attendu que M. L. fait grief
l'arrt attaqu (Angers, 5 dcembre 1994) d'avoir prononc l'annulation
de son mariage avec Mme S., clbr le 18 aot 1973, sans rechercher si
l'erreur sur une qualit essentielle de la personne aurait t dtermi-
nante pour n'importe qui d'autre que Mme S. et non pas seulement par
l'effet d'une disposition d'esprit particulire celle-ci, de sorte que la
Cour d'appel n'aurait pas lgalement justifi sa dcision au regard de
l'article 180, alina 2, du Code civil ;
Mais attendu que la Cour d'appel a retenu, bon droit, que le fait
pour M. L. d'avoir cach son pouse qu'il avait contract un premier
La jurisprudence a donc implicitement analys le droit
canonique comme prohibant le remariage des divorcs. Et
elle en a tir quelques consquences.

 /HSULQFLSHGLQGLVVROXELOLWpHWODFODXVHGH[FHSWLRQQHOOHGXret de
ODUWLFOHGX&RGHFLYLO

6DJLVVDQWGXGLYRUFHSRXUUXSWXUHGHODYLHFRPPXQHOH
OpJLVODWHXU IUDQoDLV D DGPLV XQH VRUWH GREMHFWLRQ GH FRQV-
FLHQFH/DUWLFOHGX&RGHFLYLOGLVSRVH :
6L ODXWUH pSRX[ >OH GpIHQGHXU@ pWDEOLW TXH OH GLYRUFH
aurait, soit pour lui, compte tenu notamment de son ge et
de la dure du mariage, soit pour les enfants, des consquen-
FHV PDWpULHOOHV RX PRUDOHV GXQH H[FHSWLRQQHOOH GXUHWp OH
juge rejette la demande .
Ces consquences morales peuvent tre religieuses 43.
La Cour de cassation considre que les juges du fond sont
VRXYHUDLQV TXDQWjODSSUpFLDWLRQ GH OH[FHSWLRQQHOOHGXUHWp
DXVHQVGHODUWLFOHGX&RGHFLYLO 44. Mais la Cour de cas-
saWLRQSHXWH[DPLQHUOHPR\HQUHODWLIjODWWHLQWHSRUWpHSDU
le prRQRQFpGXGLYRUFHDX[FRQYLFWLRQVPRUDOHVGHOXQHGHV
deux parties quant au mariage 45.

mariage religieux et qu'il tait divorc, avait entran pour son conjoint
une erreur sur les qualits essentielles de la personne ; qu'elle a souve-
rainement estim que cette circonstance tait dterminante de son
consentement pour Mme S. qui, dsirant contracter un mariage reli-
gieux, entendait par l mme, pouser une personne non divorce ;
qu'elle a ainsi lgalement justifi sa dcision ;
Par ces motifs, et sans qu'il y ait lieu de statuer sur le pourvoi inci-
dent de Mme S. : Rejette le pourvoi (Civ. 1re , 2 dcembre 1997,
note Jacques MASSIP, L.P.A. du 18 dcembre 1998, CD-Rom Petites
Affiches).
43. /pOpPHQW UHOLJLHX[ SHXW rWUH LQYRTXp SRXU IDLUH REVtacle au
divorce depuis que la loi de 1975 a introduit la clause de duret dans le
divorce pour rupture de la vie commune (Nicole GUIMEZANES, Le
mariage religieux et son efficacit civile en France , Les Effets civils du
mariage religieux en Europe, Milan 1993, d. Giuffr, p. 161).
44. Cf. Civ. 2me 16 juillet 1979, Bull. II, n 218, p. 150 ; cf. gale-
ment Civ. 2me 5 mars 1997, note Jacques MASSIP, L.P.A. 24 dcembre
1997, p. 17.
45. Civ. 2me 23 octobre 1991, D. 1993, J., p. 193, 1re espce.
/DMXULVSUXGHQFHUHIXVHGHFRQVLGpUHUTXHODWWHLQWHDX[
convictions religieuses constitue en elle-mme une cons-
TXHQFH GXQH H[FHSWLRQQHOOH GXUHWp 46. Mais le juge peut
accepter de le prendre en considration dans certains cas, si
il y a des circonstances exceptionnelles 47 &HVW GDQV FH
cadre que le juge civil a interprt la situation des divorcs
GDQVOglise.
Certains arrts FRQVLGqUHQW TXH OpSRX[ FDWKROLTXH YLF-
WLPHGXQGLYRUFHVHWURXYHUDLWHQRSSRsition avec les prin-
FLSHVGHOeglise. Ainsi ODFRXUGDSSHOGH0RQWSHOOLHUGDQV
un arrt du 16 fvrier 1987, a considr que devait tre reje-
te la demande en divorce pour rupture de la vie commune
d'un mari ds lors que les circonstances particulires de la
cause confrent cette preuve un caractre d'exceptionnelle
duret, l'pouse, catchiste et membre d'un tiers ordre, tant
de par ses principes moraux et religieux farouchement oppo-
se au principe du divorce 48.
0DLVFHVWOjXQHDQDO\VHWURSUDSLGHGHVSULncipes eccl-
VLDX[ (Q HIIHW Oeglise ne condamne pas la personne vic-
WLPH GXQ GLYRUFHFLYLOVLFHOOH-ci ne se remarie pas. Et un
DUUrWGHODFRXUGDSSHOGH 3DULVGXRFWREUHODIRUW
bien soulign en prcisant que Oglise catholique elle-
mme considre le cas du conjoint contraint au divorce,
DORUV TXLO pWDLW FRQVFLHQW GH OLQdissolubilit du mariage
FRPPH un tmoignage de fidlit et de cohrence chr-
WLHQQH>@GXQHYDOHXUWRXWHSDUWiculire pour le monde et
SRXUOeJOLVH 49.

 /DSSUpKHQVLRQGXSULQFLSHGLQGLVVROXELOLWpGDQVOHFDGUHGXGURLW
du travail

La jurisprudence en matire de droit du travail est ame-


ne parfois interprter le droit canonique matrimonial.

46. Paris 1er juin 1979, J.C.P.G. 1981, II-19565, note Lindon.
47. Nicole GUIMEZANES, Le mariage religieux et son efficacit
civile en France , op. cit., p. 161.
48. Montpellier 16 fvrier 1987, T... c. Mme N..., D. 1988, J., p. 5.
49. Paris 23 octobre 1991, D. 1993, J., p. 193.
Elle admet ainVLTXHVRLWSRVVLEOHOHOLFHQFLHPHQWGXQH
enseignante dans un tablissement catholique, la suite de
VRQGLYRUFHVXLYLGXQUHPDULDJH
8Q DUUrW GH OD FRXU GDSSHO GH &KDPEpU\ GX  RFWREUH
FRQVWDWHTXXQHHQVHLJQDQWHGDQVpWDEOLVVHPHQWFDWKRli-
que se trouve, la suite de son divorce en contradiction
absolue ODIRLVDYHFODGRFWULQHGHOeJOLVHHWODPLVVLRQGpGX-
caWLRQ TXL OXL pWDLW FRQILpH GDQV OHVSULW GH OHQseignement
libre 50.
'H PrPH GDQV ODIIDLUH 'DPH 5R\ OD SUHPLqUH FRXU
GDppel constatait que ODGRFWULQHGHOeJOLVH>@SURIHVVH
OLQdissolubilit du mariage 51.

8QDUUrWGHODFRXUGDSSHOGH1RXPpDGXVHSWHPEUH
1987 croit pouvoir affirmer que le jugement annulant un
mariage religieux donne immdiatement aux anciens poux
le droit de reconvoler (canon 1684 1), droit qui ne peut se
concrtiser que par la clbration pralable du mariage civil,
OHTXHOQHSHXWLQWHUYHQLUTXDSUqVGLVVROXWLRQQRWDPment par
le divorce dHFHOXLTXLODSUpFpGpHWTXLOHVWjFHUWDins gards
paraGR[DO GH YRLU OeJOLVH UHIXVHU DLQVL TXHQ OHVSqFH OD
remise de preuves qui sont de nature permettre la dissolu-
WLRQ GXQ PDULDJH FLYLO FRQGLWLRQ GH OD PLVH HQ XYUH GX
droit de se remarier et de fonder une famille chrtienne 52.
2U LO IDXW UDSSHOHU TXH ODQWpULRULWp GX PDULDJH FLYLO
QHVW HQ DXFXQ FDV XQH H[LJHQFH FDQRQLTXH $X UHJDUG GX
GURLW FDQRQLTXH OH GURLW GH VH UHPDULHU j OD VXLWH GXQH
GpFODUDWLRQGHQXOOLWpQHVWSDVVXERrdonn la dissolution
du mariage au regard du droit civil.

50. Chambry 22 octobre 1970, D. 1971, J., p. 313-317, note Andr


DEMICHEL.
51. Aix 2 dcembre 1971, 'DPH5R\HW$VVRFLDWLRQSRXUOpGXFDWLRQ
Populaire Sainte-Marthe, J.C.P.G. 1972, II-17085, note N. S.
52. Nouma 28 septembre 1987, A. C. 1987, p. 307-318, note Oli-
vier CHAPP.
Les autorits sculires ont interprt les dispositions
relatives aux officialits et la procdure de rvocation et de
transfert des curs.

Les pouvoirs publics ont interprt des normes canoni-


ques relatives aux personnels et aux procdures matrimo-
niales des officialits.

1) La qualification juridique des personnels des officialits

Un parlementaire avait pos une question crite au


Garde des sceaux portant sur les titres que peuvent utiliser
les avocats devant les officialits. Le Garde des sceaux, afin
de rpondre la question, devait se prononcer sur la situa-
tion des avocats canoniques, et la qualifier au regard du
droit franais.
La solution retenue consiste assimiler les avocats eccl-
siastiques aux avocats trangers qui exercent en France une
DFWLYLWpDXWUHTXHFHOOHGDYRFDW 53. Or les avocats ecclsiasti-
ques exercent en France une activit qui est une activit
GDYRFDW $X UHJDUG GX GURLW FDQRQLTXH LO HVW LPSRVVLEOH
GLQWHUSUpWer diffremment leur fonction. Leur situation est
GRQFGLIIpUHQWHGHFHOOHGHVDYRFDWVpWUDQJHUVTXLQH[HUFHQW

53. Seuls les avocats inscrits un barreau franais voient en France


leur titre protg. Toutefois, les personnes inscrites un barreau tran-
JHU PDLV H[HUoDQW XQH DXWUH DFWLYLWp TXH FHOOH GDYRFDW HQ )UDQFH >@
peXYHQWIDLUHpWDWGH OHXU WLWUHGDYRFDWVLHOOHV SUHQQHQWWRXWH SUpFDX-
WLRQ SRXU TXDXFXQH FRQIXVLRQ QH VH FUpH DX[ \HX[ GX SXEOLF HQWUH
OHXUWLWUHHWODSURIHVVLRQGDYRFDWUpJLHSDUODORLGXGpFHPEUH
>@ /D VLWXDWLRQ WDQW HQ )UDQFH GH O,QWpULHXU TXH GDQV OHV WURLV
GpSDUWHPHQWVFRQFRUGDWDLUHVG$OVDFH-0RVHOOHGHODGYRFDWXVUpJLSDU
le Code de droit canonique ne semble pas, cet gard, diffrente de
FHOOH GH ODYRFDW pWDEOL HQ )UDQFH ,O VHQVXLW TXH VRXV UpVHUYH GH
ODSSUpFLDWLRQVRXYHUDLQHGHVMXULGLFWLRQVODGYRFDWXVSHXWXWLOLVHUOH
WLWUH GDYRFDW GqV ORUV TXH FH WLWUH HVW VXLYL GH TXDOLILFDWLIV SURSUHV j
pYLWHUOHUHSURFKHGXVXUSDWLRQGXQWLWUHSURWpJpSDUODORL , J.O. Q.E.
Snat, 4 aot 1988, p. 892-893.
SDV GDFWLYLWp GDYRFDW 0DLVRQQHSHXWTXHFRQVWDWHUTXLO
VDJLW GXQHLQWHUSUpWDWLRQerrone du droit canonique mais
que celle-ci est favorable aux avocats ecclsiastiques.
De mme, le defensor vinculis est assimil par la Cour euro-
SpHQQHGHVGURLWVGHOKRPPHjXQ Procureur Gnral 54 ;
ce qui est pour le moins contestable.

 /DSURFpGXUHPDWULPRQLDOHLQWHUSUpWpHSDUODFRXUGDSSHOGH
Nouma

8QDUUrWGHODFRXUGDSSHOGH1RXPpDGXVHSWHPEUH
1987 affirme le caractre public et contradictoire de la proc-
dure en dclaration de nullit devant les officialits 55. La
Cour en conclut que les actes de la procdure ne peuvent tre
considrs comme soumis au secret professionnel, rsultant
OpSRTXH GH ODUWLFOH  GX &RGH SpQDO DXMRXUGhui de
ODUWLFOH-13 du Nouveau Code pnal).
Or, ODQDO\VHTXHIDLWOa cour de la procdure canonique est
largement errone. Olivier Echapp remarque ainsi que GXQ
point de vue strictement canonique, il conYLHQW GREVHUYHU
que les rgles de publicit, entre les parties, de la procdure
>@ supportent des exceptions, qui peuvent en certaines cir-
constances tre assez notables. En effet si la notification du
libelle introductif dans le dcret de citation ne fait pas de

54. C.E.D.H. 20 juillet 2001, Pellegrini c. Italie, RDC 2001, p. 127-


161, n 23.
55. $WWHQGXTXDXGHPHXUDQWODSURFpGXUHGHYDQWOHMXJHFDQRQL-
TXHHVWFRQWUDGLFWRLUHHWTXHOHVSURFqVPDWULPRQLDX[QpFKDSSHQWSDV
cette rgle ils sont, aux termes des canons 1690 et 1691 soumis aux
QRUPHVJpQpUDOHVGHODSURFpGXUHVRXVUpVHUYHGHOH[FOXVLRQGXFRQWHQ-
tieux oral et du respect concernant le statut des personnes et le bien
public.
Attendu que cette procdure est marque par la notification du
libelle au dfendeur dans le dcret de citation (canons 1504 et 1505), la
publication des actes (canon 1598) sous rserve du pouvoir du juge
concernant le bien public pour un acte dtermin, le contenu de la
sentence (canon 1611) qui doit exposer les motifs tant de droit que de
fait sur lesquels reposent son dispositif et dont rien ne prescrit que la
publication ou la signification (canon 1615) puisse se faire par simple
extrait (Nouma 28 septembre 1987, A. C. 1987, p. 307-318, note
Olivier CHAPP).
SUREOqPH LO QHQ YD SDV WRXMRXUV GH PrPH SRXU FH TXL
concerne la publication des actes la fin de la priode pro-
batoire : en fait, surtout en matire matrimoniale, la publi-
cation de certains tmoignages, voire de certains passages de
UDSSRUWVGH[SHUWVSRXUUDLWHQWUDvner de srieux dommages.
>@ Le Code [en son canon 1598] permet dans toutes les
causes regardant le bien public et donc les causes matri-
moniales que le juge dcide, pour viter un danger carac-
WpULVpTXXQDFWHSDUWLFXOLHU RXSOXsieurs actes particuliers)
chappent la publication, pourvu que restent saufs les
droits de la dfense 56. Il ajoute TX XQHSDUWLHQDSDVXQ
droit absolu avoir en communication, au point de vue
canonique, toutes les pices de la procdure 57.

En Belgique, dans un arrt du 7 janvier 1993, la cour


GDSSHOGH0RQVVHVWUHFRQQXHFRPSpWHQWHSRXUFRQQDvWUH
du respect des drRLWVIRQGDPHQWDX[DXVHLQGHOeJOLVHFDWKR-
lique. cette occasion, elle a interprt les canons relatifs
la procdure de rvocation et de transfert des curs.
Par une lettrHGXQRYHPEUHOpYrTXHGH7RXUnai
UpYRTXDLWOH3qUH%/H3qUH%DVDLsi alors les juridictions
GHOeWDWEHOJH/DFRXUGDSSHOGH0RQVVHVWGpFODUpHFRP-
ptente pour connatre de cette rvocation, considrant que
la contestation concerne un droit de caractre civil.
/DFRXUGDSSHOGH0RQV QHVHVWSDVOLPLWpHjFRQtrler
OD FRPSpWHQFH GH OpYrTXH D\DQW SURQRQFp OD UpYRcation.
Elle a entendu galement vrifier que la procdure de rvo-
cation avait bien respect les droits de la dfense et le prin-
cipe du contradictoire, garantis par les principes gnraux
GX GURLW EHOJH HW ODUWLFOH  GH OD &RQYHQWLRQ HXURpenne
GHVGURLWVGHOKRPPH
Ainsi ODFRXUGDSSHOGH0RQVFRQVLGpUDLWTXH la rvo-
cation litigieuse est une mesure disciplinaire qui sanctionne

56. Olivier CHAPP, propos GXQ DUUrW UpFHQW GH OD &RXU
GDSSHOGH1RXPpDGXVHSWHPEUH , A. C. 1987, p. 309-310.
57. Ibid., p. 310.
FHUWDLQHVIDoRQGDJLU GH&&%GHVRUWHTXHOOHQH
pouYDLWrWUHSULVHTXDXWHUPHGXQHSURFpGXUHpTXLWDEOH .
2UWHOQDYDLWSDVpWpOHFDV/D&RXUconsidrait en effet
TX  LO QDSSDUDvW GDXFXQH SLqFH GX GRVVLHU TXH >Oe Pre
B...] ait pu faire entendre sa cause quitablement propos
des faits dont il est question dans la lettre du 17 novembre
1990 ; que conWUDLUHPHQW j FH TXH VRXWLHQW Opvque de
TourQDLOHSqUH%QHGLVSRVDLWGDXFXQUHFRXUVFRQWUHOD
dcision litigieuse, ni sur la base du canon 1718, ni sur celle
des canons 1732 1739 >@TXDXGHPHXUDQWjVXSSRVHU
PrPHTXXQUHFRXUVH[LVWDLWGDQVORUJDQLVDWLRQLQWHUQHGH
OeJOLVH IRUFH HVW GH FRQVWDWHU TXj GpIDXW GH WH[WH SUpFLV
qui en prvoyait les formes, ODOHWWUHGH%GXGpFHPEUH
1990, cite supra pouvait tre interprte comme la mani-
IHVWDWLRQGHVDYRORQWpGH[HUFHUXQUHFRXUV ; que pourtant,
DXFXQHVXLWHQDpWpGRQQpHjFHWWHOHWWUH TXLOVHGpGXLWGH
OHQVHPEOHGHVIDLWVGHODFDXVHTXHODGpFLVLRQGHOvque
de Tournai, consigne dans sa lettre du 17 novembre 1990
est une voie de fait dont il chet de faire cesser immdiate-
ment tous les effets 58.
La Cour de cassation a t saisie de cette affaire. Dans
son arrt du 20 octobre 1994, elle a FDVVpODUUrWGHODFRXU
GDSSHO GH 0RQV (OOH D FRQVLGpUp HQ HIIHW TXH compte
tenu du principe de non-LQJpUHQFHGHOeWDWGDQVORUganisa-
WLRQLQWHUQHGHVFXOWHVpQRQFpSDUODUWLFOHGHOD&RQVti-
tuWLRQODFRXUGDSSHOQDYDLWSDVGqVORUV le pouYRLUGDS-
prcier le caractre quitable de la procdure ayant abouti
la dcision GHOpYrTXH 590DLVODIIDLUHQHVHVWSDVDUUrWe
la dcision de la Cour de cassation. En effet, elle a t
UHQYR\pH GHYDQW OD FRXU GDSSHO GH /LqJH &HWWH GHrnire,
dans son arrt du 4 novembre 1997, a raffirm que lors-
TXLOV SURQRQFHQW OD UpYRFDWLRQ GXQ FXUp HQ WDQW TXH
PHVXUH GH VDQFWLRQ OHV pYrTXHV GRLYHQW PHWWUH HQ XYUH
une procdure respectant les droits de la dfense. La Cour
de cassation a t de nouveau saisie. Dans son arrt du 3
juin 1999, la Cour de cassation, sigeant en Chambres

58. Mons 7 janvier 1993, dcision n JB10169.


59. Cour de cassation 20 octobre 1994, note Franois RIGAUX,
R.C.J.B. 1996, p. 119-129.
runies, a raffirm les principes poss en 1994. La Cour a
FDVVp OD GpFLVLRQ GH OD FRXU GDSSHO HW renvoy ODIIDLUH
GHYDQWODFRXUGDSSHOGH%UX[HOOHV 60.
Bien quLO DLW pWp FDVVp ODUUrW GH OD FRXU GH 0RQV HVW
intressant. En effet, la Cour a interprt le Code de droit
FDQRQLTXHHWODOHFWXUHTXHOOHDIDLWGX&RGHODFRQGXLWHj
DIILUPHUTXDXFXQUHFRXUVQpWDLWSRVVLEOHFRQWUHODGpFLVLRQ
litigieuse.
Or, cela est faux. La dcision pouvait tre conteste
devant la Congrgation pour le clerg. Et la dcision de ce
dicastre pouvait ventuellement faire OREMHW GXQ UHFRXUV
devant la seconde section de la Signature Apostolique.

Les situations dans leVTXHOOHVOHVRUJDQHVGHOetat inter-


prtent le droit canonique sont donc nombreuses. Et cet
aperu est trop bref pour rendre compte rellement de la
pratique et de la porte des dcisions tatiques et inter-ta-
tiques. Il est toutefois possible de discerner quelques grands
traits.
Au 19e sicle, ODMXULVSUXGHQFHGX&RQVHLOGetat franais
en matire de recours pour abus, tait marque par les prin-
FLSHVJDOOLFDQV,OVDJLVVDLWGHVRXPHWWUH Oglise au droit de
OeJOLVHWHOTXHOeWDWOLQWHUSUpWDLW,Oen rsultait une contra-
diction entre OLQWHUSUpWDWLRQGRQQpHSDUOeglise et celle don-
ne SDUOetat. )LQDOHPHQWFHFRQIOLWGLQterprtation tait un
vrai conflit de normes, que chaque ordre juridique rsolvait
HQDIILUPDQWODSULPDXWpGHOLQterprtation de ses organes.
6XUFHSRLQWOpYROXWLRQ est notable. Le gallicanisme juri-
dique, dont lH &RQVHLO Getat tait le gardien, notamment
JUkFHDXUHFRXUVSRXUDEXVQDSDVVXUYpFXjODORLGH
Au contrairHODWWLWXGHGHVautorits sculires est marque
SDUOHUHVSHFWGHOeglise : on assimile les avocats ecclsiasti-
ques aux avocats trangers RQJDUDQWLWODIIHFWDWLRQGHVpGL-
fices du culte affects au culte catholique ; on reconnat
OLPSRUWDQFH GX SULQFLSH GLQGLVVROXELOLWp ; on admet la

60. Cour de cassation 3 juin 1999, n JC 99631.


spcificit du lien qui unit le prtre son vque et le reli-
JLHX[jVRQVXSpULHXU
Le second trait marquant de la pratique du 19e sicle tait
la remarquablHFRPSpWHQFHGHVMXULVWHVGHOetat, dignes suc-
cesseurs des lgistes de Philippe /H%HOORUVTXLOOHXUUHYHQDLW
GLQWHUSUpWHUOHGURLWFDQRQLTXH4XDQGXQHQRUPHGHGURLW
canonique tait interprte dans un sens contraire celui
GRQQpSDUOeJOLVHFpWDLWYRORQWDLUH : cela exprimait la politi-
TXHUHOLJLHXVHGHOeWDWGLULJpHFRQWUHOeglise.
/DVLWXDWLRQHVWDXMRXUGKXLELHQGLIIpUHQte. Est manifeste
OLJQRUDQFH GHV MXULVWHV GH Otat en matire canonique. Le
GURLW FDQRQLTXH HVW GpFRXYHUW j ORFFDVLRQ GH ODIIDLUH TXL
doit tre traite. Et leur raction est facile rsumer : on
prend le Code, on le feuillette, on regarde la table, on tire les
canons qui semblent pertinent. Au mieux, on consulte un
petit manuel. Et partir de ces modestes lments, on essaie
GHFRPSUHQGUHOHGURLWGHOJOLVHHWGHQWLUHUOHVFRQVpTXHQ-
ces quLVLPSRVHQWGDQVOHFDGUHGHVDPLVVLRQ
,O \ D FHUWHV GH QRWDEOHV H[FHSWLRQV 4XLO VDJLVVH GH OD
prise en compte de la communion hirarchique ou de la sp-
cificit du lien entre le religieux et son suprieur ou le prtre
et son vque, la jurisprudence ne saurait tre critique. Mais
sans doute en est-LODLQVLSDUFHTXLOVDJLWGHMXULVprudences
constantes, tablies depuis de nombreuses annes. Il suffit de
UHSURGXLUHOHVIRUPXOHVGHSULQFLSHVDQVWURSVDSSHVDQWLU
En gnral, lorsque le juriste de droit tatique est confront
DXGURLWGHOegliseLOVHIIRUFHGHIDLUHFHTXLOSHXWHQD\DQW
UHFRXUVDX[FRQFHSWVTXLODOKDELWXGHGHPDQLHU$LQVLVH[-
plique cette tendance la rduction du droit canonique aux
concepts et catgories du droit tatique.
Comment expliquer cette situation ? Sans doute faut-il
chercher la cause de cette difficult apprhender le systme
juridique canonique dans la scularisation de la socit, dont
la consquence est une ignorance gnralise en matire reli-
gieuse.

Emmanuel TAWIL,
Facult de droit,
Universit Panthon-Assas Paris II
E
N DROIT CANONIQUE, le mariage et la vie consa-
cre par la profession des conseils vangliques
sont deux tats incompatibles et mutuellement
exclusifs ; puisque le conseil vanglique de chastet com-
SUHQG DYHF OREOLJDWLRQ GH OD FRQWLQHQFH SDUIDLWH FHOOH GX
clibat (c. 599), est admis invalidement au noviciat dans un
institut religieux (c. 643 1, 2) ou la probation initiale
dans un institut sculier (c. 721 1, 3) le conjoint tant que
dure son mariage.
Pour la mme raison, attentent invalidement mariage
OHVSHUVRQQHVTXLVRQWOLpHVSDUOHYXSXEOLFSHUSpWXHOGH
chastet dans un institut religieux (c. 1088) 1, ce que dit
aussi le Code des canons des glises orientales (c. 805) 2.
&HVW FH TXL HQ GURLW PDWULmoQLDO HVW DSSHOp OHPpche-
PHQWGHYXDans le Code de 1917, la profession religieuse
solenQHOOH FHVW--dire perptuelle dans un ordre religieux,
GDXPRLQVXQGHVpSRX[HQtranait aussi ODGLVVROXWLRQGXQ
mariage non consomm : Le mariage non consomm entre
baptiss, ou entre une partie baptise et une partie non bap-
tise, est dissous  de plein droit par la profession reli-
gieuse solennelle (c. 1119) 3 ; cette disposition, en quel-

1. Invalide matrimonium attentant, qui voto publico perpetuo


castitatis in instituto religioso adstricti sunt .
2. Invalide matrimonium attentat, qui votum publicum perpe-
tuum castitatis in instituto religioso emisit .
3. Matrimonium non consummatum inter baptizatos vel inter par-
tem baptizatam et partem non baptizatam, dissolvitur tum ipso iure per
que sorte coUROODLUHGHOHPSrFKHPHQWGHYXQHILJXUHSDV
dans le Code de 1983.
2Q VH OLPLWHUD LFL j OpWXGH GH OHPpchePHQW GH YX
WHO TXLO HVW GpILQL SDU ODFWXHO FDQRQ ODWLQ 8QH SUHPLqUH
partie envisagera la question du point de vue historique et
dcrira brivement la formation de la rgle de droit, tant
sur le plan du canon lui-PrPH TXH VXU OH SODQ GHV YX[
reliJLHX[8QHVHFRQGHSDUWLHVLQWpUHVVHUDjODFRQVWLWXWLRQ
GHOHPSrFKHPHQWHQVRLjVDYRLUVDQDWXUHVRQIDLWJpQp-
rateur, et le droit qui le fonde 4.

/eJOLVH D IRUPXOp SURJUHVVLYHPHQW OHPSrFKHPHQW GH


YX UHOLJLHX[ WHO TXLO ILJXUH DXMRXUGKXL GDQV VRQ GURLW
$YDQW OHQWUpH HQ YLJXHXU GX &RGH DFWXHO GHX[ pWDSHV RQW
marqu cette volution : le deuxime concile de Latran,
FRPSWHU GXTXHO OH YX D LQYDOLGp OH PDULDJH   HW OD SUR-
mulgation du Code pio-bndictin, qui consacre la distinc-
WLRQHQWUHLQVWLWXWVjYX[VLPSOHVHWLQVtiWXWVjYX[VROHQ-
nels (2). Pour tre complet, il faut aussi voquer le processus
GHIL[DWLRQGHOREMHWPrPHGHVYX[UHOLJLHX[  

qui connat les circonstances de la formation du Dcret


de Gratien 5LOHVWSRVVLEOHGHSUpFLVHUjTXHOOHGDWHOHPp-
chePHQW GH YX UHOLJLHX[ D SULV SRXU HPployer le vocabu-
laire moderne, un caractre dirimant. Avant le deuxime

sollemnem professionem religiosam, tum per dispensationem a Sede


Apostolica ex iusta causa concessam, utraque parte rogante vel alterutra,
etsi altera sit invita .
4. Voir Priamo ETZI, /LPSHGLPHQWRGLYRWR FDQ&-& : sua
origine e qualificazione giuridica , Ius Ecclesiae, 11, 1999, n 1, p. 193-
222 ; Janusz KOWAL, Impedimentum votiHGLPLVVLRQHGDOOIstituto
religioso , Periodica, 88, 1999, p. 29-60 ; Piero PELLEGRINO, /LPSHGL-
mento del voto pubblico perpetuo di castit in un instituto religioso nel
nuovo diritto matrimoniale canonico (can. 1088 CIC ; can. 805
CCEO) , Ius Canonicum, 40, 2000, n 79, p. 73-98.
5. Anders WINROTH, 7KH 0DNLQJ RI *UDWLDQV 'HFUHWXP, Cam-
bridge, Cambridge University Press, 2000, passim.
concile de Latran (1139), dont les canons atteiJQHQWODXWHXU
du Dcret alors que ce dernier est dj pratiquement achev,
VHORQ OD SRVLWLRQ WUDGLWLRQQHOOH GH OeJOLVH OH PDULDJH des
voventes est illicite mais il est cependant un vrai mariage 6
(C. 27 q. 1 c. 43, dictum post), sans prjudice des pnitences
imposes (C. 27 q. 1 c. 9).
Le deuxime concile de Latran (canons 7 et 8) dclare
invalide ( matrimonium non esse ) le mariage des clercs
majeurs (vques, prtres, diacres et sous-diacres) et de ceux
(chanoines rguliers, moines, convers et moniales) qui ont
fait profession : 3RXUTXHODORLGHODFRQWLQHQFHHWGH
OD SXUHWp TXL SODvW j 'LHX VpWHQGH SDUPL OHV SHUVRQQHV
ecclsiastiques et ceux qui ont reu les ordres sacrs, nous
ordonnons que les vques, les prtres, les diacres, les sous-
diacres, les chanoines rguliers et les moines, ainsi que les
convers ayant fait profession, qui auraient os, transgressant
leur sainWSURSRVVXQLUjXQHpSRXVHHQVRLHQWVpSDUpV(Q
HIIHWQRXVHVWLPRQVTXXQHXQLRQGHFHWWHVRUWHGRQWLOHVW
pWDEOLTXHOOHDpWpFRQWUDFWpHFRQWUHODUqJOHHFFOpVLDVWLTXH
QHVW SDV XQ PDULDJH &HX[ TXL VH VRQW VpSDUpV OXQ GH
ODXWUHIHURQWSpQLWHQce en rapport avec de si grands abus.
Nous dcidons que les mmes dispositions soient observes
SRXU OHV PRQLDOHV VL FH TXj 'LHX QH SODLVH HOOHV DYDLHQW
tent de se marier 7.

6. Dit autrement, le mariage des voventes est illicite mais valide. Voir
Jean WERCKMEISTER, Le trait du mariage de Gratien, thse pour le
GRFWRUDWGeWDWHQWKpRORJLHFDWKROLTXH6WUDVERXUJ
7. G. ALBERIGO (dir.), LHV &RQFLOHV FXPpQLTXHV  /HV 'pFUHWV, texte
original tabli par G. ALBERIGO, J. A. DOSSETTI, P.-P. JOANNOU, C. LEO-
NARDI et P. PRODI avec la collaboration de H. JEDIN, dition franaise
sous la direction de A. DUVAL, B. LAURET, H. LEGRAND, J. MOINGT et
B. SESBO, Paris, Les ditions du Cerf, 1994 (/H0DJLVWqUHGHOeJOLVH 
p. 434 : 8WDXWHPOH[FRQWLQHQWLDHHW'HRSODcens munditia in eccle-
siasticis personis et sacris ordinibus dilatetur, statuimus, quatenus episcopi
presbyteri diaconi subdiaconi regulares canonici et monachi atque conversi
professi, qui sanctum transgredientes propositum uxores sibi copulare
praesumpserint, separentur. Huiusmodi namque copulationem, quam
contra ecclesiasticam regulam constat esse contractam, matrimonium non
esse censemus. Qui etiam ab invicem separati, pro tantis excessibus condi-
gnam poenitentiam agant. Id ipsum quoque de sanctimonialibus feminis,
si, quod absit, nubere attentaverint, observari decernimus . Ces deux
canons sont incorpors au Dcret (C. 27 q. 1 c. 40).
Pour accorder ces canons discordants , est alors intro-
duite la distinctLRQ HQWUH YX VROHQQHO GLULPDQW OH PD-
ULDJH HWYXVLPSOH VLPSOHPHQWSURKLEDQW HWRQIDLWGH
la profession ( professio facta alicui de religionibus ), plu-
W{W TXH GX YX 8 OHPpchement dirimant. Il convient ici
GH QRWHU TXHQ IDLVDQW GpULYHU OHPSrFKHPHQW QRQ GX YX
lui-PrPHPDLVGHOpWDWUHOLJLHX[RQOHIDLVDLWSDVVHUGDQVOH
domaine du droit ecclsiastique 9&HVWFHTXRQWURXYHXOWp-
rieurement dans la seconde partie du Corpus Iuris canonici :
/H YX VROHQQHO HPSrFKH HW GLULPH OH PDULage contract
ensuite OHYXVLPSOHHPSrFKHVHXOHPHQWGHFRQWUDFWHUPDLV
ne dirime pas ce qui a t contract ensuite (X, IV, 6, c. 3) 10 ;
/HYXVROHQQLVpSDUODUpFHSWLRQGHORUGUHVDFUpRXSDU
la profession faite dans une des religions approuves par le
Sige Apostolique dirime le mariage contract ensuite ; autre-
PHQWLOOHPSrFKHVHXOHPHQWHWQHOHGLULPHSDV 9,3, 15,
c. un.) 11.
Dans la Somme de Thologie, sDLQW7KRPDVG$TXLQ ou, plu-
tt, son continuateur 12, a tent une synthse ; pour lui, il
H[LVWHXQHGLIIpUHQFHHVVHQWLHOOHHQWUHOHYXVLPSOHHWOHYX
solennel, consistant en ce que le premier est une promesse et
le second, une donation :
/H YX VLPSOH QpWDQW TXH OD VLPSOH SURPHVVH faite
'LHX GH JDUGHU OD FRQWLQHQFH OKRPPH TXL OD SURQRQFp
reste matre de son corps dont il peut disposer en faveur de

8. IO IDXW VH UDSSHOHU TXj FHWWH pSRTXH OD SURIHVVLRQ UHOLJLHXVH  pWDLW
insSDUDEOHGXYXVROHQQHO
9. Andr BRIDE, Empchements de mariage , Raoul NAZ (dir.),
Dictionnaire de droit canonique, Paris, Librairie Letouzey et An, tome
cinquime, 1953, col. 273.
10. Votum solenne impedit et dirimit matrimonium post contrac-
tum ; votum simplex tantum impedit contrahendum, sed non dirimit
post contractum .
11. Votum, solennisatum per susceptionem sacri ordinis vel per
professionem factam alicui de religionibus per sedem apostolicam
approbatis, dirimit matrimonium post contractum ; alias solum impe-
dit, et non dirimit .
126DLQW7KRPDVG$TXLQQDMDPDLVWHUPLQpVD Somme de Tholo-
gie. Le Supplment QHVWSDVGLUHFWHPHQWGHOXLPDLVUpVXOWHGXQHFRP-
pilation effectue aprs sa mort par frre Rginald de Piperno, partir
GXYUHVGHMHXQHVVH,FL Super Sent. lib. 4 dist. 38, q. 1, art. 3, qa 2 co.
( &XPHUJRLQYRWRVLPSOLFL ) et qa 3 co. ( (WLGHRGLFHQGXP ).
son pouse par un don, HW FHVW HQ FH GRQ TXH consiste le
mariage (Suppl. q. 53 art. 1) 13 ;
/HYXVROHQQHOSULYHFHOXLTXLODSURQRQFpde la disposi-
tion de son corps dont LODIDLWGRQj'LHXHQVHQJDJHDQWjOD
continence perptuelle ; il ne peut donc plus le donner une
pouse en contractant mariage avec elle ; et puisque le mariage
TXLVXLWOHYXVROHQQHOHVWQXORQGLWTXHOHYXVROHQQHO
dirime le mariage dj contract (Suppl. q. 53 art. 2) 14.
Le concile de Trente, dans ses canons sur le mariage (24e
session, 11 novembre 1563, c. 9), entrinera cette position :
6L TXHOTXXQ GLW TXH OHV FOHUFV FRQVWLWXpV GDQV OHV RUGUHV
sacrs ou les rguliers, qui ont fait profession solennelle de
FKDVWHWp SHXYHQW FRQWUDFWHU PDULDJH YDOLGH VLOV OH FRQ-
WUDFWHPDOJUpODORLHFFOpVLDVWLTXHRXOHYX TXLOVRLW
anathme 15.

Par la constitution apostolique Conditae a Christo du 8


dcembre 1900, Lon XIII a tendu le statut canonique des
religieux aux membres des nombreux instituts (congrga-
WLRQV  j YX[ VLPSOHV TXL VpWDLHQW PXOWLSOLpV DX FRXUV GX
19e sicle. La codification pio-bndictine prend en compte

13. Cum ergo in voto simplici non sit nisi simplex promissio pro-
prii corporis ad continentiam Deo servandam facta : post votum sim-
plex adhuc remanet homo dominus sui corporis. Et ideo potest ipsum
alteri dare, scilicet uxori : in qua datione sacramentum matrimonii con-
sistit, quod indissolubile est .
14. Et ideo dicendum est, cum aliis, quod votum solemne ex sui
natura habet quod dirimat matrimonium contractum : inquantum
scilicet per ipsum homo sui corporis amisit potestatem, Deo illud ad
perpetuam continentiam tradens, ut ex dictis (4 Sent., dist. 38, q. 1, art.
2, qa 3) patet. Et ideo non potest ipsum tradere in potestatem uxoris,
matrimonium contrahendo. Et quia matrimonium quod sequitur tale
votum, nullum est : ideo tale votum dirimere dicitur matrimonium
contractum .
15. G. ALBERIGO (dir.), LHV&RQFLOHVFXPpQLTXHV/HV'pFUHWV, op.
cit., p. 1534 : Si quis dixerit, clericos in sacris ordinibus constitutos,
vel regulares, castitatem solemniter professos, posse matrimonium
contrahere, contractumque validum esse, non obstante lege ecclesiastica
YHOYRWR : a. s. .
la nouvelle lgislation pour fixer la discipline en matire
GHPpchement de mariage.
/H&RGHGHDSSHOOHVROHQQHOVOHVYX[pPLVGDQVXQ
ordre religieux et simples ceux prononcs dans une congrga-
tion : Dans les canons suivants, on entend sous le nom de :
  Ordre la religion dans laquelle on met des YX[
solennels ; Congrgation religieuse ou simplement Congr-
gation, la religion dans laquelle ne sont mis que des YX[
VLPSOHVTXLOVVRLHQWSHUSpWXHOVRXWHPSRUDLUHV (c. 488) 16.
/HVDFWHVFRQWUDLUHVjXQYXVLPSOH taient illicites tan-
GLVTXHOHVDFWHVFRQWUDLUHVjXQYXVROHQQHOpWDLHQWinva-
lides (c. 579) &HVW SRXUTXRL VHXO GLULPDLW OH PDULDJH OH
YXVROHQQHORXOHYXVLPSOHTXLHQYHUWXGXQHGLVSRVL-
WLRQGX6LqJH$SRVWROLTXHDYDLWOHIIHWGXYXVROHQQel (c.
1073), ce dernier cas concernant un privilge concd par
Grgoire XIII aux scolastiques et coadjuteurs de la Compa-
gnie de Jsus 17 /H YX VLPSOH WHPSRUDLUH RX SHUptuel)
QH FRQVWLWXDLW TXXQ HPSrFKHPHQW SURKLEDQW TXL UHQGDLW
le mariage illicite mais non invalide (c. 1058 2) 18.
Si le Code de 1983 distingue entre OH YX VROHQQHO
UHFRQQXFRPPHWHOSDUOeJOLVHHWOHYXVLPSOH (c. 1192) 19,
il ne prcise pas en quoi consiste la diffrence, sinon que
celle-ci est fonde sur le critre de la reconnaissance par
OeJOLVH 4XL SOXV HVW OD GLVWLQFWLRQ HQWUH YX VLPple et
YXVROHQQHOQDSOXVGHIIHWMXULGLTXHHQVRLGDQVODOpJLs-
lation universelle. Toutes les familles religieuses sont main-
tenant appeles, en droit, instituts religieux, ce qui met un
terme la discrimination sculaire entre ordres et con-

16. In canonibus qui sequuntur, veniunt nomine   Ordinis,


religio in qua vota sollemnia nuncupantur   Congregationis religiosae
vel Congregationis simpliciter, religio in qua vota dumtaxat simplicia sive
perpetua sive temporaria emittuntur .
17. Constitution Ascendente Domino du 25 mai 1584 (Codicis Iuris
Canonici Fontes Q   ,O FRQYLHQW WRXWHIRLV GH QRWHU TXH OHV YX[
simSOHVGHV-pVXLWHVQDYDLHQWSDVWRXVOHVHIIHWVGHVYX[VROHQQHOV ; en
particulier, ils ne dissolvaient pas le mariage non consomm, et la dis-
pense pouvait en tre accorde par le Prpos Gnral.
18. Nullum votum simplex irritat matrimonium, nisi irritatio spe-
ciali Sedis Apostolicae praescripto pro aliquibus statuta fuerit .
19. Votum est Sollemne, si ab Ecclesia uti tale fuerit agnitum ;
secus simplex .
grgations,20 HW WRXW YX SHUSpWXHO GH FKDVWHWp pPLV GDQV
un institut religieux dirime le mariage.

'DQVODOpJLVODWLRQFDQRQLTXHOHVYX[UHOLgieux portent
sur les trois conseils vangliques de chastet, de pauvret et
GREpLVVDQFH F 2, c. 598 1). Mais tous les religieux
QHSURQRQFHQWSDVIRUPHOOHPHQWOHYXGHFKDVWHWp
En effet, la triade chastet, pauvret, obissance, apparat
seulement la fin du 12e sicle, dans la Rgle des Trinitai-
res (1198) 21 : Fratres Domus Sanctae Trinitatis sub oboe-
dientia Prelati Domus suae (qui Minister vocabitur) in casti-
tate et sine proprio vivant . La Rgle de saint Augustin (vers
397) ne parOHSDVGHYX[HWVDLQW%HQRvW YHUV GDQV
OHFKDSLWUHTXLOFRQVDFUHjODPDQLqUHGHUHFHYRLUOHVIUqUHV
( De disciplina suscipiendorum fratrum ) prescrit : Celui
TXL GRLW rWUH UHoX SURPHWWUD j ORUDWRLUH GHYDQW WRXV OD
stabilit, la conversion GHVPXUVHWOREpLVVDQFH (Rgle 58,
17) 22 LOHVWWRXWHIRLVHQWHQGXTXHOHYXGHFRQversion des
PXUVFRPSUHQGODSDXYUHWpHWODFKDVWHWp
Plus tard, OD SUHPLqUH 5qJOH GH VDLQW )UDQoRLV G$VVLVH
dite de 1221 (ou Regula non bullata), exprime ainsi le projet
des frres mineurs : YLYUH GDQV OREpLVVDQFH GDQV OD FKDV-
WHWp HW VDQV ULHQ HQ SURSUH HW VXLYUH OHQVHLJQHPHQW HW OHV
traces de notre Seigneur Jsus Christ ; ce que rptera la
deuxime Rgle, dite de 1223 : observer le saint vangile

20. Michel DORTEL-CLAUDOT, Les nouvelles dispositions du Code


concernant la vie religieuse. Premier inventaire , Vie consacre, 1983,
n 3/4, p. 187.
21. Giancarlo ROCCA, La triade di obbedienza, povert e castit ,
GDQV Oarticle Professione , Guerrino PELLICIA, Giancarlo ROCCA
(dir.), Dizionario degli istituti di perfezione, Roma, Edizioni Paoline, tome
VII, 1983, col. 940 ; Mariano Jos SEDANO SIERRA, I tre voti , in
article Voti religiosi , Carlos APARICIO RODRGUEZ, Joan Mara
CANALS CASAS (dir.), Dizionario Teologico Della Vita Consacrata , Edi-
zione italiana a cura di Tullo GOFFI e Achille PALAZZINI, Milano, Edi-
trice ncora Milano, 1994, p. 1932.
22. Rgle de saint Benot, texte latin, traduction et concordance par
Philibert SCHMITZ, introduction par Andr BORIAS, Turnhout, Brepols, 5e
dition, 1987 : Suscipiendus autem in oratorio coram omnibus promittat
de stabilitate sua et conversatione morum suorum et oboedientiam .
de QRWUH6HLJQHXU-pVXV&KULVWHQYLYDQWGDQVOREpissance,
sans rien en propre et dans la chastet 23.
La Rgle primitive GH O2UGUH GH OD %LHQKHXUHXVH
Vierge Marie du Mont-Carmel, dit, propos du pULHXUTXLO
faut avoir et des trois choVHVTXLOfaut lui promettre : Nous
ordonnons en premier lieu que vouV D\H] OXQ GHQWUH YRXV
comme prieur, qui sera lu cette charge du consentement
unanime de tous ou la majorit des plus dignes, qui cha-
FXQGHVDXWUHVSURPHWWUDOREpLVVDQFHHWDSUqVODYRLUSURPLVH
VDSSOLTXHUD j OD JDUGHU HQ YpULWp SDU VHV DFWHV DLQVL TXH OD
chastet et le renoncement la proprit 24. Mais il est tabli
TXHODGMRQFWLRQGHVYX[GH FKDVWHWpHWGH SDXYUHWp HVWXQ
changement apport au texte originel lors de sa rvision en
1247 25.
Et les Dominicains, selon la formule traditionnelle qui
QD TXH SHX YDULp MXVTXDXMRXUGKXL, se limitent la seule
proIHVVLRQ GREpLVsance : Moi, N., je fais profession et
promets obissance Dieu, la bienheureuse Vierge Marie

23. FRANOIS D$SSISE, crits, texte latin de l'dition de K. Esser,


introduction, traduction, notes et index par Thophile Desbonnets, Jean-
Franois Goddet, Thadde Matura, Damien Vorreux, frres mineurs,
Paris, Les ditions du Cerf, 1981 (Sources Chrtiennes, 285), p. 122 :
Caput I. Quod fratres debent vivere sine proprio et in castitate et obe-
dientia. [1] Regula et vita istorum fratrum haec est, scilicet vivere in obe-
dientia, in castitate et sine proprio, et Domini nostri Jesu Christi doctri-
nam et vestigia sequi ; p. 180 : Caput I. In nomine Domini ! Incipit
vita Minorum Fratrum : [1] Regula et vita Minorum Fratrum haec est,
scilicet Domini nostri Jesu Christi sanctum evangelium observare vivendo
in obedientia, sine proprio et in castitate .
24. /D5qJOHGHO2UGUHGHOD%LHQKHXUHXVH9LHUJH0DULHGX0RQW&DU-
mel. Pour le 4e centenaire de la mort de sainte Thrse, Paris, Descle De
Brouwer, 1982, chapitre 1 : De Priore habendo et tribus sibi promit-
tendis. Illud in primis statuimus, ut unum ex vobis habeatis Priorem,
qui ex unanimi omnium assensu, vel maioris et sanioris partis, ad hoc
officium eligatur, cui obedientiam promittat quilibet aliorum, et pro-
PLVVDP VWXGHDW RSHULV YHULWDWH servare, cum castitate et abdicatione
proprietatis  /H[SUHVVLRQ Rgle primitive remonte la rforme
thrsienne qui appelait reprendre la Rgle QRQ WHOOH TXHOOH pWDLW j
ORULJLQH YHUV  le texte en a t perdu PDLVWHOOHTXHOOHDYDLt
t approuve, lgrement remanie, par Innocent IV en 1247.
25. Martin BATTMANN, /D5qJOHGHO2UGUHGHOD%LHQKHXUHXVH9LHUJH
Marie du Mont Carmel. Pour le 4e centenaire de la mort de sainte Thrse,
op. cit. , p. 91.
et toi, N.PDvWUHGHORUGUHGHV3UrFKHXUVHWjWHVVXFFHV-
seurs, selon la rgle de saint Augustin et les institutions des
IUqUHVGHORUGUHGHV3UrFKHXUVDXVVLVHUDL-je obissant toi
HWjWHVVXFFHVVHXUVMXVTXjODPRUW26.
Dans la Somme de Thologie (IIa IIae q. 186), saint Tho-
PDV G$TXLQ DGRSWH OD SURIHVVLRQ GH OD WULDGH SDU OpPLV-
VLRQGHYX[FRPPHODIRUPXOHODSOXVYDOLGHSRXUUDVsem-
bler les valeurs essentielles de la vie religieuse, lui confrant
la marque de la stabilit. Il rpond par lDIILUmative quatre
questions :
Art. 3 La pauvret est-elle requise pour la perfection de
OpWDWUHOLJLHX[ ? ;
Art. 4 La continence perptuelle est-elle requise pour la
SHUIHFWLRQGHOpWDWUHOLJLHX[ ? ;
Art. 5 LREpLVVDQFH DSSDUWLHQW-elle la perfection de
OpWDWUHOLJLHX[ ? ;
Art. 6 Est-il requis SRXUODSHUIHFWLRQGHOpWDWUHOLJLHX[
TXH OD SDXYUHWp OD FRQWLQHQFH HW OREpLVVDQFH VRLHQW VDQF-
tionQpHVSDUOHYX ? 27.
Cependant, il remarque : OHYX Gobissance con-
tient les DXWUHV YX[ WDQGLV TXH OD UpFLSURTXH Q
HVW SDV
YUDLH (Q HIIHW TXRLTXH OH UHOLJLHX[ VRLW WHQX SDU XQ YX
spcial, de pratiquer la conWLQHQFHHWODSDXYUHWpHOOHVQen
WRPEHQW SDV PRLQV VRXV OH YX Gobissance (IIa IIae

26. Constitutiones antique Ordinis Fratrum Predicatorum, 16, in


Antoninus Henricus THOMAS, De oudste Constituties van de Domini-
canen (1215-1237), Leuven, Bureel van de RHE, Leuvense Universi-
WDLUH 8LWJDYHQ  %LEOLRWKqTXH GH OD 5HYXH G+LVWRLUH (FFOpVLDVWL-
que, 42), p. 326-327 ; Raymond CREYTENS, Les Constitutions des
Frres Prcheurs dans la rdaction de s. Raymond de Peafort (1241) ,
Archivum Fratrum Praedicatorum XVIII, 1948, p. 41 : Ego N. facio pro-
fessionem et promitto obedientiam Deo et beate Marie et tibi N.,
magistro ordinis Predicatorum, et successoribus tuis, secundum regu-
lam beati Augustini et institutiones fratrum ordinis Predicatorum,
quod ero obediens tibi tuisque successoribus usque ad mortem .
27. Art. 3 Utrum paupertas requiratur ad perfectionem religionis ;
Art. 4 Utrum perpetua continentia requiratur ad perfectionem religio-
nis ;
Art. 5 Utrum obedientia pertineat ad perfectionem religionis ;
Art. 6 Utrum requiratur ad perfectionem religionis quod praedicta
tria, scilicet paupertas, continentia et obedientia cadant sub voto .
q. 186 art. 8) 28. Ce qui, en passant, justifie la formule de
profession en usage dans son ordre.

Aprs avoir, dans une premire partie, tudi la formation


de la rgle de droit, il convient de cerner les lments constitu-
WLIVGHOHPSrFKHPHQWGHYX&HOXL-FLH[LVWHHQYHUWXGXQH
ORLLQKDELOLWDQWHFHTXLQHVWSDVLQGLIIpUHQWTXDQWjVHVFRQ-
GLWLRQV GDSSOLFDWLRQ  ; il trouve son fait gnrateur dans
toute profession religieuse perptuelle valide (2) ; les modalits
de sa dispense dfinissent le droit qui le fonde (3).

Selon le c. 1058, peuvent contracter mariage tous ceux


TXL QHQ VRQW SDV HPSrFKpV SDU OH GURLW 29. Le c. 1073 pr-
cise que lHPSrFKHPHQW GLULPDQW UHQG OD SHUVRQQH LQFDSD-
ble de contracter validement mariage 30. /HPpchement, ici
pris en gnral (mais cela vaut naturelOHPHQWSRXUOHPpche-
PHQWGHYXHQSDUWLFXOLHU HVWGpILQLFRPme une loi inhabi-
litante, spcifiant expressment TXXQHpersonne est inhabile
(c. 10). Celle-ci, eQYHUWXGXFHVWGLQWHUSUpWDWLRQVWULFWH :
Les lois qui tablissent une peine ou qui restreignent le libre
exercice des droits ou qui comportent une exception la loi
VRQWGLQWHUSUpWDWLRQVWULFWH 31.
3XLVTXH OLQWHUSUpWDWLRQ H[WHQVLYH GHV ORLV Tui restrei-
gnent le libre exercice des droits est interdite et que les lois
QH FRQFHUQHQW TXH ODYHQLU j PRLQV TXHOOHV QH GLVSRVHQW
nommment pour le pass (c.  OHPSrFKHPHQWGHYXQH
WRXFKH SDV OHV UHOLJLHX[ TXL DYDQW OHQWUpH HQ YLJXHXU GX

28. YRWXPREHGLHQWLDHFRQWLQHWVXEVHDOLDYRWDVHGQRQFRQ-
vertitur. Nam religiosus, etsi teneatur ex voto continentiam servare et
paupertatem, tamen haec etiam sub obedientia cadunt .
29. Omnes possunt matrimonium contrahere, qui iure non prohi-
bentur .
30. Impedimentum dirimens personam inhabilem reddit ad matri-
monium valide contrahendum .
31. Leges quae poenam statuunt aut liberum iurium exercitium
coarctant aut exceptionem a lege continent, strictae subsunt interpreta-
tioni .
nouveau droit (1983), ont proQRQFpGHVYX[VLPSOHVSHU-
ptuels 32.
'DXWUHSDUWLOIDXWQRWHUTXHOHGURLWDFWXHODVXSSULPpOD
catgorie des empchements prohibants 33 (affectant la licit
mais non la validit) ; moyennant quoi le qualificatif de diri-
mant  QHVW SOXV VWULFWHPHQW QpFHVVDLUH : tout empchement
matriPRQLDO DIIHFWH DXMRXUGKXL OD YDOLGLWp GX PDriage.
/DQFLHQHPSrFKHPHQWGHYXVLPSOHQDSOXVOLHXGrWUH

Le c. 1088 dispose : Attentent invalidement mariage les


SHUVRQQHV TXL VRQW OLpHV SDU OH YX SXEOLF SHUSpWXHO GH
chastet dans un institut religieux . 3RXUFRQVWLWXHUOHPSr-
chePHQWGHPDULDJHOHYXGHFKDVWHWpGRLWGRQFrWUH :
public,
perptuel,
mis dans un institut religieux.
Ces trois conditions se rsument une seule.
A. Le c. 1192 1 distingue entre le YXSXEOLFreu au
QRP GH OeJOLVH SDU OH VXSpULHXU OpJLWLPH HW OH YX SULYp
Les YX[UHOLJLHX[VRQWSDUGpILQLWLRQGHVYX[SXEOLFV :
/LQVWLWXWUHOLJLHX[Hst une socit dans laquelle les mem-
EUHV SURQRQFHQW VHORQ OH GURLW SURSUH GHV YX[ SXEOLFV
perptuels, ou temporaires renouveler leur chance, et

32. Klaus LDICKE, Mnsterischer Kommentar zum Codex Iuris Cano-


nici, hg. von Klaus LDICKE, Band 5 (cann. 1055-1310), Essen, Ludge-
rus Verlag, 1984 ff., 1088/2 (November 2000) ; Carlos CORRAL SALVA-
DOR (dir.), Jos M URTEAGA EMBIL, Diccionario de Derecho Cannico,
Madrid, Universidad Pontificia Comillas Editorial Tecnos S. A.,
1989, p. 631.
33. Juan FORNS, Code de droit canonique bilingue et annot, 2e di-
tion, Montral, Wilson & Lafleur lte, 1999 (Gratianus), p. 759. Le
Code actuel a cependant conserv des interdictions, comme il ressort
du c. 1066 : Antequam matrimonium celebretur, constare debet nihil
eius validae ac licitae celebrationi obsistere ; ainsi, au sujet des maria-
ges mixtes : Matrimonium inter duas personas baptizatas, quarum
altera sit in Ecclesia catholica baptizata vel in eandem post baptismum
recepta, quaeque nec ab ea actu formali defecerit, altera vero Ecclesiae
vel communitati ecclesiali plenam communionem cum Ecclesia catho-
lica non habenti adscripta, sine expressa auctoritatis competentis licen-
tia prohibitum est (c. 1124).
mnent en commun la vie fraternelle (c. 607 2) 34, et il
est propre aux instituts religieux, mme si cela ne leur est
pas excluVLI GDVVXPHU OHV FRQVHLOV pYDQJpOLTXHV SDU GHV
YX[SXEOLFVjOH[FHSWLRQGHV autres liens sacrs dont il
est question au c. 573 2.
B. Puisque le droit connat trois sortes de profes-
sion religieuse :
La premire profession temporaire, qui intervient
immdiatement aprs le noviciat, pour une dure
dtermine par le droit propre, qui ne sera pas inf-
rieure trois ans ni suprieure six ans (c. 655),
Le renouvellement de la profession temporaire, qui
se fait, si OH GURLW SURSUH GH OLQVWLWXW OD SUpYRLW DX
terme de la prcdente pour une dure dtermine
par le mme droit propre,
La profession perptuelle,
LO\DDXVVLOLHXGHGLVWLQJXHUHQWUHOHVYX[WHPSRUDLUHVHW
OHV YX[ SHUSpWXHOV HQ DSSOLTXDQW OD PrPH W\SRlogie.
Attentent invalidement mariage les religieux qui ont pro-
nonFpGHVYX[SHUptuels 35 ; les autres peuvent contracter
mariage mais ils sont considrs comme renvoys par le fait
mme (c. 694 1, 2).
C. Dans la lgislation actuelle, WRXV OHV UHOLJLHX[ TXLOV
appartiennent un institut de droit pontifical ou un insti-
WXW GH GURLW GLRFpVDLQ VRQW WHQXV SDU OHPSrFKHPHQW GH
YX ; mais seulement les religieux  OHUPLWH DX VHQV VWULFW
FHOXLTXLQHVWSDVPHPEUHGXQ LQVWLWXWUHOLJLHXx), mme
VLOIDLWSURIHVVLRQSXEOLTXHGHVWURLVFRQVHLOVpYDQJpOLTXHV
VFHOOpV SDU XQ YX  F    QHVW SDV FRQFHUQp QRQ
plus que les membres des instituts sculiers (c. 712) ou des
socits de vie apostolique assumant les conseils vangli-
que SDUGHVYX[ c. 731 2).
Par consquent, les trois conditions poses par le c. 1088
sont runies dans la profession religieuse perptuelle qui les

34. Institutum religiosum est societas in qua sodales secundum ius


proprium vota publica perpetua vel temporaria, elapso tamen tempore
renovanda, nuncupant atque vitam fraternam in communi ducunt .
353RXUOHVHIIHWVGHQDWXUHSpQDOHVLOHUHOLJLHX[GHYX[SHUSptuels
DWWHQWHXQPDULDJHLOIDXWVHUpIpUHUDXFTXLVDSSOLTXHLQGppen-
damment de la rvocation de plein droit de tout office ecclsiastique (c.
194  HWGXUHQYRLSDUOHIDLWPrPHGHOLQVWLWXW F 1, 2).
rassemble et les rsume 36. Encore faut-il que cette dernire
VRLWYDOLGHFHVW--dire (c. 658) :
4XDLWHX OLHXODGPLVVLRQSDUOHVXSpULHXUFRPSpWHQW
avec vote de son conseil, faite librement selon le droit
(c. 656, 3)
4XHOOHVRLWH[SUHVVHHWpPLVHHQGHKRUVGHWRXWHYLR-
lence, crainte grave ou dol (c. 656, 4)
4XHOOH VRLW UHoXH par le suprieur lgitime, par lui-
mme ou par un autre (c. 656, 5)
4XHOOH DLW pWp SUpFpGpH GXQ WHPSV GH SURIHVVLRQ
temSRUDLUH GDX moins trois ans (c. 658, 2), restant
VDXYH OD SRVVLELOLWp GH ODQWLFLSHU SRXU XQH MXVWH
FDXVHPDLVSDVGHSOXVGXQWULPHVWUH F
Que la personne qui OpPHW DLW au moins vingt-et-un
ans accomplis (c. 658, 1).
Il convient encore de noter ceci : en tant que loi inhabili-
tante, le c. 1088 doit tre lu dans un sens restrictif ; nan-
PRLQVDLQVLTXRQODYXSOXVKDXW, OHYXGHFKDVWHWp dont
il est question doit tre compris au sens large pour tre inclus
dans les formules de profession qui ne le mentionnent pas
explicitement (par exemple, celle des Bndictins et celle des
'RPLQLFDLQV  &HVW SRXUTXRL OD UpGDFtion du c. 1073 du
Code de 1917 : attentent invalidement mariage les religieux
TXL RQW SURQRQFp OHV YX[ VROHQQHOV ( invalide matrimo-
nium attentant religiosi qui vota sollemnia professi
sint ) convenait davantage. Mais le changement de formula-
tion est intervenu ds ODWURLVLqPHVHVVLRQGXJURXSHGpWXGHV
sur le mariage (13-17 novembre 1967) 37.

/DGLVSHQVHGHOHPSrFKHPHQWSURYHQDQWGXYXSHUSp-
tuel de chastet mis dans un institut religieux est rserve
au Sige Apostolique ORUVTXH OLQVWLWXW HQ TXHVWLRQ HVW GH

36(QUDLVRQGHOHPSrFKHPHQWGHYXODSURIHVVLRQSHUSpWXHOOH
dans un institut religieux doit tre inscrite dans le registre des baptiss
(c. 535 2).
37. Invalide matrimonium attentant, qui votum publicum perpe-
tuum castitatis emiserint , ex Actis Pontificiae Commissionis Codici Iuris
Canonici recognoscendo, Coetus studiorum De Matrimonio (Sessio
III), Communicationes, vol. XXXII, 2000, n 2, p. 271 ; p. 284.
droit pontifical : Les empchements dont la dispense est
rserve au Sige Apostolique sont : 1 OHPSrFKHPHQWSUR-
veQDQW GHV RUGUHV VDFUpV RX GX YX SXEOLF SHUSpWXHO GH
chastet dans un institut religieux de droit pontifical
(c. 1078 2, 1) 38 6LQRQ FHVW--GLUH ORUVTXH OLQVWLWXW HVW
GHGURLWGLRFpVDLQODGLVSHQVHSHXWrWUHDFFRUGpHSDUO2U-
dinaire du lieu : /2UGLQDLUH GX OLHX SHXW GLVSHQVHU VHV
SURSUHVVXMHWVRTXLOVGHPHXUHQWHWWRXVFHX[TXLUsident
de fait sur son propre territoire de tous les empchements
de droit ecclsiastique, except de ceux dont la dispense est
rserve au Sige Apostolique (c. 1078 1) 39.
Cet empchement est donc de droit ecclsiastique 40, non
de droit divin. EQ HIIHW ODXWRULWp VXSUrPH GH OeJOLVH VH
rserve de dclarer de manire authentique quand le droit
divin empche ou dirime le mariage (c. 1075 1) 41 et la dis-
pense est un relchement de la loi purement ecclsiastique
dans un cas particulier (c. 85) 42 OeJOLVH QH VH UHFRQnat
SDVOHGURLWGHGLVSHQVHUGXQHPSrFKHPHQWGHGURLWGLYLQ
,OIDXWHQFRUHQRWHUTXHOHPSrFKHPHQWGHYXFRPPH
HIIHWFDQRQLTXHGHVYX[UHOLJLHX[SHUSpWXHOVFHVVHTXDQG
prennent fin ces derniers 43 : en cas de passage un institut
sculier ou une socit de vie apostolique au moment de

38. Impedimenta quorum dispensatio Sedi Apostolicae reservatur


sunt : 1 impedimentum ortum ex sacris ordinibus aut ex voto publico
perpeWXRFDVWLWDWLVLQLQVWLWXWRUHOLJLRVRLXULVSRQWLILFLL .
39. Ordinarius loci proprios subditos ubique commorantes et
omnes in proprio territorio actu degentes ab omnibus impedimentis
iuris ecclesiastici dispensare potest, exceptis iis, quorum dispensatio
Sedi Apostolicae reservatur .
40. Voir M. Bernard CALLEBAT, Des empchements matrimoniaux
en droit canonique et en droit civil franais , Studia Canonica, 33, 1999,
n 2, p. 429-430.
41. Supremae tantum Ecclesiae auctoritatis est authentice decla-
rare quandonam ius divinum matrimonium prohibeat vel dirimat .
42. Dispensatio, seu legis mere ecclesiasticae in casu particulari relaxa-
tio, concedi potest ab iis qui potestate gaudent exsecutiva intra limites suae
competentiae, necnon ab illis quibus potestas dispensandi explicite vel
implicite competit sive ipso iure sive vi legitimae delegationis .
43. Juan Ignacio BAARES in INSTITUTO MARTN DE AZPILCUETA,
Commentario Exegtico al Cdigo de Derecho Cannico, Pamplona, EUNSA,
Volumen III, 1996, p. 1185-1186 ; Carlos CORRAL SALVADOR (dir.), Jos
M URTEAGA EMBIL, Diccionario de Derecho Cannico, op. cit., p. 631.
OLQcorporation dfinitive (c. 685 2), de sortie (c. 692) ou
de renvoi (c. 701), y compris le renvoi par le fait mme du
religieux qui a attent un mariage mme purement civil
(c. 694 1, 2) 44&HVWjGLUHSDUODVpSDUDWLRQGHVUHOLgieux
GDYHFOHXULQVWLWXWKRUVOHFDVGXSDVVDJHjXQDXWUHLQVti-
tut religieux.
Cependant, puisque le GURLW GpILQLW OH YX FRPPH la
SURPHVVHGpOLEpUpHHWOLEUHIDLWHj'LHXGXQELHQSRVVLEle
et meilleur (c. 1191  OHIRQGHPHQWGHOHPSrFKHPHQW
GHYXQHVW-il pas en rapport avec le droit divin ? Il y a lieu
GH Vinterroger. /KLVWRLUH QpDQPRLQV HQ IDLVDQW driver
OHPpFKHPHQWQRQGXYXOXL-mme, mais de la profession
religieuse, raison pour laquelle il est de droit ecclsiastique
fournit une explication suffiVDQWH/pWXGHGXIDLWJpQprateur
GHOHPSrFKHPHQWFRQGXLWjXQHFRQFOXVLRQVHPEODEOH

/HPSrFKHPHQWGHYXVLJQLILHTXDWWHQWHQWLQYDOLGHment
mariage les UHOLJLHX[SURIqVGHYX[SHUSpWXHOV cette formu-
lation semble plus approprie que celles du Code de droit
canonique ou du Code des canons des glises orientales.
/XQLILFDWLRQVRXVODSSHOODWLRQFRPPXQHGLQVWLWXWVUHOL-
gieux, de la diversit des formes de vie religieuse, ainsi que la
VLPSOLILFDWLRQ GX UpJLPH GHV YX[ RQW SURGXLW XQ FHUWDLQ
nivellement : dans le droit prcdemment en vigueur, seule
la profession solennelle dirimait le mariage.
&HWDOLJQHPHQWGHOHIIHWFDQRQLTXHGHVYX[VHVWSRUt
VXUFHTXHOKLVWRLUHHWOHVWUDGLWLRQVRQWSHXjSHXIL[pIl y
DXUDLW OLHX QpDQPRLQV GH VLQWHUURJHU VXU OD TXDOLILFDWLRQ
MXULGLTXH GH OHPSrFKHPHQW GH YX TXRQ SRXUUDLW PHWWUH
HQSDUDOOqOHDYHFOHPSrFKHPHQWGHOLHQVLORQHQYLVDJHDLWOD
profession religieuse comme une alliance dans la perspective
GXQPDULDJHVSLULWXHOFRQWUDFWpDYHF'LHX (Somme de Tholo-
gie, Suppl. q. 53 art. 2).

Rmy LEBRUN

44. &HTXLUHQGOHPSrFKHPHQWGHYXLQHIILFDFHHQSUDWLTXH.
L
ES CONSERVATEURS APOSTOLIQUES ont dj fait
OREMHWGHGLIIpUHQWHVpWXGHVTXLRQWSDUXGDQVOD
Revue de droit canonique 1. /LQVWLWXWLRQ UHPRQWH
la fin du 12e sicle. Les conservateurs apostoliques for-
ment une catgorie particulire de juges dlgus, nomms
par le pape pour dfendre les droits et les privilges de cer-
WDLQHVSHUVRQQHVSK\VLTXHV FURLVpVURLVpYrTXHV HWVXU-
WRXW PRUDOHV RUGUHV UHOLJLHX[ XQLYHUVLWpV  FRQWre des
injustices ou des violences perptres leur gard. Dans la
prsente tude, nous poursuiYRQVOKLVWRLUHGHOLQVWLWXWLRQ
partir du dbut du 14e sicle.
Aprs la publication du SexteHQOLQVWLWXWLRQGHV
conservateurs connat un renouveau. Les pontificats de
Boniface VIII (1294-1303), de Benot XI (1303-1304) et de
Clment V (1305-1314) sont marqus par un accroissement
de lettres conservatoires, comme en tmoignent les Regis-
tres de ces papes.
partir du concile de Vienne (1311-1312), le statut des
conservateurs prendra une nouvelle forme. Ils recevront des
pouvoirs plus tendus pour intervenir dans les domaines
TXL UHOqYHQW GH OHXU FRPSpWHQFH ,O IDXW FKHUFKHU ORULJLQH
de cette extension de pouvoirs non pas dans un document

1. Le lecteur intress trouvera les rfrences aux prcdentes tudes


WUDLWDQWGHOKLVWRLUHGHVFRnservateurs dans la Revue de droit canonique,
t. 47, 1997, p. 71, note 1. La toute dernire tude figure dans la RDC,
t. 50, 2000, p. 283-308.
proprement lgislatif, mais dans une lettre pontificale de
caractre priv.
,O VDJLW GXQH OHWWUH GX SDSH %RQLIDFH 9,,, H[SpGLpH
G$QDgni et portant la date du 28 juillet 1301. Papinien de
Roborea, vque de Parme et vice-FKDQFHOLHU GH OeJOLVH
romaine 2 VpWDLW SODLQW DX SDSH GDWWDTXHV GRQW IDLVDLHQW
OREMHWVHVGURLWVHWVHVELHQVDLQVLTXHFHX[GHVRQGLRFqVH
/DOHWWUHHVWXQHUpSRQVHjFHVSODLQWHV(OOHQHVWSDVDGUHV-
VpHGLUHFWHPHQWjOpYrTXH3DSLQLHQPDLVjWURLVSHUVRQQHV
que Boniface VIII nomme conservateurs au bnfice de
PapiQLHQ &HV SHUVRQQHV VRQW OpYrTXH HW ODUchidiacre de
Bologne ainsi que le prieur du monastre Saint-Barthlmy
de Bologne, situ la porte de Ravenne. Il convient de
noWHU TXH FHVW -HDQ G$QGUp -1348) qui a rendu les
canoQLVWHV DWWHQWLIV j OLQWpUrW GH FHWWH OHWWUH SRXU OLQVtitu-
WLRQGHVFRQVHUYDWHXUV,OODIDLWGDQVOD Novella in Sextum,
en commentant le terme dietam (diaetam) de la dcrtale
Hac constitutione (VI. 1. 14.15) : Dominus Papinianus, episco-
pus Parmensis, dum erat vicecancellarius Bonifacii, pro suo epis-
copatu Parmensi impetrauit conseruatoriam per quam dabatur
conseruatoribus potestas, quod etiam in his quae iudicialem
requirunt indaginem per se vel alios procedere possent, et citare
usque ad quatuor dietas, et per quas tempore datae perpetuaba-
tur ipsorum iurisdictio (Papinien, vque de Parme, alors
TXLO pWDLW YLFH-chancelier de Boniface, demanda pour son
piscopat de Parme une lettre conservatoire par laquelle
serait concd aux conservaWHXUV OH SRXYRLU GLQWHUYHQLU
SDU HX[ RX SDU GDXWUHV PrPH GDQV GHV DIIDLUHV H[LJHDQW
une enqute judiciaire, et de citer les personnes loignes
MXVTXjTXDWUHMRXUVGHPDUFKHHWGDQVFHFDGUHGH[HUFHU

$YDQWVDQRPLQDWLRQjOpYrFKpGH3DUPH3DSLQLHQDYDLWpWpSUp-
vt de Parme, puis chapelain du Palais apostolique et auditeur des
causes du Palais ; nomm vice-FKDQFHOLHUGHOeJOLVHURPDLQHLOGHYLHQW
pYrTXHGH1RYDUHOHIpYULHU6RQDFFHVVLRQjOpYrFKpGH3DUPH
date du 3 juin 1300. Il meurt Avignon le 14 aot 1316. Cf.
G. BRIACCA, Papiniano Della Rovere. Contributo ad una biografia, dans
ConWULEXWLGHOO,VWLWXWRGL Storia Medioevale (Raccolta di studi in memoria
di Giovanni Soranzo), I, Milano, 1968, p. 60-128 (les pages 85 et suivan-
WHVFRQFHUQHQWOpSLVFRSDWGH3DSLQLHQj3DUPH 9RLUDXVVL& EUBEL,
Hierarchia catholica Medii Aevi, 2e d., t. 1, Monasterii, 1913, p. 392 ;
R. FAWTIER, Les registres de Boniface VIII, t. 4, Paris, 1939, p. IX.
leur juridiction sans limite de temps partir de la date de la
concession) 3.
la lecture de cette lettre, on constate que les pouvoirs
accords, en la circonstance, par Boniface VIII aux trois
personnes en question sont plus tendus que ceux normale-
PHQWUHFRQQXVMXVTXLFLDX[FRQVHUYDWHXUs.
Ces pouvoirs se caractrisent de triple faon. Tout
GDERUGOHVFRQVHUYDWHXUVSHXYHQWSURFpGHUjXQHHQTXrWH
judiciaire MXVTXDORUVVDXIHQGHWUqVUDUHVFDVOHVFRQVHU-
YDWHXUVQpWDLHQWSDVDXWRULVpVjOHIDLUH&HVWGLUHTXLOVQH
pouvaient pas intervenir lorsque les injustices ou les violen-
FHVUHSURFKpHVDX[IDXWHXUVQpWDLHQWSDVFODLUHPHQWpWDEOLHV
et requraient, pour tre prouves, le recours une enqute
MXGLFLDLUH,OVQpWDLHQWKDELOLWpVjDJLUTXHVLOHVDFWHVGpOLF-
tueux taient notoLUHV /HQTXrWH MXGLFLDLUH pWDLW UpVHUYpH
aux juges RUOHVFRQVHUYDWHXUVQHQWUDLHQWSDVGDQVODFDWp-
gorie des juges proprement dits. Dsormais, il leur est per-
PLVGHIDLUHXQHHQTXrWHMXGLFLDLUHFHTXLOHVDVVLPLOHGXQH
certaine manire aux juges.
En second lieu, ils pourront citer les prvenus ou les
tmoins rsidant dans un lieu situ quatre jours de mar-
che hors du diocse. 2UGDSUqVODFRQVWLWXWLRQ Nonnulli du
e 4
IV concile du Latran (1215) , la distance autorisant une
citation tait limite deux jours de marche. Par la suite,
Boniface VIII avait mme rduit cette distance une seule
journe.
(QILQ OHV FRQVHUYDWHXUV GLVSRVHQW PDLQWHQDQW GXQH
juriGLFWLRQTXLQHVWSDV OLPLWpHGDQV OHWHPSV-XVTXLFLOD
mission qui leur tait confie tait temporaire ; ils devaient
accomplir leur tche dans le dlai qui leur avait t assign.
Effectivement, dans la seconde moiti du 13e sicle, pour
viter que les affaires ne tranent en longueur et pour que le
mandat soit fidlement excut, les papes QDYDLHQWFRQFpGp
aux conservateurs que trois ans, tout au plus cinq, pour
VDFTXLWWHU GH OHXU PLVVLRQ 6L OHV FRQVHUYDWHXUV QDYDLHQW
pas rempli leur office dans le temps imparti, ils se voyaient

/HWH[WHHVWSULVGDQVOpGLWLRQGHOD Novella in Sextum, Venetiis,


1581 (dit. anast., Torino, 1966), fol. 52 r.
4. Canon 37, insr dans les Dcrtales de Grgoire IX, 1. 3. 28.
SULYpVDXWRPDWLTXHPHQWGHWRXWGURLWGDQVODIIDLUHGRQWLOs
taient chargs.
En plus de ces trois points essentiels, la lettre donne
TXHOTXHV SUpFLVLRQV TXL PpULWHQW GrWUH UHOHYpHV 'qV OH
premier jour de leur nomination, les trois conservateurs
peuvent agir de concert ou titre individuel FKDFXQGHX[
a pleine juridiction pour assurer la dfense des intrts de
OpYrTXHHWGHVRQGLRFqVH
Contrairement aux dispositions qui figurent auparavant
dans la dcrtale Hac constitutione (1298 ; VI. 1. 14.15), ils
VRQWDXWRULVpVDXVVLjGpOpJXHUOHXUSRXYRLUjGDXWUHV. Bien
SOXVODGpOpJDWLRQHVWSHUPLVHVDQVTXHVRLWH[LJpHODSSDUWH-
nance des dlgus au mme diocse que celui du dlgant.
Une autre facilit est encore octroye ces trois conser-
vateurs  VL OXQ GHX[ D FRPPHQFp OpJLWLPHPHQW OD SURFp-
dure, par uQH FLWDWLRQ RX DXWUHPHQW HW TXLO QH SXLVVH OD
poursuivre, chacun des deux autres dispose de la juridiction
ncessaire pour la mener terme.
En outre, la lettre indique les personnes ou les institu-
tions contre lesquelles ces conservateurs peuvent exercer
leur pouvoir  HQ SULQFLSH WRXV FHX[ TXHOV TXLOV VRLHQW
TXLVHUHQGHQWFRXSDEOHVGLQMXVWLFHVRXGH[DFWLRQVjOHQ-
contre de Papinien, vque de Parme, et de son diocse. La
lettre cite en particulier les universits, les seigneuries, les
collges OHV SUpODWV PrPH VLOV VRQW pYrTXHV HW WRXWH DXWUH
perVRQQHMRXLVVDQWGXQHGLJQLWpHFFOpVLDVWLTXHRXFLYLOH(Q
cas de ncessit, le pape autorise mme ces conservateurs
UHFRXULUjODLGHGXEUDVVpFXOLHU
Comme, notre connaissance, cette lettrH QD SDV pWp
SXEOLpH HW TXHOOH HVW GRQF GLIILFLOHPHQW DFFHVVLEOH DX OHF-
WHXUQRXVHQUHSURGXLVRQVOHWH[WHGDSUqVOHPDQXVFULWTXH
nous avons trouv aux Archives Vaticanes, Reg. Vat. 50,
fol. 44 v, n173 : Uenerabili Episcopo et dilecto filio archidia-
cono Bononiensi et priori monasterii sancti Bartholomei, porte
Rauennatis, Bononiensis, per priorem soliti gubernari. Ex iniunc-
te nobis seruitutis officio ecclesiis et personis ecclesiasticis pontifi-
cali presertim preditis dignitate tenemus adesse presidio secundum
uenerabilem fratrem nostrum P(apinianum) episcopum Parmen-
sem sancte Romane Ecclesie uice cancellarium eo specialius uolu-
mus et intendimus contra malignancium audaciam quorum-
cumque tueri quomodo ipsum suis exigentibus meritis beneuo-
lencia prosequimur ampliari. Cum itaque dictus Episcopus sicut
ipse nobis exposuit super bonis et iuribus suis et Parmensis eccle-
sie frequenter indebite molestari, nos et ipsius in hac parte
prouidere quieti et molestancium maliciis obuiare uolentes, dis-
crecioni uestre per apostolica scripta mandamus quatenus uos
uel duo aut unus uestrum per uos uel alium seu alios eidem
Episcopo opportuni fauori et efficacis defensionis presidio assis-
tentes, non permittatis eum super hiis ab aliquibus molestari
faciendo sibi uel procuratori seu procuratoribus suis, cum ab eo
uel ab eis super hoc fueritis requisiti, de quibuslibet iniuriatori-
bus suis eciam per uiam iudicii super hiis que iudicialem requi-
runt indaginem iusticie complementum ac iniuriatores et moles-
tatores huius quicumque et cuiuscumque condicionis fuerint aut
status, eciam si uniuersitates comitates uel collegia fuerint seu si
pontificali uel alia quacumque ecclesiastica uel seculari premi-
neant dignitate, auctoritate nostra appellacione postposita com-
pescendo, inuocato ad hoc si opus fuerit auxilio brachii secula-
ris, non obstantibus de duabus edita in concilio generali, et nos-
tris de una dietis, dummodo ultra terciam uel quartam dietam
aliquis extra suam ciuitatem et diocesim auctoritate presencium
ad iudicium non trahatur, ac quibuslibet aliis constitucionibus
in contrarium promulgatis. Ceterum uolumus et apostolica auc-
toritate decernimus quod a data presencium plene sit attributa
unicuique uestrum iurisdiccio in premissis quandoque idem
robur eandemque uim perpetuacionis ex tunc iurisdiccio cuius-
libet uestrum obtineat quod et quam si quilibet uestrum auctori-
tate presencium incepisset per citacionem monicionem uel alias
legitime procedere obtinerent, et quasi re non integra perpetuata
eadem uestrum cuiuslibet iurisdiccio censeatur. Datum ut supra
(Anagni v kalendas augusti anno septimo) (28 juillet 1301).
Les pouvoirs accords aux conservateurs en faveur de
OpYrTXH3DSLQLHQQHGHYDLHQWSDVrWUHH[FHSWLRQQHls par la
VXLWH&HVWFHTXHORQHVWDXWRULVpjDGPHWWUHVLORQVHQ
WLHQWDXGLUHGH-HDQG$QGUp(QHIIHWOHFpOqEUHFRPPHQ-
tateur note que cette manire de procder sera utilise par
OD &XULH URPDLQH (OOH OpWDLW HQFRUH DX WHPSV R -HDQ
G$QGUpUdigeait la Novella in Sextum ; celle-ci remonte aux
annes 1336-1342  Haec forma sic venit in stilum curiae,
quod quo ad hoc parum valet hodie de facto haec prouisio 5.

 WLWUH GLQIRUPDWLRQ QRXV DYRQV IDLW TXHOTXHV VRQGDJHV


dans les Registres des papes suivants : Boniface VIII (1294-
1303), Benot XI (1303-1304) et Clment V (1305-1314). Il
nous intressait de savoir si, avant le concile de Vienne (1311-
1312), nous pourrions trouver des exemples qui auraient tay
ODUHPDUTXHGH-HDQG$QGUpFRQFHUQDQWODGRSWLRQGXQQRX-
veau style par la Curie.
Pour Boniface VIII, nous avons consult les lettres conser-
vatoires postrieures au 23 juillet 1301, date de la lettre accor-
dant des pouvoirs spciaux aux trois conservateurs chargs de
dfendre les intrts de Papinien. Les Registres de Boniface
VIII (1294-  SXEOLpV SDU OeFROH IUDQoDLVH GH 5RPH *
Digard, M. Faucon, A. Thomas, R. Fawtier, Paris, 1904-1939,
YRO QHGRQQHQWSRXUFHVOHWWUHVTXHOLQcipit et un rsum
du contenu, et non pas le texte lui-mme. Nous avons exa-
min les manuscrits des lettres qui, dans les Registres de
OeFROHIUDQoDLVHGH5RPHSRUWHQWOHVQXPpURV
4316, 4622 et 4845 (Reg. Vat. 50, fol. 85 v-86r; fol. 86 r ;
fol. 104 r-v ; fol. 236 r-v). Ils ne fournissent aucun indice
sur une modification des pouvoirs concds habituellement
aux conservateurs.
Les lettres que nous avons releves dans le Registre de
Benot XI (1303-1304), publi par Ch. Grandjean (Paris,
1905, 1 vol.), savoir les numros 959, 960, 1044 et 1045,
ne sont pas plus explicites. En ce qui concerne Clment V,
nous avons examin dans les Registres publis par les
Bndictins (Romae, 1885-1892, 10 vol.) quelques lettres
antrieures au concile de Vienne (1311-1312). Ces lettres
figurent sous les numros 4435, 4436, 5272 et 5273. Elles
aussi nous amnent la mme conclusion : elles ne laissent
SDVDSSDUDvWUHGpOpPHQWVQRXYHDX[&HVWGLUHTXHOHVFRQ-
cessions de conservateurs accords par ces trois papes entre
les annes 1301-1311 (dbut du concile de Vienne) que
nous avons releves sont faites selon la formule habituelle ;
QRXV QDYRQV SDV GpFRXYHUW GXUDQW FHWWH SpULRGH GH[HP-

5. Le passage reproduit ici fait suite au texte correspondant la


note 3.
ples de nomination accordant des conservateurs des pou-
voirs spciaux quivalents ceux octroys aux trois conser-
vaWHXUV GH OpYrTXH 3DSLQLHQ /H UpVXOWDW QpJDWLI GH QRWUH
HQTXrWHSDUWLHOOHQHFRQWUHGLWSDVSRXUDXWDQWODIILUmation
GH-HDQG$QGUp3RXUSRXYRLUSRUWHUXQMXJHPHQWREMHFWLI
il aurait fallu procder un dpouillement complet des
Registres des trois papes cits plus haut ; en outre, on sait
TXH OHV 5HJLVWUHV QH FRQWLHQQHQW TXXQH SDUWLH GHV GRFX-
PHQWV GpOLYUpV SDU OHV SDSHV 9RLFL FH TXRQ OLW j OD ILQ GH
OLQtroduction du tome 4 des Registres de Boniface VIII
(1294-1303) sous la plume de R. Fawtier : /RQQ\WURXYH-
ra pas (dans les Registres de Boniface VIII) le texte de tou-
tes les lettres expdies par la Chancellerie apostolique.
/RQQ\WURXYHUDSDV en principe FH TXLHVWOHVVHQWLHO
de la correspondance particulire du pontife, les lettres
closes. Il semble mme que la plus grosse partie de la cor-
responGDQFH SROLWLTXHOHV OHWWUHV FXULDOHVQ\DLW SRLQWpWp
transcrite. Il est certain que, en nombre considrable, les
lettres de grce et de justice ont vit leur transcription
GDQVFHV5HJLVWUHV<FKHUFKHUXQWDEOHDXFRPSOHWGHODFWL-
vit de la Curie de Boniface VIII serait donc, notre avis,
une erreur grave 6. La rflexion de R. Fawtier vaut aussi
pour les Registres de Benot XI (1303-1304) et de Clment
V (1305-1314). &HVW SRXUTXRL QRXV QRXV UDOOLRQV j OD
rIOH[LRQ GH -HDQ G$QGUp HW QRXV DGPHWWRQV YRORQWLHUV
FRPPHDFTXLVTXHOD&XULHDUHSULVSRXUGDXWUHVFRQVHUYD-
teurs, au moins en certains cas, les dispositions prvues
dans la lettre de 1301 en faveur de Papinien.
Nous arrivons au concile de Vienne (1311-1312). Deux
SRLQWV PpULWHQW ODWWHQWLRQ : la mise en garde contre des
DEXVHWODFFURLVVHPHQWGHVSRXYRLUVUHFRQQXVDX[FRQVHUYD-
WHXUV &HV GHX[ SRLQWV QRQW SDV OD PrPH LPSRUWDQFH /H
premier est de nature secondaire LOQLQWpUHVVHSDVGLUHFWH-
ment le statut des conservateurs. Le second, en revanche,
est capital ; il modifie les pouvoirs des conservateurs.
Dans un premier point, le concile rend attentif aux abus
FRPPLV j ORFFDVLRQ GH OLQWHUYHQWLRQ GHV FRQVHUYDteurs. Il
le fait dans deux textes : le premier est la dcrtale Frequens

6. R. FAWTIER, Les Registres de Boniface VIII (1294-1303), t. 4,


Paris, 1939, p. CV-CVI.
(Clm. 5. 6. 1) 7 et le second, la dcrtale Religiosi (Clm. 5.
7. 1) 8.
'DQVOHSUHPLHUWH[WHOHFRQFLOHVHQSUHQGDX[pYrTXHV
TXL HQWUDYHQW ODFWLRQ GHV FRQVHUYDWHXUV ,O DUULYH que les
SULYLOqJHVGRQWMRXLVVHQWOHVH[HPSWVQRQWSDVpWpUHVSHFWpV
par les ordinaires. Dans ce cas, des conservateurs sont inter-
venus lgitimement pour tenter de mettre fin aux agisse-
ments des vques. Ils ont port des sentences pour rtablir
la jusWLFHjOpJDUGGHVH[HPSWV
/HVpYrTXHVVHVRQWRSSRVpVjODSXEOLFDWLRQRXjOH[p-
FXWLRQ GH FHV VHQWHQFHV &HVW FH UHIXV GH OD SDUW GHV pYr-
TXHV GREWHPSpUHU DX[ GpFLVLRQV GHV FRQVHUYDWHXUV TXH OH
pape Clment V dnonce dans cette dcrtale. Il ordonne
que prennent fin de tels comportements de la part des v-
TXHV/HFRQFLOHSUHQGjVRQFRPSWHOLQWHUYHQWLRQGXSDSH
et la sanctionne, son tour, de son autorit.
Dans le second texte, la dcrtale Religiosi, le concile
intervient contre les religieux. On leur reproche de prendre
GHV PHVXUHV YH[DWRLUHV j OpJDUG GHFFOpVLDVWLTXHV ,OV OHV
citent devant des juges dlgus par le pape pour tenter
GREWHnir justice : ils le font en ne respectant pas les rgles
de la loi ou en les convoquant en des lieux fort loigns de
OHXUUpVLGHQFH&HVWXQHIDoRQGHIDLUHTXLHVWFRQWUDLUHDX
droit et tout aussi rprhensible. Le terme de conservateur
ne figure pas dans le texte, mais il ne fait pas de doute que
VRXVOH[SUHVVLRQGH juges dlgus sont compris les con-
servateurs.
Le bien-fond de ces reproches ne saurait tre mis en
question : on sait par les dolances du clerg de la province
de Sens que les juges dlgus par le Sige Apostolique se
UHQGDLHQW FRXSDEOHV GDEXV GH FH JHQUH HW PrPH GH SOXV
graves, SXLVTXLOV VHUDLHQW DOOpV MXVTXj FRQYRTXHU LQXWLOH-

7. Sur la formation du dcret lors du concile, voir Ew. MLLER, Das


Konzil von Vienne (1311-1312). Seine Quellen und seine Geschichte,
Mnster i. W., 1934, p. 552-556 ; cf. aussi G. MOLLAT, art. Les Cl-
mentines , dans Dictionnaire de droit canonique, sous la dir. de R. NAZ,
t. 4, Paris, 1949, col. 636. On pourra consulter galement J. LECLER,
Vienne, Paris, 1964, p. 153 (+LVWRLUH GHV FRQFLOHV FXPpQLTXHV, sous la
dir. de G. DUMEIGE, t. 8).
8. Cf. MLLER, op. cit., p. 536539 ; MOLLAT, op. et loc. cit.,
col. 636 ; LECLER, op. cit., p. 150-151.
ment des tmoins pour extorquer des amendes sous pr-
texte de contumace 9.
4XRLTXLOHQVRLWOHSDSHSURILWHGXFRQFLOHSRXUUDSpe-
OHU DXVVL ELHQ DX[ SUpODWV TXDX[ UHOLJLHX[ OREOLJDWLRQ
GREVHUver les rgles canoniques.
Le second point nous parat de loin plus important. Il
concerne directement les pouvoirs des conservateurs. Il a
IDLW OREMHW GXQH GLVSRVLWLRQ GX FRQFLOH 1RXV OD FRQQDLV-
sons par un manuscrit cit par Ewald Mller : le manuscrit
Cod. lat. 2699 de la Bibliothque Nationale de Munich
(Mnchener Staastbibliothek) 10.
Parmi les diffrentes dispositions releves par Mller,
nous en trouvons une qui effectivement intresse les conser-
vateurs LOVDJLWGXWH[WHVHORQODQXPpURWDWLRQptablie
SDU0OOHU'DSUqVFHWH[WHGHVFRQVHUYDWHXUVSHXYHQWrWUH
DFFRUGpV FRQWUH OHV IDXWHXUV GLQMXVWLFHV OHV YROHXUV RX OHV
receleurs de biens ecclsiastiques. Les conservateurs ont
toute libert pour citer les coupables ; ils peuvent les convo-
quer MXVTXj XQH GLVWDQFH DOODQW j TXDWUH MRXUV GH PDUFKH
hors du diocse de ces dlinquants. Ce pouvoir, ils ont le
GURLWGHOH[HUFHUDXVVLELHQj OpJDUGGHODwFVGHFOHUFVRX
de religieux. Si trois conservateurs sont accords pour inter-
venir dans une affaire donne, ils peuvent agir non seule-
ment de concert mais mme titre individuel.
Voici les termes mmes du texte 21, tels que nous les
trouvons dans le manuscrit Cod. lat. 2699 : Item iniuriato-
res, spoliatores et detentores possessionum ecclesiarum sive layci,
clerici vel religiosi trahi possunt per conservatoria usque ad
quartam dietam extra suam dyocesim ita etiam quod iudices,
si tres fuerant impetrati, unus sine altero procedere possit 11.
Nous ignorons la raison pour laquelle cette disposition
QD SDV pWp LQVpUpH SDUPL OHV GpFUHWV GX FRQFLOH 1RXV VD-
vons simplement que, pendant le concile ou trs peu de
temps aprs sa clture, le pape a donn divers vques et

9. Cf. G. MOLLAT, Les dolances du clerg de la province de Sens


au concile de Vienne (1311-1312) , dans 5HYXHGKLVWRLUHHFFOpVLDVWLTXH,
t. 6, 1905, p. 325.
10. MLLER, Das Konzil von Vienne (supraQRWH S 679. Voir
aussi LECLER, Vienne (supra, QRWH  p. 149.
11. MLLER, op. cit., p. 687, n 21.
abbs de monastre des lettres conservatoires (Conservato-
ria). Ces lettres mettent excution de faon provisoire ce qui
DYDLWpWpGpFLGpDXFRQFLOH,OQHVWSDVLPSRVVLEOHTXHODGLV-
position que nous trouvons dans le manuscrit de Munich
UHIOqWH OHV WHUPHV GXQ GpFUHW JpQpUDO TXRQ DYDLW OLQtention
de promulguer durant le concile. Mais on peut admettre aussi
que cette disposition est plus probablement un rsum bref
HWV\QWKpWLTXHGXQHGpFLVLRQSULVHDXFRQFLOH4XRLTXLOHQ
VRLW FRPPH OHV DEXV GRQW pWDLHQW OREMHW FHUtains diocses
exiJHDLHQW TXRQ \ UHPpGLH LPPpdiatement, le pape accor-
dait de nombreux prlats, surtout des vques allemands,
des conservateurs munis de pouvoirs qui dpassaient ceux
prvus jusque-l. Il le faisait par des lettres individuelles que
ces prlats emportaient chez eux. Il allouait en fait aux con-
serYDWHXUVGHV SRVVLELOLWpVGDJLU FRUrespondant celles qui
figurent dans le texte 21 cit plus haut. En vertu de ces pos-
sibilits, les conservateurs taient habilits convoquer avec
une plus grande libert les fauWHXUVGLQMXVWLFHV ; rien ne les
empchait de faire venir ces dlinTXDQWV GXQ OLHX GLVWDQW
de quatre jours de marche hors de leur diocse. En outre,
FHV FRQVHUYDWHXUV SRXYDLHQW LQWHUYHQLU DXVVL ELHQ j OpJDUG
de lacs que de clercs ou de religieux, et mme titre indi-
viduel au cas o ils auraient t nomms trois pour une
mme affaire.
Nous ne savons pas non plus pourquoi cette disposition
QDSDVpWpLQVpUpHSOXVWDUGGDQVOHV Clmentines. Peut-tre
semblait-il au pape plus sage de rgler de manire indivi-
duelle les abus signals par les vques  FHVW SRXUTXRL OD
chancellerie pontificale tablit un formulaire particulier de
ces Conservatoria du concile de Vienne .
,O QHVW SDV LQWHUGLW GH SHQVHU TXH FHWWH SUpFDXWLRQ DLW
t prise par la Cour pontificale pour exempter les rois, en
particulier le roi de France, des mesures pnales prvues
FRQWUH OHV IDXWHXUV GDEXV /HV OHWWUHV SDUWLFXOLqUHV DYDLHQW
ODYDQWDJHGHSHUPHWWUHjTXLOHVUHFHYDLHQWGHQLQIOLJHUGHV
SHLQHVTXDX[FRXSDEOHVTXLOVDYDLHQWHQYXH8QHGLVSRVL-
tion gnrale aurait eu des rpercussions que la papaut
voulait viter. ce sujet, il est intressant de signaler un
document de Clment V, du 13 juillet 1312, donc de peu
posWpULHXUjODILQGXFRQFLOH,OVDJLWGXQHOHWWUHDGUHVVpHj
OpYrTXH GH Rouen, dans laquelle celui-ci est autoris agir
FRQWUHWRXVOHVIDXWHXUVGDEXVjOH[FHSWLRQGH3KLOLSSH 3KL-
lippe IV le Bel), roi de France, et de ses proches parents 12.
La disposition que nous trouvons dans le manuscrit de
Munich accorde pour tous les conservateurs des pouvoirs
similaires ceux concds en 1301, titre individuel, par
Boniface VIII aux trois conservateurs nomms pour dfen-
dre les intrts de Papinien, vque de Parme. Ces pou-
YRLUV FRPPH QRXV ODYRQV GLW SOXV KDXW RQW pWp RFWURys
dans un premier temps par Clment V lui-mme certains
conservateurs dans des lettres remises de nombreux v-
ques. Ils seront rapidement gnraliss aprs le concile ; tous
les conservateurs en bnficieront. preuve, la manire dont
se feront dsormais les concessions de conservateurs, puis-
TXHOOH UHFHYUD OD GpQRPLQDWLRQ GH forma concilii Viennensis
(formule du Concile de Vienne) 13. Cette dnomination figure
dans le livre de la chancellerie en usage durant la priode des
SDSHVG$YLJQRQ
Aux termes de cette formule, les conservateurs obtien-
nent mme des pouvoirs encore plus larges que ceux conc-
ds en 1301 aux trois conservateurs nomms par Boniface
VIII au bnfice de Papinien. En effet, outre la facult qui
leur est donne de pratiquer ventuellement une enqute
judiciaire, ils peuvent utiliser sans restriction la procdure
VRPPDLUHVXLYDQWOHVWHUPHVTXHORQWURXYHGDQVODGpFUp-
tale Dispendiosam au titre De iudiciis (Clm. 2. 1. 2) : sim-
pliciter et de plano, ac sine strepitu iudicii et figura. De ce fait,
ils pourront rgler plus rapidement certaines situations,
sans que leurs protgs soient obligs de recourir aux forma-
liWpVGHOordo iudiciarius.
Les lettres conservatoires dlivres par Clment V lui-
mme, au lendemain du concile de Vienne, laissent appa-
ratre clairement que les conservateurs seront habilits dor-
navant faire usage, de manire habituelle, de la nouvelle

7RXWHVFHVLQGLFDWLRQVQRXVOHVDYRQV SULVHV GDQVORXYUDJHGH


Ew. MLLER, Das Konzil von Vienne (supra, note 7)..., p. 431-432 ; 483-
484.
13. Cf. M. TANGL, Die ppstlichen Kanzleiordnungen von 1200-1500,
Innsbruck, 1894 (rdition Aalen, 1959), p. 321-324 : Conservatoria
iuxta formam concessam per dominum Clementem in concilio Viennensi.
SURFpGXUH  WLWUH GH[HPSOHV QRXV VLJQDORQV TXHOques-
unes de ces lettres : Avignon, 3 janvier 1313 ; Avignon, 1er
avril 1313 ; Apud Castrum novum (Chteauneuf), 23 mai
1313 ; Montiliis (Monteux), 5 janvier 1314 14. Les succes-
seurs de Clment V procderont de manire identique. Il
sufILWSRXUVHQFRQYDLQFUHGHVHUHSRUWHUDX[5HJLVWUHVGHV
lettres de ces papes.
Une dcrtale postrieure au concile de Vienne dfinit
les rgles de la procdure sommaire. En ralit, elle tait
dj en usage depuis un certain temps ; mais son applica-
WLRQ QpWDLW SDV JpQpUDOH HW OHV UqJOHV HQ pWDLHQW HQFRUH
imprcises 15. la demande des canonistes, le pape Cl-
ment V dterminera le sens attribuer aux diverses clausu-
les qui la caractrisent. Il le fera dans la dcrtale Saepe,
insre dans les Clmentines au titre De verborum significa-
tione (5. 11. 2). On avait longtemps cru que cette dcrtale
tait antrieure au concile de Vienne ; on la datait du 19
novembre 1306, conformment ce qui est indiqu dans
les Clmentines : Avinion. XIII. Kal. Decembr. Pont. nostri
Ao. II (= 19 novembre 1306). 'DSUqV OHV WUDYDX[ GH St.
Kuttner, elle est postrieure au concile : il faut la placer entre
le 6 mai 1312 (fin du concile) et le 21 mars 1314 16. La proc-
dure dfinie dans la dcrtale Saepe sera utilise couramment
par les conservateurs aprs le concile de Vienne.
*
* *
PRXU OKLVWRLUH GHV FRQVHUYDWHXUV OH FRQFLOH GH 9LHQQH
constitue une date capitale : il accorde aux conservateurs
des pouvoirs plus tendus que ceux qui, normalement, leur
taient reconnus dans le pass : procder en certains cas

14. On trouvera le texte de ces lettres dans Les Registres de Clment V


(1305-1314), publis par les Bndictins, Romae, 1885-1892, nos 9097,
9017, 10006, 10137.
 $X VXMHW GH OpYROXWLRQ GH OD SURFpGXUH VRPPDLUH j OpSRTXH
que nous tudions, voir Ch. LEFEBVRE, Les origines romaines de la
e e
procdure sommaire aux XII et XIII sicles , dans Ephemerides iuris
canonici, t. 12, 1956, p. 192 et suiv.
16. St. KUTTNER, The date of the Constitution Saepe, the Vatican
Manuscripts and the Roman Edition of the Clementines , dans
Mlanges E. Tisserant, t. 4, Citt del Vaticano, 1964, p. 427-452 (Studi e
Testi, 234).
une enqute judiciaire eW IDLUH XVDJH GXQH PDQLqUH KDEL-
tuelle, de la procdure sommaire. Ainsi prend naissance la
forma concilii Viennensis, selon laquelle, durant des dcen-
nies, seront dsormais nomms les conservateurs. On com-
SUHQGGDQVFHVFRQGLWLRQVTXLOVYRQWIUDQFKir un nouveau
pas pour devenir une catgorie particulire de juges. Cepen-
GDQWDXFRXUVGHVVLqFOHVLOVIHURQWHQFRUHOREMHWGHTXHO-
ques mesures lgislatives : par exemple, au Ve concile du
Latran (1512-1517), sous Lon X ; au concile de Trente
(1545-1563) (session 7, canon 14, De reform. ; session 14,
canon 5, De reform. ; session 21, canon 8, De reform.) 17. Par
la suite, divers papes mettent des constitutions les concer-
nant : Clment VIII, constitution Sanctissimus, du 19 mars
1592 ; Grgoire XV, constitution Sanctissimus, du 20 sep-
tembre 1621 ; Clment XIII, constitution Cum omnium, du
23 avril 1762. partir de la fin du 18e VLqFOH OXVDJH SUp-
vaudra, en particulier pour les ordres religieux, de ne plus
passer par les conservateurs, mais de VDGUHVVHUGLUHFtement
au Saint-sige SRXU OD SURWHFWLRQ GHV GURLWV /LQVtitution
ILQLUDSDUWRPEHUHQGpVXpWXGHSDUPDQTXHGLQWpUrW

Henri HNAFF

 /H FDQRQ  GH OD VHVVLRQ  QH SDUOH TXLQGLUHFWHPHQW GHV
FRQVHUYDWHXUV 1RXV ODYRQV TXDQG PrPH PHQWLRQQp FDU LO HVW TXHV-
tion de lettres conservatoires (Conservatoria) dans le texte ; il nous
parat vident que les conservateurs sont viss dans ce canon.
S
ELON LE CODE de droit canonique promulgu en
1983, le synode diocsain est : la runion des
SUrWUHV HW GHV DXWUHV ILGqOHV GH OeJOLVH SDUWLcu-
liqUH FKRLVLV SRXU DSSRUWHU OHXU FRQFRXUV j OpYrTXH GLRFp-
sain pour le bien de la communaut diocsaine tout
entire . Les dispositions du canon 460 1 sont trs large-
ment influences par la Constitution dogmatique Lumen

1. E. CORECCO, Il Vescopo, capo della Chiesa locale, protettore e


promotore della disciplina locale , Concilium, 8, 1968, p. 106-121 ; ID.,
Parlamento ecclesiale o diaconia sinodale ? , Communio 1, 1972, p.
32-44 ; ID., lus universale ius particulare , Ius et communio. Scritti du
Diritto Canonico, Facolt di Teologia di Lugano-Piemme, 1997,
549-579 ; J. I ARIETTA, Annotazione ai canoni 460-468 , P. LOMBAR-
DIA, J. I. ARRIETA, Codigo de Derecho Canonico, Pamplona, 1992,
p. 327-330 ; G. FELICIANI, Corresponsabilit ecclesiale nella struttura
gerarchica della Chiesa , J. BEYER, Communione ecclesiale e strutture di
corresponsabilita. Dal Vaticano II al nuovo Codice du Diritto Canonico,
Rome, 1990, p. 37-49 ; ID., Il sinodo diocesano , Vita Consecrata, 27,
1991, p. 381-395 ; ID., De synodo diocesana , Periodica de re canonica,
81, 1992, p. 381-423 ; L. TRICHET, Le Synode diocsain, Paris, Le Cerf,
coll. Bref , 1992, p. 11-35 ; P. AMENTA, Il sinodo diocesano quale
organo di participazione alla potesta legislativa del Vescovo , Periodica
84, 1995, p. 627-653 ; H. MONCEAU, Les Synodes diocsains, Paris,
DDB, 1994 ; H. LEGRAND, Dmocratisation ou communion ? Une
lecture thologique , dans H. MONCEAU, op. cit. ; CONGRGATION
POUR LES VQUES ET CONGRGATIONS POUR LVANGLISATION DES
PEUPLES, Instruction sur les synodes diocsains , La Documentation
catholique, 94, 1997, 826-831 ; R. PUZA et A. P. KUSTERMANN, Synodal-
recht und Synodalstrukturen..., Freiburg, Universittsverlag, 44, 1996, 7.
Gentium 2. 'DSUqV OH WH[WH FRQFiliaire, si chaque vque
reoit un mandat particulier, stricWHPHQWQpFHVVDLUHjOpGLIL-
cation de la Societas ecclsiale, et qui fait de lui le Diakonos
GX&KULVWLOQHQGHPHXUHSDVPRLQVTXHFHPLQLVWqUHpSLV-
FRSDOQH[HUFHVDPLVVLRQHWQDFWXDOLVH VDJUkFHTXHQFRP-
PXQLRQ GH OpYrTXH GH Oordo et de la plebs 3 : OeJOLVH YLW
de la synergie de ses membres .
La pratique du synode rpond avant tout une ncessit 4.
-XVTXDXe VLqFOHOpYrTXHYLWHQFRPPXQDXWpDYHFVRQFOHUJp
Aid par le presbyterium 5, il rgle les questions litigieuses, il
exerce ses fonctions liturgiques, pastorales et juridictionnel-
les 6. partir du 6e sicle 7 HQ UDLVRQ GH OpYROXWLRQ FRQFL-

2. Lumen Gentium, n 24-28


3. J. M. R. TILLARD, /eglise locale. Ecclsiologie de communion et
catholicit, Cerf, Cogitatio Fidei, 1995, p. 313.
4. Le terme de synode est trs tt connu (F.-G. SAVAGNONE, Le ori-
gini del sinodo diocesano, 6WXGL%UXJL &KH]OHV*UHFVOH[SUHVVLRQ
synodos est HPSOR\pH SRXU GpVLJQHU GLYHUV W\SHV GDVVHPEOpHV &KH]
les Latins, le signifi apparat sous le vocable de concilium (F.-B.
DONNELY, The Diocesan Synod. An historical conspectus and commentary,
Washington D. C., The Catholic University of America, 1932). Pen-
GDQW ORQJWHPSV V\QRGH HW FRQFLOH VHURQW GDLOOHXUV V\QRQ\PHV &HVW
donc de faon indiffrente que thologiens et canonistes les utiliseront
(BENOT XIV, De Synodo Dioecesana, Venice, 1792, 1, 1, c. 1, n 1 ;
WERNZ-VIDAL, Jus de personis, Rome, 1928, p. 664). R. NAZ, Diction-
naire de Droit Canonique, Paris, 1965, t. VII, col. 1134-1140, v Synode.
Certains auteurs considrent le synode diocsain comme une volution
du presbyterium que les aptres avaient constitu dans toutes les glises
pour cpOpEUHUO(XFKDULVWLHHWJRXYHUQHUOHVILGqOHV (A. MICHIELS/2UL-
JLQHGHOeSLVFRSDW /RXYDLQS 3RXUGDXWUHVHQUHYDQche,
OLQVWLWXWLRQV\QRGDOHHVWWRXWjIDLWRULJLQDOH (SAVAGNONE, Le origini
GHOVLQRGRGLRFHVDQRHOLQWHUSUHWDWLRDlla c. 23, C. Th. XVI, 2 , Studi
in onore du Biagio Brugi, Palerme, 1910, p. 570 et s.). E. LANNE, /RUL-
gine des synodes , Tradition et communion des JOLVHV5HFXHLOGpWXGHV
Leuven, University Press-Uitgeverij Peeters, coll. Bibliotheca Epheme-
ridum Theologicarum Lovaniensis , 129, 1997, p. 199-217.
5. FOURNERET, Dictionnaire de thologie catholique, Paris, 1903-1926,
v Diocse, col. 1362-63. F. SALMON, 7UDLWp GH OpWXGH GHV &RQFLOHV HW GH
leurs collections, Paris, 1726, Part III, Chap. II, p. 840. M. MICHIELS, De
origine episcopatus, Louvain, 1900, p. 277-286.
6. J. GAUDEMET, /eJOLVH GDQV O(PSLUH URPDLQ ,9me-Vme sicles),
Sirey, 1989, p. 322.
7. Les premires rfrences directes datent de cette poque. Le droit
de Justinien et les canonistes emploient le terme de synode mais sem-
blent se rfrer aux conciles gnraux et provinciaux. (Cod. Just. I, 1, 3,
3 ; I, 1, 4, 9 ; I, 1, 7, 12. Nov. 131, c. 1 ; 137. C. Theod. 16, 2, 24 ;
Codex Canonum universae Ecclesiae, PL, 67,40).
OLDLUHHWGHOpYDQglisation des lieux les plus reculs du dio-
cse 8, il lui faut organiser de nouveaux lieux de culte. En
FRQVpTXHQFHOpYrTXHTXLVDIILUPHGHSOXVHQSOXVFRPPH
chef et pasteur 9 des mes dont il a la charge, doit notam-
PHQWYHLOOHUVXUOHQVHPEOHGHVHVFOHUFVPrPHOHVSOXVpORL-
gns gographiquement. cette poque donc, en Occident,
on assiste la tenue de conciles, rendus obligatoires 10 et
FRQYRTXpVSDUOpYrTXH&HSHQGDQWOHVFULVHVSROLWLTXHVHW
religieuses des 7e et 8e sicles devaient attnuer la frquence
de ces assembles 11.
3XLVVRXVOimpulsion des moines insulaires, de Grande-
Bretagne 12 HQ SDUWLFXOLHU j OLQLWLDWLYH GHV SDSHV FRPPH
un peu partout en Europe 13, les Carolingiens runissent

8. J. A FUENTES CABALLERO, Le Sinodo Diocesano. Breve recorrido a


su actuacion y evolucion historica , Ius Canonicum, 11 (1984), p. 543-566.
O. PONTAL, volution historique du synode diocsain , dans La Synoda-
OLWp /D SDUWLFLSDWLRQ DX JRXYHUQHPHQW GH OeJOLVH Actes du VIIme Congrs
international de Droit canonique, /$QQpH&DQRQLTXH Hors srie, vol. 11,
1991, p. 525. T. ROZKRUT, La natura teologico-giuridica del sinodo diocesano,
Rome, 1996. P. VALDRINI, DveloppePHQW HW OLPLWHV GH OH[Sprience
synodale catholique en France , Nonagesimo anno. Mlanges en hommage
Jean Gaudemet, PUF, 1999, p. 204-216.
9. J. GAUDEMET, op. cit., p. 323.
10&RQFLOHG2UOpDQV HW V\QRGHG$X[HUUH  ; synode
de Canterbury (597) FRQFLOHG2VFD  
11. En *DXOHHQWUHHWODFWLYLWpV\QRGDOHVHPEOHVpFOLSVHU
Les assauts extrieurs et les dsordres politiques intrieurs nuisent la
staELOLWpGHVLQVWLWXWLRQVHWFRQGXLVHQWjODPLVHHQSODFHGXQHVRFLpWp
nouYHOOH(Q(VSDJQHOLQYDVLRQDUDEHUemet dfinitivement en cause la
structure synodale. En revanche, en Grande-Bretagne, on assiste un
mouvement de plus en plus fort de romanisation liturgique lanc par
les moines insulaires. On pourra se reporter R. H HELMHOLZ., P.
MIKAT, J. MLLER, M. STOLLEIS, Grundlagen des Rechts. Festschrift Lan-
dau zuni 65. Geburstag, Paderborn, 2000, et un compte rendu par J.
GAUDEMET, RHD, n 2, avril-juin 2001, p. 232-234.
12. C. R. CHENEY, English Synodalia of the Thirteenth Century with a
new introduction, 2e d. Oxford, 1968, p. 1-33. ID., The earliest English
diocesan statutes, English Historical Review, 75, 1960, p. 1-29. D. M.
OVEN, Synods in the diocese of Ely in the later Middle Ages and the six-
teenth century, Leiden, 1967. F. M. POWICKE et C. R. CHENEY, Councils
and synods, with other documents relating to the English Church, Oxford,
1964; J. WAYLAND JOYCE, (QJODQGV6DFUHG6\QRGV Londres, 1855, rep.
1967.
13. 3RXU O$OOHPDJQH RQ VH UHSRUWHUD QRWDPPHQW j $ - BITERIN,
Pragmatische Geschichte der deutschen national-provinzial und vorzglisch-
sten Diozesankonzilien von 4. Jahrh. bis auf Konzil von Trient 1-7, Mainz,
1835- 3RXU O,WDOLH RQ FRQVXOWHUD 6 DA NADRO, Sinodi diocesani ita-
liani. Catalago degli atti a stampa 1534-1878, Cit du Vatican, 1962.
nouveau les conciles 14. Aussi, pour diffuser une lgisla-
tion qui devient de plus en plus aERQGDQWHOpYrTXHVHPploie
promulguer celle-ci au cours du synode, faisant ainsi du
FOHUJp OLQVWUXPHQW PpGLDWLTXH GHV GLYHUVHV GLVSRVLtions 15.
$LQVLOpYrTXHHWOHV\QRGHGHYLHQQHQWOHSLYRWGHODVWUXFWXUH
religieuse des Carolingiens et le synode, fondePHQWGHOLQIRU-
mation normative.
Avec la Rforme Grgorienne, qui vient mettre un terme
DX[ H[FqV GH OD IpRGDOLVDWLRQ GH OeJOLVH 16, la suite des
pFULWVG<YHVGH&KDUWUHs 17 et de Saint Bernard 18, et dans
le cadre de la rvolution pastorale 19, les synodes, partout
en Europe 20, aprs une clipse aux 10e et 11e sicles, pren-
nent une importance certaine au 12e sicle.

3RXU O(VSDJQHRQYHUUDQRWDPPHQW) CANTELAR RODRIGUEZ, Celle-


cion sinodal Lamberto de Echevarria , Salamanca, 1980 ; GARCIA Y
GARCIA, Synodicon Hispanum, Salamanca, 1983. Pour la Hongrie, R.
SZENTIRMAI, Die ungarische Dizesansynode im Sptmittelalter, ZRG, Kan.
Abt. 47, 1961, p. 266-269. Pour le Portugal, A. DE JESUS DA COSTA,
Sinodos e constituioes diocesanas , Acco Catolica, XXVI, Braga,
1941, p. 596-610. Pour la Pologne, J. SAWICKI, Concilia Poloniae, Wars-
zawa, 10 vol., 1948-1963. Pour la Suisse, S. GAGNER, Zur Entstehung
der europischen und Schwedischen Dizesan synode , Kyrkohistorisk
Arsskrift, 48, 1948, p. 1-31.
14. HEFELE-LECLERCQ, Histoire des Conciles, Paris, 1909, III, 83.
Mansi, Collectio conciliorum, 13, 995 et 508.
15. M. RIZZI, De synodis diocesanis et de constitutionibus synoda-
libus , Apollinaris, 28, 1953, p. 292-315. (note p. 302-303).
16. A. GARCIA Y GARCIA, Los concilios particulares en la Edad
Media, Salamanca, 1980. Plus particulirement pour l(VSDJQHRQFRQ-
sultera L. DE LA CALZADA, La proyeccion del pensamiento de Grego-
rio VII en los reinos de Castilla y Leon , Studi Gregoriani, 3, 1948,
p. 1-87.
17. J. WERCKMEISTER, Yves de Chartres. Prologue, Cerf, 1997,
p. 15-18.
18. B. JACQUELINE, Papaut et piscopat selon saint Bernard de Clair-
vaux, ditions du Centurion, 1963, p. 105-108.
19. O. PONTAL, Les statuts synodaux , Typologie des sources du
Moyen ge occidental, Brepols Turhnout 1975, Fasc. 11. H. BARION,
Das Frnkisch-deutsch Synodalrecht des Frhmittelalters, Bonn und Kln,
1931. R. FOREVILLE, Les statuts synodaux et le renouveau pastoral du
XIIme sicle, dans le Midi de la France , Cahier de Fanjeaux, VI, 1971, p.
119-150. E. HALKIN, /HVVWDWXWV V\QRGDX[GHODQFLHQQH)UDQFH , Revue
G+LVWRLUH(FFOpVLDVWLTXHLXII 1, Louvain, 1967, p. 429-436. L. FERRER, Dic-
cionario de Historia Eclesiastica de Espana, Madrid, 1975, IV, 2487-2494, v
Sinodo.
20. J. GAUDEMET, Le GRXYHUQHPHQW GH OeJOLVH j OpSRTXH FODVVLTXH
Le gouvernement local, op. cit., p. 177-179.
En effet, partir du 12e sicle, le synode apparat comme
une assemble diocsaine o se rendent tous les curs du
diocse sur la convocation de leur vque pour y faire quel-
ques rglements ou quelques corrections sur la discipline et
la puret des PXUV 21. La clbration du synode est donc
DFFHSWpH FRPPH XQH FRXWXPH D\DQW IRUFH GH ORL HW FHVW
sans doute ce titre que Gratien le mentionne 22.
Le droit universel intervient pour rglementer le synode
diocsain, Ooccasion du IVe Concile de Latran 23. En vue
GH OXWWHU FRQWUH Ohrsie cathare, le Concile impose une
clbration annuelle du synode la suite du concile provin-
cLDOGRQWLOVDJLWHQIDLWGHSXEOLHUOHVGpFLVLRQVdans le dio-
FqVH &HSHQGDQW LO Qest pas rare de voir le synode tenu
semestriellement 24&HWHPSUHVVHPHQWGHOvque convo-
quer le synode peut trouver une explication tout fait mat-
rielle 25. Par la suite, Grgoire IX 26 et Boniface VIII 27 men-

21. DURAND DE MAILLANE, Dictionnaire de droit canonique et de pra-


tique bnficiale, Lyon, 1770, v Synode. BENOT XIV, op. cit., I, 1, VI :
8QHDVVHPEOpHOpJLWLPHUpXQLHSDUOpYrTXHFRPSUHQDQWOHVSUrWUHVHW
les clercs de soQGLRFqVHHWOHVSHUVRQQHVWHQXHVGDVVLVWHUjFHWWHDVVHP-
ble dans laquelle on doit traiter et dlibrer des choses qui concernent
le ministre pastoral .
22. Decretum Magistri Gratiani, P. I, D. XVIII : Episcoporum igitur
concilia, ut ex praemissis apparet, sunt invalida ad definiendum et consti-
tuendum, non autem ad corrigendum. Sunt enim necessaria episcoporum
concilia ad exhortationem et correctionem, quae etsi non habent vim consti-
tuendi habent tamen auctoritatem imponendi et indicendi, quod alias statu-
tum est et generaliter seu specialiter observari praeceptum (ed. FRIEDBERG,
Leipzig, 1879, Graz, 1955).
23. BOUCHER D$RGIS, Institutions du droit ecclsiastique, Paris,
Hrissant, 1767, Tome II, Chap. II, p. 18 ; DU ROUSSEAUD DE LA
COMBE, Recueil de jurisprudence canonique et bnficiale par ordre alpha-
btique, Paris, Bailly, 1771, v Synode ; GUYOT, Rpertoire de jurispru-
dence civile, criminelle et canonique, Paris, 1785, v Synode.
24. M. PISTOCCHI, De synodo dioecesana, Turin, 1922, p. 11.
25(QHIIHWHQYHUWXGHVRQGURLWGLRFpVDLQOpYrTXHSRXYDLWSHUFH-
voir le droit de synode ainsi appel SDUFHTXLOHVWGSDUWRXVFHX[TXL
VRQW REOLJpV GDVVLVWHU DX V\QRGH GH OpYrTXH HW TXL VRQW VRXPLV j VD
juridiction et aussi SDUFHTXLOVHSD\DLWRUGLQDLUHPHQWGDQVOHV\QRGH ,
BOUCHER 'ARGIS, op. cit., chap. XVII, p. 173, note 2. /auteur rap-
porte que ce droit a donn lieu Hincmar, archevque de Reims,
de reprendre plusieurs vques qui convoquaient souvent des syno-
des pour se faire payer plus souvent ce droit et Choppin prcise que
cette perception a lieu SRXU GpIUD\HU OpYrTXH IDLVDQW YR\DJH HQ FRXU
ou assembles gnrales du clerg (dans R. CHOPPIN trad. J. TOUR-
NET, Trait de la police ecclsiastique, Paris, 1662, Livre II, Titre VII,
tionnent le synode diocsain pour rappeler les dispositions
conciliaires. Mais ces instructions pontificales laissent une
JUDQGH PDUJH GH PDQXYUH la lgislation aiQVL TXj OD
pratique piscopale.
Le Concile de Ble, tenu entre 1433 et 1437, rglemente
le synode diocsain. Il renouvelle les dispositions prcden-
WHVHQOHVUHQIRUoDQWGHVDQFWLRQVSpQDOHVHQFDVGLQH[pcu-
tion 28. Le but du synode est alors de lutter contre tous les
abus qui peuvent intervenir dans le diocse. Pour accentuer
le caractre officiel que revt cette assemble, des tmoins
synoGDX[VRQWLQVWLWXpVTXLVDVVXUHURQWGHOHIILFDFLWpHWGH
ODSSOLFDWLRQGHVPHVXUHVSDUOHVFOHUFVGXGLRFqVH
De leur ct, les souverains temporels encouragent la
tenue des synodes diocsains. En Allemagne, en 1548,
Charles Quint promulgue sa Formula Reformationis, prescri-
vant ainsi la clbration rgulire de tels synodes 29.
Rformateur de la discipline ecclsiastique, le Concile
de Trente insiste encore sur la ncessit imprieuse de tenir
ces synodes et dfinit avec minutie les exigences et condi-
tions respecter 30.
Par la suite, la lgislation relative aux synodes diocsains
ne se modifie pas profondment. Seules quelques synthses

p. 317). On retrouve une explication similaire chez Du Bois qui prcise


toutefois que cette pratique fut restreinte au cours du 12e sicle (DU
BOIS, Maxime de droit canonique de France, Paris, Guignard, 1681, p. 37
et s.).
26. Decretalium D. Gregorii Papae IX, Liv. V, Tit. I, Chap. XXV :
Metropolitani ad correctionem excessuum et reformationent morum, sin-
gulis annis facere debent provinciale concilium in quo statuere debent perso-
nas idoneas ; per singulas dioeceses, quae solicite investigent, et in sequenti
concilio referant corrigenda : et episcopi debent facere synodos episcopales
singulis annis et publicare agitatae in provinciali concilio : et haec negligen-
tes, ab executione officii suspenduntur (op. cit.).
27. Sexti Decretalium, Liv. V, Tit VI, Chap. VI : Inferii praelati, qui-
bus per privilegium conceditur usus mitrae sunt exempti in provincialibus et
episcopalibus conciliis, uti possunt mitris aurificatis, non habentibus lami-
nas aut gemmas. Et si non sunt exempti, albis et planis utantur : in aliis
locis utuntur, ut indulta permittunt .
28. Concile de Ble, Session XV ; 26.Xl.1433, Histoire des Conciles,
p. 973-978.
29. R. LLORCA - R. VILLOSLADA - F. J. MONTALBAN, Historia de la
Iglesia Catolica, III, Edad Media, Madrid, 1960, p. 513-534.
30. Concile de Trente, Session XXIV, c. 2, Histoire des Conciles,
p. 1547-1548.
SRQWLILFDOHV GLPportance varie, viendront rappeler les
normes tridentines.
Ainsi, du Concile de Trente au Code de 1917 31, les
canons conciliaires et les prcisions pontificales deviennent
les fondements, souvent discuts, de la pratique synodale. Ils
dfinissent la nature juridique du synode diocsain (I) et font
de lui une vritable source de droit (II).

Les caractres 32 GXV\QRGHGLRFpVDLQGpYRLOHQWOautorit


qui mane de ce dernier.

A) Les caractres du synode

De La Blandinire pense que la lgislation synodale est


seulement une branche de la lgislation gnrale ou com-
PXQH GH OeJOLVH HW ODSSOLFDWLRQ GH Felle-ci la situation
prsente du diocse pour lequel le synode est assembl (...).
/RLQGDSSHVDQWLUOHMRXJGHOancienne discipline elle y met
tous les adoucissements que comporte la matire dont il
VDJLW (...). QuHOon prenne volont les statuts qui forment
DXMRXUGKXL OD GLVFLSOLQH GHV GLYHUV GLRFqVHV RQ Q\ YHUUD
31. A. ARTONNE, L. GUIZARD, O. PONTAL, Rpertoire des statuts syno-
GDX[GHVGLRFqVHVGHODQFLHQQH)UDQFHGX;,,,me au XVIIIme sicle, Paris,
1963 ; L. GUIZARD, Chronique des synodes diocsains et des statuts
synodaux franais , /$QQpH FDQRQLTXH I, Paris, 1952, p. 265-270 ; E.
HALKIN, /HV VWDWXWV V\QRGDX[ GH ODQFLHQQH )UDQFH  5HYXH GKLVWRLUH
ecclsiastique, LXII, 1, Louvain, 1967, p. 429-436 ; J. LELONG, Actes des
conciles et des synodes de France, Bibliothque historique de France, Paris,
1768 ; A. LONGHITANO, La normativa sul sinodo diocesano dal Con-
cilio di Trento al Codice du Diritto Canonico , Il sinodo diocesano nella
teologia e nella storia. Atti del Convegno di Studi Catania, 15-16 Maggio
1986, Catania 1987, p. 33-85.
32. O. PONTAL, volution historique du synode diocsain , op.
cit., p. 527, 530 et 532 ; J. GAUDEMET, /eJOLVHGDQVO(PSLUH5RPDLQ
op. cit., p. 343 ; ID., Le GRXYHUQHPHQWGHOeJOLVHjOpSRTXHFODVVLTXH/H
JRXYHUQHPHQWORFDO+LVWRLUHGX'URLWHWGHV,QVWLWXWLRQVGHOeJOLVHHQ2FFL-
dent, Cujas, Tome VIII, Vol. II, p. 175 ; J. IMBERT, Les Temps Carolin-
giens (741- /eJOLVH : Les institutions, Histoire du Droit et des Institu-
WLRQV GH OeJOLVH HQ 2FFLGHQW Cujas, Tome V, Vol. I, p. 131,134,138 ;
L. CHEVAILLER, Ch. LEFEBVRE, R. METZ, Le Droit et les institutions de
OeJOLVHFDWKROLTXHGHODILQGX;9,,,me 1978. Organismes collgiaux et
moyens de gRXYHUQHPHQW+LVWRLUHGX'URLWHWGHV,QVWLWXWLRQVGHOeJOLVHHQ
Occident, Cujas, Tome XVII, p. 154-155.
rien dont les curs et les autres ecclsiastiques puissent dire,
TXHVLWHOOHFKRVHOHXUHVWRUGRQQpHRXGpIHQGXHFHVWTXLO
a plu leur vque de la leur prescrire ou de la leur dfen-
dre ; rien qui ne vienne des canons ou ny remonte. Ce qui
SDUDvW PrPH QrWUH TXXQH constitution locale QHVW Tue
lDSSOLFDWLRQ GHV UqJOHV GH Oglise aux besoins, la situation
particulire du diocse qui a exig de plus grandes prcautions
OHVTXHOOHVQHVHWURXYHQWSRLQWQpFHVVDLUHVGDQVGDXWUHV 33.
Les canonistes et jurisconsultes, ds le 16e sicle, font
apparatre le triple caractre du synode.
Le premier caractre du synode diocsain, le plus effac
j OpSRTXH TXL UHWLHQW QRWUH DWWHQWLRQ HVW OD FRPSpWHnce
juridictionnelle. Au Moyen ge, le synode est, pour partie,
une vritable cour de justice dans laquelle sont tranches
les affaires ne prsentant pas de difficult majeure. Aprs le
Concile de Trente, cette fonction est trs nettement mise
HQUHWUDLWHQUDLVRQGHODIILUPDWLRQGXU{OHGHOofficial. La
TXDOLWp MXGLFLDLUH GX V\QRGH Qapparat plus que lorsTXXQ
DYLV HVW GHPDQGp j Oassemble des clercs sur le choix des
juges synodaux. Ceux-ci sont chargs dDVVLVWHU ORIILFLDO HW
VRQWGpVLJQpVSDUOpYrTXHSRXUFRQVWLWXHUXQWULbunal col-
lgial ORUVTXHOHGURLWOexige.
/H GHX[LqPH FDUDFWqUH HVW Oimportance pdagogique du
synode. Dans son trait, Horry observe que les statuts qui
sont prononcs dans les synodes ne sont que des renouvel-
lePHQWV GHV DQFLHQV FDQRQV GH OeJOLVH RX GHV pWDEOLVVH-
PHQWV GXQH QRXYHOOH GLVFLSOLQH TXL QH VHUW WRXWHIRLV TXj
faire observer les maximes de lancienne, et il est sans doute
que cHVWODORLGRQWOHVHFFOpVLDVWLTXHVGXQGLRFqVHGRLvent
tre parfaitement instruits 34. Le jurisconsulte insiste donc
VXU ODVSHFW LQIRUPDWLI GX FRQWHQX GHV VWDWXWV V\QRdaux.
Ceux-ci sont un moyen mdiatique. Dsormais, nul clerc ne
pourra ignorer le contenu des conciles provinciaux, nationaux
HWDXWUHV+HUPDQWUDSSRUWHTX aprs quon et termin ce
Saint Concile (de Trente) avec les crmonies accoutumes,

33. DE LA BLANDINIRE, Confrences ecclsiastiques sur les synodes


SRXU VHUYLU GH VXLWH HW GDSSXL DX[ FRQIpUHQFHV G$QJHUV Paris, Gueffier,
n. d., p. 173 et s.
34. C. HORRY, Trait de la comptence des juridictions ecclsiastiques,
Palis, Pralard, 1703, p. 1.
les vques retournrent dans leur diocse pour y faire rece-
voir ses saints et vnrables dcrets et pour y travailler au
rtablissement de la discipline ecclsiastique . Il prcise que
par la clbration de synode, on faisait de sages et pieux
rglements, on abolissait les mauvaises coutumes et on rfor-
mait les moeurs 35. /DXWHXUVWLgmatise ainsi le caractre du-
catif du synode et dvoile le troisime  Oautorit gouverne-
mentale de celui-ci.
La convocation synodale et le statut fix Oissue de
ODVVHPEOpHVRQWQpFHVVDLUHPHQWHQYLVDJpV pour le gouver-
nement et la discipline 36. Les exemples abondent. Il appa-
rat que la pastorale des sacrements et la formation du
clerg restent les proccupations dominantes 37. Ainsi Ov-
que avant de convoquer le synode, fait tablir par ses curs
des rapports dtaills sur la discipline ecclsiastique et sur
les moeurs de leurs paroisses 38 DILQ GpOaborer des statuts
appropris. JurisconsultHVHWFDQRQLVWHVLQVLVWHQWVXUOaspect
disciplinaire du synode 39 : on y lit un grand nombre de
rglements particuliers qui tendent maintenir le bon
ordre dans les diocses, mais encore plusieurs dcisions tou-
chant la foi et les PXUV.
Le triple caractre du synode juridictionnel, informatif
et gouvernemental HQJDJH j SUpFLVHU OLGHQWLWp GH Oauto-
rit qui le promulgue.

35. HERMANT, Histoire des Conciles, Rouen, Besongne, 1695,


chap. 113.
36. JOUSSE, Trait de la juridiction volontaire et contentieuse des offi-
cLDX[HWDXWUHVMXJHVGglise, Paris, Debure, 1769, Tit. 1, Sect. 1, Art. 2,
p. 26.
37. J. GAUDEMET, $VSHFW V\QRGDO GH ORUJDQLVDWLRQ GX GLRFqVH HV-
quisse historique , P. VALDRINI, Le S\QRGHGLRFpVDLQGDQVOKLVWRLUHHWGDQVOH
Code, Facult de droit canonique de Paris, 1988, p. 4-31.
38. Par exemple, Mmoire de ce que doivent faire les curs pour donner
FRQQDLVVDQFHj0RQVHLJQHXUGHOpWDWGHOHXUVSDURLVVHVDXSURFKDLQV\QRGH
gnral qui se tiendra le 16 mai 1673 : Tous les curs de ce diocse
feront XQ0pPRLUHH[DFWGHOpWDWGHOHXUVSDURLVVHVTXLOVDSSRUWHURQW
Monseigneur au prochain synode. Ce mmoire contiendra [...] suit
une liste de 11 prescriptions.
39. F. SALMON, op. cit., Part. III, Chap. I, p. 840 et BOUCHEL,
Recueil des dcrets de OeJOLVHJDOOLFDQHParis, 1689.
B) LLGHQWLWpGHODXWRULWpOpJLVODWLYHV\QRGDOH

Avant le Concile de Trente, la question fondamentale


demeure celle des modalits de convocation et de contenu
du synode diocsain 40. Par la suite, Ointerrogation glisse sur
OLGHQWLWpGHOautorit lgislative synodale 41.
La discussion trouve son fondement dans la question
suivante VLOHVWOXQLTXHOpJLVODWHXUSRXUTXRLOpYrTXHVXU
OLQMRQFWLRQGHVFDQRQVFRQFLOLDLUHVFRQYRTXH-t-il le synode
pour faire approuver les rgles de conduite et de discipline
HFFOpVLDVWLTXHTXil veut promulguer ? Daprs Hricourt 42,
cette approbation gnrale du clerg leur donne plus de
IRUFHHWGDXWRULWp . La rponse, dont le mrite est la clart
et la simplicit, semble cependant partielle certains.
Influencs par les ides de la Rforme 43 et de la Renais-
sance 44, nombreux sont ceux qui, en effet, discutent du
droit de lpYrTXH HW GHV SUpURJDWLYHV GH Oassemble syno-
dale. Ce mouvement trouve notamment son fondement
dans les thories de Richer 45, syndic, en 1602, de la facult
de thologie de Paris. Cette fonction le conduit dfendre
les liberts gallicanes et les droits de OXQLYHUVLWp de Paris
contre les empitements des ordres religieux. Dans la thse
TXil soutient en 1611 46, Richer dmontre que tout pouvoir
40. O. PONTAL, volution historique du synode diocsain , op.
cit., p. 522.
41. G. LE BRAS, Ch. LEFEBVRE, J. RAMBAUD, /ge classique
1140- +LVWRLUH GX 'URLW HW GHV ,QVWLWXWLRQV GH OeJOLVH HQ 2FFLGHQW
Tome VII, Sirey, p. 439.
42. L. HRICOURT, Les Loix ecclsiatiques de France dans leur ordre
naturel, Paris, David, 1756, Chap. XIV, n XXXI.
43. Dans ses Controverses, BELLARMIN combat les protestants qui
soutiennent sur ce point deux erreurs : la premire que tous les laques
RQW GURLW GDVVLVWHU DX[ FRQFLOHV HW G\ DYRLU OH VXIIUDJH GpFLVLI ; la
seconde est que le concile ne peut tre compos que des lus (Opera
omnia, Naples, 1872, T. II, L. I, Chap. XV).
44. J. BERNHARD, Ch. LEFEBVRE, F. RAPP, /epoque de la Rforme et
GX &RQFLOH GH 7UHQWH +LVWRLUH GX 'URLW HW GHV ,QVWLWXWLRQV GH OeJOLVH HQ
Occident, Tome XIV, p. 31-32.
45. E. PRECLIN, Edmond Richer, sa vie, son oeuvre, le rich-
risme , 5HYXH GKLVWRLUH PRGHUQH 1930, p. 241-269 et 321-336 ;
J. LECLER, 4XHVWFHTXHOHVOLEHUWpVGHOeJOLVHJDOOLFDQH , Recherches
de sciences religieuses, 1934, p. 47-85 ; NAZ, Dictionnaire de droit canoni-
que, Paris, 1951, v Richer ; M. COTTRET, Edmond Richer, le politi-
que et le sacr , /eWDWEDURTXH Paris, 1985, p. 159-177 ; Dictionnaire
GH OKLVWRLUH GX FKULVWLDQLVPH Paris, Encyclopdia Universalis et Albin
Michel, 2000, v Richer.
46. E. RICHER, De ecclesiastica et politica potestate, Paris, 1611.
est dans le peuple : chaque communaut a droit immdiate-
ment et essentiellement de se gouverner elle-mme Fest elle
et non aucun particulier que la puissance et la fonction ont
t donnes... Ni le temps ni les lieux ni la dignit des person-
nes ne peuvent prescrire contre ce droit fond dans la loi
divine et naturelle .
partir du 16e sicle, certains considrent que le synode
est un corps lgislatif dans lequel ceux qui sont prsents
dtiennent un vritable droit de vote 47. Certains clercs,
membres du synode, de jure, LQVLVWHQW VXU FH GURLW TXLOV
revenGLTXHQW'DSUqVHX[HQHIIHWXQHGpFLVLRQV\QRGDOH
ne peut tre efficace que si elle a reu le consentement de
ODVVHPEOpH.
Cette position, relative la conception dlibrative du
synode diocsain, entrane deux consquences :
/DSUHPLqUH UHOqYHGXQHGLVFXVVLRQSXUHPHQWWKori-
TXH (Q )UDQFH QRWDPPHQW Oautorit lgislative synodale
opre un glissement. Castel le justifie et par analogie
dmontre que celle-OjSHXWDSSDUWHQLUjXQDXWUHTXjOpYr-
que diocsain 48. Reprenant une affaire tranche le 5 aot
1585 par le Parlement de Paris, le jurisconsulte rappelle que
OH GR\HQ GH OeJOLVH GH 1HYHUV HQ IDYHXU GXTXHO OD &RXU
avait pris position, pouvait faire des assembles et des con-
vocations de synode , j OHQFRQWUH PrPH GH OpYrTXH TXL
V\RSSRVDLW&HOXL-ci se fondant sur cette raison naturelle
et de droit quLO Q\ DYDLW TXXQ SUpODW HW XQ pYrTXH GDQV
chaque diocVHGHPDQLqUHTXLOIDLVDLWYRLUSDUOjTXHVHXO
lvque pouvait tenir des synodes . 'DSUqV&DVWel donc, le
SRXYRLU OpJLVODWLI QDSSDUWLHQW SDV j OpYrTXH VHXO ; il est
GpWHQX SDU OHV FOHUFV EpQpILFLDQW GXQH FHUWDLQH UHFRQnais-
sance hirarchique et au nombre desquels sont les doyens
GHFKDSLWUH&HJOLVVHPHQWGHODXWRULWpOpJLVODWLYHV\QRGDOH
revtira un caractre plus FROOHFWLIGqV ORUVTXHOon appro-
fondit la dfense du droit des prtres dans le synode ou

47. WERNZ-VIDAL, op. cit., p. 622 ; A. DE MEESTER, Juris Canonici


et Juris Canonici Compendium, Bruges, 1921-28, vol. II, 713 ; DESTERLE,
Praelectiones juris canonici, 1, 181-182.
48. CASTEL, Les Dfinitions du droit canon contenant un recueil fort
exact de toutes les matires bnficiales suivant les maximes du Palais,
Paris, 1700, 3me d., p. 255-256.
concile diocsain 49, le synode est assembl pour rgler les
affaires du diocse HW QRQ SRXU OHV YRLU UpJOHU SDU Ovque
seul (...). Il serait possible en ULJXHXUTXHOpYrTXHW\UDQQLVkt
son diocse en ne se montrant jamais aux pasteurs du second
ordre que comme un matre qui les mne la baguette,
ordonQDQWWRXWVDQVOHXUDYLVRXQHOHSUHQDQWTXHSRXUVHQ
moquer. &HVW SUpFLVpPHQW FH TXH OD VDJHVVH GH Oglise a
voulu prvenir (...). 2XLOpYrTXHDOautorit suffisante pour
gouverner le diocse mais souvent et trs souvent de nos
joursLOQDSDVOHVTXDOLWpVUHTXLVHVSRXUOHELHQJRXYHUQHU
/eJOLVHDYRXOXSUpYHQLUOHVVXLWHVGHOLJQRUDQFH RXGHOD
SDVVLRQ GH OpYrTXH Elle a tabli un concile annuel dans
lequel il est oblig de dlibrer avec le second ordre. Lorgueil
piscopal regarde cette obligation comme une humiliation. Il
FKHUFKH j V\ VRXVWUDLUH 50  ODUELWUDLUH GH OpYrTXH SRVp
comme postulat, Maultrot oppose OpTXLWp V\QRGDOH 'DSUqV
lui Oglise a institu les synodes pour former une dlibra-
tion commune et un jugement fond sur la pluralit des
suffrages (...) pour concourir avec lvque la lgislation
diocsaine et aux autres affaires importantes . La pratique,
marginale, de certains pYrTXHVWHQGGDilleurs lui donner
raison 51.

49. J.-P. GIBERT, Institutions ecclsiastiques et bnficiales suivant les


principes du droit commun et les usages de France, Paris, 1736, Tome 1,
titre XIV, p. 82 : Si ceux qui tiennent que les statuts appels synodaux
doLYHQWrWUHIDLWVQRQSDUOpYrTXHVHXOPDLVSDUOHV\QRGH FRQjointe-
PHQW DYHF OpYrTXH VRQW PLHX[ IRQGpV TXH FHX[ TXL WLHQQHQW OH FRQ-
traire ? .
50. MAULTROT, Dfense du droit des prtres dans le synode ou concile
diocsain contre les confrences ecclsiastiques sur les synodes, Paris, 1789
p. 3, 20 et 21. Ou encore ID., Le droit des prtres dans le synode ou concile
GLRFpVDLQRXVXLWHGHODUpIXWDWLRQGHODFRQVXOWDWLRQVXUODXWRULWpOpJLVODWLYH
des vques dans leur diocse, publie par M. de Condorcet, vque de
Lisieux, en rponse une autre consultation en faveur des curs de son
diocse, Paris, 1779.
51. Factum pour M. Berthold prtre, cur de Champforgeux et pour
M. Enjarrant prtre, cur de Seury, tant pour eux que pour les autres curs
du dLRFqVH GH &KDORQV GRQW LOV RQW SURFXUDWLRQ DSSHODQWV FRPPH GDEXV
une ordonnance institue statuts synodaux du diocse de Chalons, publie
au synode de 6 mai 1716 contre Messire de Madot vque et comte de
Chalons sur Sane, Intim. 6L0OeYrTXHGH&Kalons avait voulu couter
les remonWUDQFHVGHVHVFXUpVGDQVOHGHUQLHUV\QRGHHWVRXIIULUTXRQOXLSUR-
SRVkWWRXVOHVLQFRQYpQLHQWVTXHVRQRUGRQQDQFHLPSRVVLEOHGDQVOH[pcution
renIHUPH LO QDXUDLW SDV PLV VHV SUrWUHV GDQV OD QpFHVVLWp GH VH SRXUvoir
contre un rglement dont les dispositions et les censures sont inouies et exor-
La raction lencontre de cette conception collgiale du
pouvoir lgislatif est mene par le souverain pontife 52, les
congrgations 53 romaines et certains canonistes 54 ,OV QRQW
GHFHVVHGDIILUPHUOexclusivit GXSRXYRLUOpJLVODWLIGHOv-
que. Les prtres, quelle que soit leur dignit ou leur fonc-
tion, ne peuvent donner que des avis lors du synode dioc-
VDLQ 7RXV UDSSHOOHQW DYHF IRUFH TXLO QDSSDUWLHQW TXj
OpYrque seul de juger, de prendre des dcisions quelconques,
et de publier les ordonnances 55. Le pape Pie VI condamne
la doctrine selon laquelle les prtres sont juges de la foi
comme les vques. Dans la Bulle dogmatique Auctorem
Fidei de 1794 56, il interdit les propositions 9, 10 et 11 du
synode de Pistoie, de 1786, dans lesquelles il est affirm
notamment que la rforme des abus en fait de discipline
ecclsiastique dans le synode diocsain doit galement
GpSHQGUHGHOpYrTXHHWGHVFXUpVHWTXHVDQVODOLEHUWpGH
dcision, on ne doit pas la soumission aux ordres des v-
ques, que les curs et autres prtres sont juges de la foi avec

bitantes : mais il a voulu faire lui seul des statuts synodaux et les donner
pour loi son diocse : il les a faits et dats 2 jours avant le synode et il a
prWHQGX TXpWDQW PDvWUH DEVROX GH OD GLVFLSOLQH LO QDYDLW SDV EHVRLQ GH
ODFFHSWDWLRQ QL PrPH GHV DYLV GH VRQ FOHUJp SRXU OH VRXmettre aux rgles
TXLO YRXODLW SUHVFULUH  FHVW SRXU FHOD TXH QH YRXODQW ULHQ GLPLQXHU OLGpH
TXLOVHVWIDLWHGHVRQSRXYRLULOURPSLWGDXWRULWpVXSUrPHOHV\QRGHDSUqV
avoir fait publier ses statuts HWOHVDYRLUFRQILUPpV /HVpYrques ne sont
pas des rois dans leur diocse, ni les matres absolus de la discipline ; le Sou-
veUDLQ /pJLVODWHXU GH OD 3DL[ QD SDV FRQILp FHWWH SXissance ces aptres
GRQWOHVpYrTXHVVRQWOHVVXFFHVVHXUV8QpYrTXHQDSDVOHGURLWGHIDLUHOXL
seul des canons  FH SRXYRLU QDSSDUWLHQW TXDX[ FRQFLOHV : les statuts syno-
daux sont des canons FHVRQWGHVUHJXOD /pYrTXHQHSHXWGRQFIDLUH
lui VHXOGHVVWDWXWVV\QRGDX[PDLVQHOHVGRLWIDLUHTXHQSOHLQV\QRGHSDUFH
que ce sont des lois pour tout le clerg qui les doit observer .
52. Pie VI, const. Auctorem fidei , 28.VIII.1794, prop. 9, 10,
Synodi Pistorien., damn. ; Lon XIII, const. Romanos Pontifices ,
8.V.1881.
53. S.C.C., Urgellen. A. 1581 ; S.C.C., Venetiarum, 21.IV.1592 ;
S.C.C., Algaren. 12.I.1595 ; S.C.C. Nullius, 1.VII.1597 ; S.C.C.,
Ianuen., 2.XII.1604 ; S.C.C., Oriolen., 26.VII.1614 ; S.C.C., Agien.,
26.VI.1621 ; S.C.C., Burgen., 5.1.1627 ; S.C.C., Savonen., 19.II.1628,
ad. 5 ; S.C.C., Oriolen., 27.V.1632, ad 15 ; Fulginaten., 26.II.11639 ;
Strongolen., 17.VI.1645, ad 4.
54. J. VERNANT, La DpIHQVHGHODXWRULWpGH1RWUH6DLQW3qUHOH3DSH
Louvain, Sassen, 1669.
55. ANDR, Dictionnaire de droit canonique, Paris, Walzer, 1890,
Tome III, v Synode.
56. Constitution Auctorem fidei , 28.VIII.1794, Fontes, n 475.
OpYrTXH GDQV OH V\QRGH . Le pouvoir lgislatif appartient
donc au seul vque. In synodo dioecesana unicus legislator et
iudex est episcopus 57. 2Q QH FUDLQW SDV GDIILUPHU TXH la
puissance de ladministration qui appartient aux vques
consiste (...) convoquer les synodes et y prsider 58. Ou
encore que WRXVFHX[TXLVRQWKRQRUpVGHORUGUHpSLVco-
pal (...) jouissHQW GXQH SXLVVDQFH RUGLQDLUH ) celle de
donner la loi diocsaine 59. Canonistes et jurisconsultes
lgitiment leur affirmation en se reposant sur Oquit cano-
niTXH HW QKpVLWHQW SDV j VLQGLJQHU FRQWUH FHX[ TXL DWWUi-
EXHQW XQ SRXYRLU DUELWUDLUH j Ovque : Alors quoi ! Les
vques sont donc dans un synode des lgislateurs absolus
qui commandent en matres et rigent en lois ce qui leur
plat dordonner ou de dfendre ; et tout un diocse dans
ORUGUH VSLULWXHO HVW OLYUp DX FDSULFH HW j OD GLVFUpWLRQ GXQ
seul homme  &H VHUDLW ELHQ PDO FRQQDvWUH OeJOLVH HW VRQ
gouvernement que de se former une pareille ide de la lgis-
lation diocsaine 60.
Le synode est une assemble consultative qui ne saurait
GRQF GLVSRVHU GDXFXQ SRXYRLU GpOLEpUDWLI 'DLOOHXUV OHV
dcisions adoptes aprs consultation du synode doivent
tre promulgues par le seul vque. En effet la publica-
tion solennelle (...) est une des conditions requises leur
rception juridique HQVRUWHTXHOOHVQHVRQWUpSXWpHVMXUL-
GLTXHPHQW UHoXHV VL HOOHV QRQW pWp SXEOLpHV . La publica-
tion de ces dispositions par le seul vque est donc nces-
VDLUHSRXUTXHOles aient force de loi publique 61.
La seconde consquence relative la conception dli-
bUDWLYHGXV\QRGHHVWGRUGUHSUDWLTXH'qVOHGpEXWGX18e
VLqFOH EHDXFRXS GpYrTXHV DILQ GpYLWHU GHV GLVFXVVLRQV
longues, fastidieuses et striles quant leur puissance lgis-
lative, renoncent convoquer les synodes aussi frquem-
ment que ne OHIL[HOH&RQFLOHGH7UHQWHGo ORQpeut en

57. F. WERNZ, lus Decretalium, Rome, 1906, II, 2, n 863, p. 758.


58. D. JOUSSE, op. cit., p. 26.
59 P.-J. CARLE, Code de drRLW FDQRQ GDSUqV OHV DSKRULVPHV G$UQROG
Corvin, Paris, Debcourt, 1841, Titre XIII, n 80, p. 25.
60. DE LA BLANDINIRE, op. cit., p. 162 et s.
61. J.-P. GIBERT8VDJHVGHOeJOLVHJDOOLFDQHFRQFHUQDQWODFHQVXUHHW
OLUUpJXODULWpParis, Mariette, 1724.
partie expliquer pourquoi si peu de synodes sont convo-
qus, tant en EspagnHTXen France 62.

Le synode diocsain devient, par la promulgation de ses


statuts, une source GHGURLW/HVGLVSRVLWLRQVTXil contient
VDSSOLTXHQWWDQWFRPPHVRXUFHGXGURLWLQWHUQHjOglise
que comme une source de droit public.

A) Le synode diocsain source de droit interne

Le synode diocsain est une source de droit interne


OeJOLVH. Il est une partie du droit particulier 63, de mme
que les canons particuliers font partie du droit propre aux
glises particulires, ainsi les ordonnances synodales com-
posent le droit particulier du diocse aussi bien que les
autres rglements faits par lpYrTXHKRUVGXV\QRGH 64. En
vertu du principe de hirarchie des normes ecclsiales, les
dispositions synodales demeurent soumises au droit univer-

62. En Espagne, plusieurs causes expliquent cet immobilisme : inef-


ficacit pratique des synodes diocsains, dsintrt des vques, pres-
VLRQVUR\DOHVTXHORQUHPDUTXHQRWDPPHQWGDQVOHVGLVSRVLWLRQVSULVHV
par Charles III, en 1769 et 1784, ordonnant que les conciles et les
synodes se soumettent au contrle du Conseil de Castille, oppositions
des chanoines cathdraux et des instituts exempts, influence croissante
et contrle des Congrgations romaines exercs sur les assembles et
actes synodaux, selon la Constitution Immensa de Sixte V. FUENTES
CABALLERO (J.-A.), El sinodo diocesano , Ius Canonicum, 1981, XI,
41, p. 543 et s. ; T. CAMARA, Los concilios provinciales en Espana ,
Ciudad de Dios, 14, 1887, 77-85, 257-263 et 460-465 ; DE ECHEVERRIA
(L.), Controversias juridiccionales entre Gregorio XIII y Felipe II ,
Revista Espanola de derecho canonico, 2, 1956, p. 373-377. Pour la
France, on pourra se rfrer WILLAERT (L.), La Restauration catho-
lique, 1563-1648, FLICHE et MARTIN, Histoire de OeJOLVH 18, 1960,
p. 70-71.
63. J.-P. GIBERT, op. cit., p. 51 : Les ordonnances synodales compo-
sent le droit particulier du diocse . G. LE BRAS, Ch. LEFEBVRE,
J. RAMBAUD, /ge classique 1140-1378. Sources et thorie du droit,
Histoire du Droit et dHV ,QVWLWXWLRQV GH OeJOLVH HQ 2FFLGHQW Paris, 1965,
Tome VII, p. 186, note 1 : Le droit particulier est celui qui est tabli
pour une partie de la chrtient par le lgislateur suprme lui-mme ou
une autorit qui lui est subordonne .
64. SALMON, op. cit., p. 841.
sel. Aprs le 16e sicle, cette affirmation, de principe jus-
TXDORUVVHWURXYHrWUHGHSOXVHQplus discute. En France,
VRXV Oeffet du gallicanisme 65, le synode diocsain tend
devenir le vritable pivot de la lgislation universelle, le
passage impos sans lequel nulle autre norme, mme sup-
ULHXUHQHSRXUUDLWVDSSOLTXHUGDQVXQGLRFqVHGpWHUmin.
3DUWDQWGHOide selon laquelle FHVWune loi inviolable
GDQV OeJOLVH TXXQ evque ne peut faire aucune fonction
piscopale daQVOHGLRFqVHGXQDXWUHpYrTXHVDQVOHFRQsen-
tement de cet vque 66, les dispositions pontificales et
conciliaires, pour tre juridiquement efficaces, doivent
EpQpILFLHUGHOHQWpULQHPHQWGHOevque qui, pour ce faire,
pourra assembler un synode. On retrouve une fois encore
les ides de Richer : le gouvernement de Oglise offre le
caractre dune aristocratie tempre dans laquelle les pas-
teurs, institus par le Christ, exercent une autorit minist-
rielle et reprsentative. Ainsi se multiplient les dissertations
relatives au Droit des vques touchant la rception des Bulles.
Pour leurs auteurs, une glise aussi importante que celle de
)UDQFHQHVWSDVREOLJpHGDFFHSWHUWRXWHVOHVGpFLVLRQVGHV
papes en matire de doctrine. Elle a le pouvoir de les exa-
miner. Elle peut expliquer celles qui sont obscures ou qui-
voques, modifier celles dont le contenu paratrait erron
DX[pYrTXHVYRLUHOHVUHMHWHUORUVTXHOOHOHVFRQsidrera dan-
gereuses ou non conformes sa tradition et sa foi.
/DUticle 4 de la Dclaration de 1682 lui reconnat de jure,
cette prrogative : Quoique le pape ait la principale part
dans les questions de foi et que ses dcrets regardent toutes les
glises, et chaque glise en particulier, son jugePHQWQHVWSDV
irrfoUPDEOH VL OH FRQVHQWHPHQW GH OeJOLVHQLQWHUvient . Le
pouvoir pontifical ne porte donc nulle atteinte la libert des
glises ORFDOHVGaccepter ou non ses dispositions.
/DQpFHVVLWpGXFRQVHQWHPHQWGHOeJOLVHSDUWLFXOLqUHHVW
ad validitatem GHODSplication des normes suprieures. Cette
glise examine les dcisions du souverain pontife, mais ne
VpOqYHSDVSRXUDXWDQWDXUDQJGHWULEXQDO(QHIIHWOHVpYr-
ques SHXYHQWUHIXVHUGHFRQVHQWLUGDSSURXYHURXGDFFHS-

65. J. BERNHARD, Ch. LEFEBVRE, F. RAPP, /poque de la rforme et


du Concile de Trente, Histoire du 'URLW HW GHV ,QVWLWXWLRQV GH Oeglise en
Occident, Paris, Tome XIV, 1975.
66. BRUNET GDSUqVBARBIER, $EUpJpGHVOLEHUWpVGHOeJOLVHJDOOLFDQH
avec des rflexions et des preuves qui en dmontrent la pratique et la justice,
Paris, 1765, art. III, p. 29.
ter les dispositions pontificales, en DXFXQ FDV LOV Qont le
pouvoir de les casser ou de les annuler 67. Mais leur accepta-
tion conditionne la rception de ces normes.
En consquence, pour tre applicable, la lgislation pontifi-
FDOHGRLWIDLUHOREMHWGXQHUDWLILFDWLRQHWGune promulgation
SDU Oglise particulire, notamment par convocation du
synode68. Or, selon Bouix, la promulgation des statuts syno-
daux est du ressort H[FOXVLI GH Ovque 69 j Oexclusion de
Rome 70 qui, contrairement ce qui se passe pour les conciles
provinciaux 71QHGLVSRVHSDVGun droit de reconnaissance 72.
Faut-il en conclure que les vques, par leurs statuts dioc-
sains, mettent en place une lgislation originale et particu-
lire ? La rponse semble ngative. Aux 16e, 17e et 18e sicles,
le grand souci des statuts synodaux sera de faire appliquer la
lgislation tridentine et les dispositions romaines qui la pro-
longent (constitutions pontificales et instructions des congr-
gations) 73.
Il nen demeure pas moins que les statuts diocsains sont
une vritable source du droit particulier 74. En effet, les
rglements faits, les synodes diocsains obligHQWGDQVOpWHQ-
due du diocse (...). /HVGpFUHWVGHVV\QRGHVQREOLJHQWSDVOHV
dioFpVDLQV TXL GHPHXUHQW KRUV GH OpWHQGXH GX GLRcse, ni
ceux qui, WDQWGDQVOHGLRFqVHQRQWSXDYRLUFRQQDLVVDQFH

67. J. GAUDEMET, Le *RXYHUQHPHQW GH OeJOLVH j OpSRTXH FODVVLTXH


HisWRLUH GX 'URLW HW GHV ,QVWLWXWLRQV GH OeJOLVH HQ 2FFLGHQW Tome VIII,
vol. II, Cujas, p. 178-179.
68. I. FRER, De synodo diocesana , Periodica 62, Rome, 1973,
p. 117-131.
69. BOUIX, Tractatus de episcopo ubi et de synodo dioedesana, Paris,
1859, vol. II, p. 388-389.
70. L. CHEVAILLER, Ch. LEFEBVRE, R. METZ, Le Droit et les institu-
WLRQVGHOeJOLVHFDWKROLTXHODWLQHGHODILQGX;9,OO me sicle 1978, His-
WRLUH GX 'URLW HW GHV ,QVWLWXWLRQV GH OeJOLVH HQ 2FFLGHQW Tome XVII,
Cujas, p. 151-175.
71. Ch. LEFEBVRE, M. PACAUT /epoque moderne 1563-1789. Les
sources du droit et la seconde centralisation romaine, Histoire du Droit et
GHV,QVWLWXWLRQVGHOeJOLVHHQ2FFLGHQWTome XV, Vol. 1, Cujas, p. 39-41.
72. Une seule exception ce principe est envisage par Benot XIV :
le recours adress la Congrgation du Concile par un diocsain qui
VHVWLPHUDLWOpVpSDU FHUWDLQVDUWLFOHV GHVWDWXWVV\QRGDX[ BENOT XIV,
op. cit., lib. 13, c. 5, n12-13.
73. J. GAUDEMET, op. cit., p. 22.
74. L. CHEVAILLER, Ch. LEFEBVRE, R. METZ, op. cit., p. 153-159.
des dcrets 75. La force lgale de ces dispositions synodales
est indiscutable, Les vques, (...) par les statuts synodaux
(...), ont de droit le pouvoir de faire des ordonnances pour
la police ecclsiastique de leur diocse et ces ordonnances
obligent en conscience et doivent tre suivies comme des
lois, mme aprs la mort des vques qui les ont faites, jus-
TXj FH TXHOOHV VRLHQW UpYRTXpHV SDU TXHOTXXQ GH OHXUV
successeurs 76.

B) Le synode diocsain source de droit public

/HV VWDWXWV V\QRGDX[ VLOV VRQW source du droit particu-


OLHU GH OeJOLVH SHXYHQW pJDOHPHQW VDSSOLTXHU HQ WDQW TXH
normes de droit public.
,OHVWUHFRQQXTXHQPDWLqUHUHOLJLHXVHOHVORLVOHVRUGRQ-
nances, les rglements du royaume, sont directement influen-
cs par diverses mesures ecclsiastiques. Mais pour Brunet ces
dernires ne tirent leur force et leur autorit ni des canons,
ni des conciles FHVWOHVFHDXGHOautorit royale et le consen-
tement des vques et des peuples qui donnent leur autorit et
qui assurent leur excution . Cette thorie domine aux 17e et
18e sicles 77.
Les statuts synodaux entrent ainsi dans la sphre du droit
FRPPXQ G$QFLHQ 5pJLPH DSSOLFDEOHV SDU OHV MXULGLFtions
civiles. Cette incorpRUDWLRQVHMXVWLILHGautant plus que ODS-
probation gnrale du clerg , dont bnficient les statuts dio-
csains, OHXUGRQQHSOXVGHIRUFHHWGDXWRrit 78.
En principe pour devenir vritable source du droit la-
que, et conformment la jurisprudence des cours souve-
raines, les statuts synodaux doivent tre prsents au roi,
FRPPHRQOHIDLWGDLOOHXUVSRXUOHVFDQRQVGHVFRQFLOHVHW
des constitutions des congrgations rgulires. Jousse fait de
ce contrle une condition imprative. Opgard des statuts
qui renferment des rglements o lRUGUH SXEOLF HVW LQWp-
ress , ceux-ci ne peuvent faire loi dans un diocse,
PRLQVTXLOVQDLHQWpWpHQUHJLVWUpVGDQVOHVFRXUVGHSDUOH-

75. SALMON, op. cit., p. 841.


76. ANDR, op. cit., v Synode.
77. BRUNET, op. cit., Art. VIII, p. 60.
78. L. HRICOURT, op. cit., Chap. XIV, n XXXII.
ment ou autoriss par lettres patentes dment enregis-
tres 79. Par cette rflexion, Jousse constate que la sphre
publique, Oordre public, la paix civile, quel que soit le
GRPDLQH TXils visent appartiennent en dernier ressort au
monarque ou ses dlgus. Il revient en effet aux gens du
Roi de contrler le contenu des diffrents textes. Il ne doit
en rien tre contraire aux dispositions gnrales du royaume.
6LOVWURXYHQWTXHOHVXSpULHXUHFFOpVLDVWLTXHHVWDOOpDX-del
de son pouvoir, ils prononcenW TXLO \ D DEXV HW GpIHQGHQW
Oexcution de son jugement. Cette ressource contre les entre-
prises ecclsiastiques est ouverte tous les Franais, comme
aux religieux 80.
Dans la pratique, toutefois, Hricourt remarque que les
VWDWXWV V\QRGDX[ VRQW REVHUYpV TXDQG LO Q\ D SRLQW GH GLV-
positions contraires aux loix gnrales de la discipline eccl-
siastique, aux liberts de lglise gallicane, aux ordonnances
de nos rois et aux usages particuliers du diocse, quand ils
sont lgitimes .
$LQVL ODUWLFOH  GX V\QRGH G$UUDV WHQX HQ 
ordonne tous les curs et ceux qui sont chargs de la
conduite des mes de faire de temps en temps une retraite
de huit ou dix jours dans le sminaire. Quelques curs dio-
cVDLQVLQWHUMHWWHQWDORUVDSSHOFRPPHGDEXVGHFHVWDWXWHW
prsentent une requte au conseil dArtois, par laquelle ils
demandent quLO VRLWIDLWGpIHQVHGexcuter ce statut syno-
GDOMXVTXjFH TXH OHSDUOHPHQWGH3DULVVH soit dfinitive-
PHQW SURQRQFp /vque, protestant contre cette requte,
se pourvoit devant le Conseil du Roi, duquel il obtient un
arrt en date dXVHSWHPEUHRUGRQQDQWOexcution
SDU SURYLVLRQ GH ODUWLFOH YLVp Dans sa dcision, le Conseil
du Roi prcise TXXQVWDWXWV\QRGDOVXUXQSRLQWGHGLVFL-
pline et de police ecclsiastique ne doit point avoir moins de
SRLGVTXXQe sentence de lRIILFLDORXTXXQHRUGRQnance de
lvque, qui sont excutes par provision suivant la disposi-
tion des canons et des ordonnances ds quLOVDJLWGHODFRU-
rection des moeurs et de la discipline ecclsiastique 81.

79. JOUSSE, op. cit., Tit. I, Sect. I, Art. 2.


80. BRUNET, op. cit., Art. VIII, p. 61.
81. L. HRICOURT, op. cit., Chap. XIV, n XXXII.
Il semble que le contrle de lgalit des statuts synodaux
soit donc assur de faon plutt rpressive que prventive,
SDUOHELDLVGHODSSHOFRPPHGabus. Cette technique met en
vidence tout le profit que le roi peut tirer de statuts dont
lREMHW HVW GDVVXUHU Oordre public en matire religieuse.
MaulWURWHVWFHSHQGDQWSOXV QXDQFp TXDQWjOHIILcacit de
cette coopration du spirituel et du temporel garantie, en
quelTXHVRUWHSDUODYRLHGHOapSHOFRPPHGDEXV,OSHQVH
TXH Oautorit publique, de concert avec les vques, biaise
le mcanisme. Le diocse est gouvern par des mande-
PHQWV GHV RUGRQQDQFHV GHV ULWXHOV pPDQpV GH OpYrque
seul. Par l, on est asVXUpGpFUDVHUOHVHFRQGRUGUH(...). La
VHXOH UHVVRXUFH GHV SUrWUHV HVW GLPSORUHU GHV WULEXnaux
sculiers LOV\REWLHQQHQWGHVDUUrWVTXLUpSULPHQWODEXVGH
OD GRPLQDWLRQ /H FOHUJp DFKqWH j SUL[ GDUJHQW OHV DUUrWV
du Conseil qui les casse ou des lettres de cachet qui les ren-
dent inutiles en rpandant partout le terreur. Tel est au vrai
OpWDWGHOeJlise en France en ce qui regarde les synodes 82.
Autrement dit le mcanisme de ODSSHOFRPPHGDEXVH[HUFp
devant les parlements, est rendu inefficace par la voie de
Ovocation ou de la cassation, que certains vques action-
nent devant le tout-puissant Conseil du Roi.
'H QRPEUHX[ IDFWXPV SHUPHWWHQW GLOOXVWUHU FHWWH VLWXD-
tion qui met en vidence les litiges intervenant entre un v-
que et son clerg, ainsi que le contrle des statuts demand
par celui-ci aux tribunaux ordinaires 83.
En France, ce procd de vrification sera maintenu dans
les articles 6 8 des Articles Organiques 84. De plus, ODUWLFOH

82. F. MAULTROT, op. cit., p. 27.


83. Factum pour M. L. Bethold, prtre, cur de Champforgeux
et pour M. L. Enjarrant prtre cur de Seurcy, tant pour eux que pour
les autres curs du diocse dont ils ont procuration, appelants comme
GDEXV XQH RUGRQQDQFH LQWLtule Statuts synodaux du diocse de
Chalon publie au synode du 6 mai 1716 contre Messire F. de Madot,
vque et comte de Chalon sur Sane, intime : /pYrTXH ferma la
bouche ceux qui voulurent lui expliquer leurs raisons avec toute la
soumission due son caractre : HQTXRL0OeYrTXHVHVWPRQWUpSOXV
ferme et plus absolu que ne le serait un souverain dans ses tats. Il ne
faut donc pas tre surpris si ses pasteurs ont eu recours la justice
VpFXOLqUH HW VLOV RQW LPSORUp OD SURWHFWLRQ GHV PDJLVtrats pour faire
casser un mandement contraire au droit public et aux lois du royaume.
84. G. DESOS, Rgime des cultes , Jurisclasseur Alsace-Moselle, 1994,
Fasc. 232, 11, p. 7 : /HVWURLVDUWLFOHVHQWDQWTXLOGRQQHQWFRPSptence
DX&RQVHLOGeWDWRQWpWpDEURJpVHWremplacs par les dispositions de la
ORL ORFDOH GX  GpFHPEUH  GRQW ODUWLFOH  HVW DLQVL OLEHOOp : les
UHFRXUVSRXUDEXVHQPDWLqUHHFFOpVLDVWLTXHGpIpUpVDX&RQVHLOGeWDWSDU
prcise TX aucun concile national ou mtropolitain, aucun
V\QRGH GLRFpVDLQ DXFXQH DVVHPEOpH GpOLEpUDQWH QDXUD OLHX
sans la permission expresse du gouvernement . en croire
Gautry, cette disposition est assez rapidement tombe en
dsutude 85. Avec la loi de sparation, en 1905 86, ces
dispositions sont cartes sauf en Alsace Moselle. En effet en
UDLVRQ GH Oannexion des dpartements du Rhin et de la
Moselle, suite la dfaite de 1870 et du Trait de Francfort,
du 10 mars 1871, OHEORFGHVUpJLPHVGHVFXOWHVQa pas t
supprim de jure. Cependant, de facto, cette disposition est
devenue progressivement inapplicable en raison de lvolu-

la loi du 18 germiQDODQ;HWOHVORLVTXLORQWFRPSOpWpHVHURQWVRXPis au
Conseil Fdral (Bundesrat) qui statuera sur le rapport de sa commission
de justice  $SUqV  OD TXHVWLRQ GXQ UpWDEOLVVHPHQW GH OD FRPp-
WHQFH GX &RQVHLO GeWDW QH IXW MDPDLV WUDQFKpH $FWXHOOHPHQW XQ WHO
UHFRXUVDXUDLWEHDXFRXSGHSHLQHjVinsrer dans le dispositif concorda-
WDLUHWHOTXLOHVWSUDWLTXp/LQVWLWXWLRQGRLWrWUHFRQVLGpUpHFRPPHLUUp-
mdiablement prime .
85. GAUTRY, Trait de la lgislation des cultes et spcialement du culte
catholique, Paris, 1854, Tome 2, n 695, p. 465-466 : En la supposant
HQYLJXHXUHOOHGHYUDLWVDSSOLTXHUDYHFXQHGLVWLQFWLRQ : toutes les fois
TXXQpYrTXHYRXGUDLWFRQYRTXHUOHFOHUJpHQDVVHPEOpHGpOLEpUDQWHLO
DXUDLW EHVRLQ GXQH DXWRULVDWLRQ H[SUHVVH GX JRXYHUQHPHQW 0DLV WUqV
souvent, leV pYrTXHV VHQWRXUHQW GHV HFFOpVLDVWLTXHV GH OHXU GLRFqVH
dans des runions purement religieuses, et qui ont pour but, non de
dliEpUHUVXUFHUWDLQVREMHWVPDLVGHVpGLILHUHWGHVHIRUWLILHUGDQVGHVVHQ-
timents de pit ; ce ne sont pas des synodes D\DQWOHFDUDFWqUHGDVVHPbles
GpOLEpUDQWHV HW GqV ORUV FHV UpXQLRQV QRQW EHVRLQ GDXFXQH DXWRULVDWLRQ
(OOHVVRQWGXQHJUDQGHXWLOLWpSRXUOHPDLQWLHQGHVPXUVHWGHODGLVFL-
pline. Dans certains diocses, conformment aux anciens principes, elles
RQWOLHXWRXVOHVDQV&HVWXQXVDJHVDOXWDLUHTXHODXWRULWpFLYLOHGRLWSURWp-
ger .
86. A. RIVET, 7UDLWpGXFXOWHFDWKROLTXHHWGHVORLVFLYLOHVGRUGUHUHOL-
gieux, Langres, 1950, Tome 2, p. 239 : La loi de sparation laisse
intacte la discipline ecclsiastique. Les autorits religieuses et spciale-
ment les vques peuvent dicter des prescriptions sanctionnes par des
SHLQHVVSLULWXHOOHVHWSDUOLQWHUGLFWLRQGHVVDFUHPHQWV . B de CHELLES,
Le nouveau rgime du culte catholique par le droit commun, Bordeaux,
1907, p. 84 : Or toutes ces entraves la libert (art. 4 des Articles
Organiques) sont dsormais abolies (...) sous ce rapport le clerg
recouvre toute sa libert la plus complte. Tout lui est permis sauf ce
qui peut tre contraire lRUGUHSXEOLFHWDXGURLW FRPPXQ . MIGNE,
Premire Encyclopdie thologique, Paris, 1862, v Synode.
tion des conceptions 87. Les statuts synodaux sont donc
rduits Otat de source du seul droit partiFXOLHUGHOglise 88.
En 1917, la refonte de la lgislation ecclsiastique pose,
plus que jamais, le problme de la combinaison droit parti-
culier droit universel. Dj en 1905, Boudinhon juge cette
entreprise extrmement difficile et dlicate 'DSUqVOXL le
GURLWFDQRQLTXHHVWORLQGrWUHXQLIRUPpPHQWREVHUYpSDUtout,
HW TXDQG LO VHUD FRGLILp FHUWDLQHV SDUWLHV QHQ GHPHXreront
pas moins impossible pratiquer en certains pays . Aussi
sinterroge-t-il sur les mthodes employer. Peut-on faire
figurer dans le Code autre chose que le droit commun ?
Mais que faire alors pour les parties de ce droit commun
qui ne sont ni observes ni possibles en tel ou tel pays ? (...)
Ajoutera-t-on au Code gnral une srie de lgislations loca-
OHVVDXIjQ\IDLUHILJXUHUTXHOHVGLVSRVLWLRQVTXLVHUDLHQW
praeter ou contra jus ? 89. En consquence, la veille de la
codification et au sein mme du droit canonique, la question
se pose dj du rle et de Oautorit de la lgislation locale
dont font partie les synodes diocsains 90. Finalement, la
lgislation universelle contenue dans le Code de 1917 laisse
une place limite au droit particulier. Celui-ci semble depuis
lors se trouver VRXV VXUYHLOODQFH GX IDLW GXQH PDMRUDWLRQ
du magistre romain et des prtentions curialistes 91.

Jeanne-Marie TUFFRY-ANDRIEU
Facult de droit, Strasbourg

87. F. MESSNER, Organisation et institutions des cultes recon-


nus et non reconnus et congrgations , Juris-Classeur Alsace-Moselle,
2000, Fasc. 231, p. 7.
88. En Allemagne, le paragraphe 18 du Landesherrliche Verord-
nung du 30 janvier 1830 SUpFLVH TXH VDQV ODJUpPHQW GHV JRXYHU-
nements respectifs, aucun vque ne peut convoquer un synode
diocsain. Cette mesure sera rapidement supprime (DREY, Was ist
in unserer zeit von synoden zu erwarten ? , Theolog. Zeitschrift, 1834,
p. 242).
89. Le Canoniste, 1905, p. 80-81.
90. A. ARYNHANC, Constitution of the Church in the new Code of
Canon Law, New-York, 1929. Ch. AUGUSTINE, A commentary on the
new Code of the Canon Law, v. II, St Louis & London, 1919. J. A.
CORIDEN, The diocesan synod an instrument of renewal for the local
Church , The Jurist, 33 (1974), p. 68-93.
91. TILLARD (J. M. R.), Comment accorder synodalit et pri-
maut , Cristianesimo nella storia, 19, 1998, p. 405.
En vrit je vous le dis : tout ce que
vous lierez sur la terre sera tenu au ciel pour
li, et tout ce que vous dlierez sur la terre
sera tenu au ciel pour dli.
(Mt 18,18)

D
ERRIRE LA DUALIT DES TERMES (ordre et
juridiction), derrire ce qui pourrait passer
SRXU XQH TXHUHOOH GH PRW FHVW WRXWH OHF-
clsiologie qui est engage Oglise comme ralit surnatu-
UHOOHHWOglise comme institution socitaire, juridiquement
hirarchise 1. On le voit, la distinction entre ordre et juri-
diction est capitale 2. Apparemment ignore par la tradition
orientale orthodoxe 3 HOOH QpPHUJH HQ 2FFLdenW TXj

1. J. GAUDEMET, Pouvoir d'ordre et pouvoir de juridiction. Quel-


ques repres historiques , L'Anne canonique, 29, 1985-1986, p. 83
(dsormais Pouvoir). Sur cette question cf. L. VILLEMIN, Pouvoir d'ordre
et pouvoir de juridiction, Paris, ditions du Cerf, 2003, qui propose une
tude historico-thologique de la distinction dans l'glise catholique
romaine des origines nos jours.
2. La distinction ordre / juridiction est souvent exprime dans
les sources sous la forme pouvoir d'ordre / pouvoir de juridiction ,
mais le fondement de cette thorie reste articul autour des
mots ordre et juridiction , cf. L. VILLEMIN, op. cit., p. 13-24.
3. J. GAUDEMET, Pouvoir, p. 90 ; sur cette question voir P. L'HUIL-
LIER, Rapport entre pouvoirs d'ordre et de juridiction dans la tradi-
tion orientale , Revue de droit canonique, 23, 1973 et J. ERICKSON,
partir du 12e sicle 4. 6DJLVVDQWGHVWHUPHVordo et iurisdictio
VRQW LVVXV GX GURLW SXEOLF URPDLQ HW QRQW j ORULgine que
peu de lien avec le christianisme 5. Ordo remonte aux
GpEXWV GH OeJOLVH HW HPSRUWH XQH FRQFHSWLRQ WUqV ODUJH
Cette dernire est encore de mise dans le Dcret de Gratien,
puisque le vocable renvoie non seulement au sacrement de
ORUGUHPDLVSOXVJpQpUDOHPHQWjWRXWGHJUpGDQVODKLpUDU-
chie, ou mme un office, sans rfrence un degr sacra-
menWHOGRUGUHRXHQFRUH XQHFDWpJRULHGLQGLYLGXV 6. Iuris-
dictio QDSSDUDvW TXH SOXV WDUGLYHPHQW GDQV OH YRFDEXODLUH
canonique, de manire incertaine et en concurrence avec
GDXWUHVWHUPHVQRWDPPHQW officium&HQHVWTXHGDQV OD
premire moiti du 12e VLqFOH TXpPHUJH iurisdictio comme
servant dsigner un pouvoir 7. Quant potestas LO QHVW
joint iurisdictio que par deux fois dans Gratien qui en
UHYDQFKH LJQRUH OH[SUHVVLRQ potestas ordinis 8. L. Villemin
conclut la VXLWHGXQPLQXWLHX[H[DPHQTXH OpWXGHOHxi-
FRJUDSKLTXHSHUPHWGDIILUPHUVDQVDPEDJHVTXLOQ\DSDV
chez Gratien de distinction entre ordo et iurisdictio, ou entre
potestas iurisdictionis et potestas ordinis.En revanche, dans la
rsolution de certains problmes, Gratien en semble
proche 9&HVWGRQFGDQVODVHFRQGHPRLti du 12e sicle

7KH RLNRQRPLR RI RUGHUV LQ %\]DQWLQH FDQRQ/DZ , Proceed of the


VIth international Congress of medieval canon law, 1985, p. 270. L. VIL-
LEMIN, op. cit., p. 19 estime que, malgr l'existence de travaux de qua-
lit, une tude d'ensemble sur la tradition orientale serait la bienve-
nue .
4. J. GAUDEMET, Pouvoir, p. 84.
5. ID., glise et Cit. Histoire du droit canonique, Paris 1994, p. 481
(dsormais glise).
6. ID, Pouvoir, p. 84-85.
7. ID, glise, p. 481.
8. L. VILLEMIN, op. cit., p. 27-33, qui ajoute (p. 18) que ce qui
importe ici est la distinction des deux concepts, c'est--dire sur leur
bipartition comme axe fondamental d'une argumentation canonique ou
thologique . Il ne s'agit donc pas d'voquer une simple histoire du
pouvoir d'ordre d'un ct, et du pouvoir de juridiction de l'autre.
9. Ibid., p. 70. O. CONDORELLI, Ordinare-Iudicare. Ricerche sulle
potest dei vescovi nella Chiesa antica e altomedievale (secoli II-IX),
Rome, Il Cigno Galileo Galilei, 1997, p. 10, estime que comme l'histo-
riographie la plus avise l'a observ, dans le premier millnaire de
l'glise, une bipartition du pouvoir ecclsiastique en pouvoir d'ordre et
TXpPHUJHODGLVWLQFWLRQRUGUHHWMXULGLFtion comme consti-
WXDQWXQD[HIRQGDPHQWDOGXQHDUJXmentation thologico-
canonique 10.
/XQHGHVFDXVHVGHOpPHUJHQFHGHFHWWHWKpRULHUpVLGDLW
dans la volont des docteurs latins de rsoudre la querelle
des investitures 11&HVW, mutatis mutandis, pour des motifs
semblables prcisment le souhait des autorits ecclsias-
WLTXHVGHPDvWULVHUOHUHFUXWHPHQWGXFOHUJpTXLMXVTXDORUV
leur chappait largement , que dans la seconde moiti du
5e sicle apparaissent DX VHLQ GH OeJOLVH DUPpQLHQQH OHV
SUpPLVVHVGXQHGLVWLQFWLRQHQWUHRUGUHHWMXULGLFWLRQ&HWWH
tentative nous est connue de faon incidente par un passage
GH O+LVWRLUH G$UPpQLH compose vers 490 par le chroni-
queur ecclsiastique Ghazar Parpetsi 12. Certes, la thorie

pouvoir de juridiction tait une ralit vive et oprante, que ce soit dans
diffrents offices ou dans le mme office. Il faut de toute faon attendre
le 12e VLqFOH SRXU TXH FHWWH FRQVFLHQFHSUDWLTXH devienne une cons-
cience rflchie et labore scientifiquement (traduction franaise du
passage en italien par L. VILLEMIN, op. cit., p. 19). Toutefois,
O. CHAPP, Droit canonique, Paris, Dalloz, 1999, (2e d.), p. 195,
affirme qu'antrieurement, en effet, c'est--dire pendant tout le pre-
mier millnaire de l'histoire de l'glise, le pouvoir tait considr
comme parfaitement unitaire et s'obtenait dans sa plnitude au
moment de l'ordination, toujours confre pour un service concret au
sein d'une glise dtermine .
10. L. VILLEMIN, op. cit., p. 110. Plus prcisment, celui-ci (p. 23)
dgage trois phases dans l'histoire de la distinction. Une premire qui
va jusqu'au Dcret de Gratien distingue potestas et executio potestatis ou
usus potestatis. Il ne s'agit pas, dans cet tat de la distinction, propre-
ment parler de deux pouvoirs, mais d'un pouvoir, d'un ct, et de son
exercice, de l'autre. La deuxime phase (seconde moiti du 12e sicle
avec les premiers Dcrtistes) distingue d'abord implicitement deux
pouvoirs : d'un ct ce qui relve de l'ordo et, de l'autre, ce qui appar-
tient ce qu'on appelle frquemment administratio. Enfin, la troisime
phase, avec les Dcrtalistes aboutit la constitution de deux hirar-
chies, une selon l'ordre, l'autre par la juridiction.
11. Ibid., p. 110-112 et infra p. 380.
12. dition de l'ouvrage par G. Ter MKRTCHEAN et S. MALKHA-
SEANTS, Tiflis, 1904 ; traduction anglaise par R. W. THOMSON, The
History of Ghazar Parpetsi, Atlanta, 1991. Ghazar composa une
chronique portant sur l'Armnie du 5e sicle, qu'il offrit au prince
Vahan Mamikonean, alors gouverneur du pays pour le compte du roi
perse. D'origine modeste, Ghazar reut la prtrise et se vit confier par
Vahan qui tait un ami d'enfance , la direction de la maison
en question ne dpassera gure le stade embryonnaire du
IDLWTXHODUpIRUPHTXHOOHVRXV-tendait fera long feu en rai-
VRQ QRWDPPHQWGX FDUDFWqUH LPSpULHX[GHOKpUpGLWpGHOD
clricDWXUHTXLVHPDLQWLHQGUDMXVTXjODILQGX0R\HQJH
Malgr son chec, nous souhaiterions revenir sur cette tho-
rie indite labore par les autorits ecclsiastiques arm-
nienQHVSUqVGHVHSWVLqFOHVDYDQWTXXQHDFWLRQVLPLlaire ne
soit engage et russie en Occident.
Aprs avoir examin le contexte politico-religieux et les
termes prcis dans lesquels la distinction est formule dans
le texte de Ghazar Parpetsi, nous voquerons les causes qui
dterPLQqUHQWODSSDULWLRQSXLV in fine Ochec de cette tho-
rie.

/DGRSWLRQGXFKULVWLDQLVPHFRPPHUHOLJLRQRIILFLHOOHGX
UR\DXPH G$UPpQLH SDU OH URL 7LULGDWH OH *UDQG HQ 
GHX[DQVDYDQWTXLOQHVRLWSURFODPpreligio licita GDQVO(P-
pire romain, fut considr par les Perses sassanides adep-
tes du zoroastrisme comme une forme de dfection 13.
'qVORUVMXVTXjODILQGXe sicle, ces derniers essayrent
plusieurs reprises de dtourner les Armniens du christia-
nisme par des guerres et GHVSHUVpFXWLRQV$SUqVODERlition
GHODUR\DXWpHQ$UPpQLHHQOeJOLVHORFDOHIXWVRXPLVH
la juridiction sculire du roi des rois sassanide auquel
appartenait notamment la ratification du choix du patriar-

religieuse, rattache l'glise patriarcale. Assez rapidement, il entra en


conflit avec les religieux du lieu pour diffrents motifs plus ou moins
srieux. En ralit, ce litige traduisait une opposition entre le mona-
chisme de type hellnisant prn par Ghazar et celui, ptri de traditions
syriennes, de ses adversaires, cf. A. et J.-P. MAH, Grgoire de Narek,
Tragdie Matean Okhbergutean : le Livre de Lamentation, Louvain,
CSCO 584, Subsidia 106, 2000, p. 18-22 et A. MARDIROSSIAN, Le
Livre des canons armniens de Yovhannes Audznetsi. glise, droit et socit
en Armnie du IVe au VIIIe sicle, Louvain, CSCO 606, Subsidia 116,
2004, p. 145 n. 22, 189, 356-357 (dsormais Le Livre).
13. Sur la date et les motifs de la christianisation de l'Armnie, cf.
A. MARDIROSSIAN, Le synode de Vagharshapat (491) et la date de la
conversion au christianisme du royaume de Grande Armnie (311) ,
Revue des tudes armniennes, nouvelle srie 28, 2001-2002, p. 249-260.
che 14 (Q  OpOHFWLRQ GH *LXW ,er Arahezatsi comme
patriarche par un synode gnral armnien fut conteste
par la cour sassanide 15. Finalement Giut fut exil en 471 et
VRQ VLqJH GHPHXUD YDFDQW MXVTXj VD PRUW HQ  16.
/KRVWLOLWp GX URL GHV URLV 3HUR] pWDLW FHUWDLQHPHQW PRWLYp
par les pourparlers secrets engags par le patriarche avec
OHPSHUHXU E\]DQWLQ /pRQ ,er 17 &HVW j FHWWH RFFDVLRQ TXH

14. N. GARSOAN, Secular Juridiction over the Armenian Church


(Fourth-Seventh Centuries) , Okeanos. Essays Presented to Ihor Shevcen-
ko on his Sixtienth Birthday = Harvard Ukrainian Studies, 7, 1984, p.
220-250 [Rimpr. dans EAD. Armenia between Byzantium and the Sasa-
nians, Londres, 1985, IX]. Jusqu'au dbut du 6e sicle, le chef de l'glise
armnienne portait le titre de patriarche. Par la suite, il est commun-
ment appel catholicos, cf. J.-P. Mah, Le rle et la fonction du catho-
licos d'Armnie du 7e au 11e sicle , Des Parthes au Califat. Quatre
leons sur la formation de l'identit armnienne , Paris 1997, p. 81 n. 8
(dsormais Le rle) et N. GARSOAN, L'Armnie , Histoire du christia-
nisme. III. Les glises d'Orient et d'Occident (432-610), sous la direction
de L. PIETRI, 1998, p. 1130 n. 20.
15. Jusqu'en 438, le patriarcat fut concd titre hrditaire la
famille de Grgoire l'Illuminateur, premier chef de l'glise armnienne
aprs la conversion du pays. Toutefois, les interventions de la royaut,
puis aprs son abolition, du roi des rois perse, imposrent en diverses
circonstances des prlats trangers la famille de saint Grgoire. Pres-
que tous taient de la ligne d'Aghbianos, ancien vque de la cour
arsacide au dbut du 4e sicle. Lorsque Sahak le Parthe, dernier descen-
dant de Grgoire l'Illuminateur, s'teignit en 438 sans avoir eu de fils,
ses disciples et partisans souhaitrent rendre le patriarcat lectif.
l'inverse, les Perses prfraient maintenir le principe d'hrdit au profit
de la seconde famille sacerdotale du pays, celle des descendants d'Agh-
bianos. Le 24 juin 444, profitant de la runion annuelle Shahapivan,
ancien camp royal, les autorits ecclsiastiques et sculires locales li-
rent patriarche Yovsep Ier, disciple de Sahak le Parthe. Mais ce coup de
force ne fut jamais reconnu par la cour sassanide. Finalement Yovsep
fut exil (452) puis martyris (454) par les Perses qui imposrent sur le
trne patriarcal deux descendants de la famille d'Aghbianos, Melite Ier
(452-456), puis Movses Ier (456-461). Sur les modalits d'accession au
patriarcat, cf. A. MARDIROSSIAN, Le Livre, p. 146-149.
16. M. ORMANEAN, Azgapatum (Histoire nationale), Beyrouth
1959, vol. I, 1, col. 417-452 [1re d. Constantinople 1912]. L'action de
Peroz constituait la dernire tentative perse pour imposer un patriarcat
hrditaire. Dsormais tous les successeurs de Giut sont lus, mais sous
la surveillance de la cour sassanide ou de son reprsentant en Armnie
qui doit approuver cette lection, J.-P. MAH, Le rle, p. 83.
17. Giut lui-mme ne cache pas ses liens troits avec le monde
byzantin: J'ai suivi mes tudes de littrature et de philosophie au pays
OKLVtorien Ghazar Parpetsi prtend rapporter un change
entre Giut et Peroz par messager royal interpos :
Le roi envoya dire au bienheureux catholicos Giut :
-XVTXjSUpVHQWWXDVH[HUFpWDjuridiction (zishkhanutiund)
VDQVPRQRUGUHHWFHX[TXLWRQWDFFRUGpXQHDXVVLJUDQGH
fonction (gorts VRQW>PHV@VHUYLWHXUVHWWXQDVUHoXDXFXQH
confirmation de moi. Mais si maintenant tu accomplis ma
volont, si tu adoptes ma religion, si tu adores le soleil, je te
confrerai cette fonction (zgortsotsd) perptuit, par un
dcret imprial, toi, ta famille, ou quiconque tu dsire-
ras. Et ainsi je te renverrai avec honneur en Armnie, tu
bnficieras GXQKRQQHXUHWGXQHVSOHQGHXUWHOVTXDXFXQ
$UPpQLHQQDMDPDLVREWHQXGHQRWUHFRXU0DLVVLWREVti-
QDQWWXUHIXVHVGDFFRPSOLUPDYRORQWpMHWHQOqYHUDLOpis-
copat (zepiskoposutiund), je te retirerai tes fonctions (zgort-
sotsd), et tu retourneras dans ta maison et ton pays [dans] le
dsKRQQHXUHWOLJQRPLQLH
/HELHQKHXUHX[KRPPHGH'LHX*LXWFDWKROLFRVG$U-
mnie, rempli du pouvoir du Saint-Esprit, dit au messager
royal   'LVDXURLTXHQFHTXLFRQFHUQHOHVfonctions
(zgortsoys), dont tu dis que je les tiens de tes serviteurs et
non de toi-PrPH VL WRL RX QLPSRUWH OHTXHO GH WHV VHUYL-
WHXUVTXLPHOHVDYDLWGRQQpHPHO{WDLWMHPHUpMRXLrais et
je le dsire, car dlivr des tourments et des troubles de ce
monde, je me vouerai moi-mme et la prire. Quant
Oordination piscopale (episkoposakan dzernadruteans) que
WX GLV TXH WX P{WHUDVOD dignit de cette ordination (dzer-
nadrutean pativ FpOHVWHQHSHXWPrWUH{WpHQLSDUOHVURLV
ni par aucun prince, ni mrPH SDU OD PRUW FDU HOOH QHQ D
pas le pouvoir. Et je ne crains nullement un homme mortel
>TXLQH SHXW@QLPDFFRUGHUFHWWH dignit (zpativs) ni me la
UHWLUHU  18.

des Romains, j'ai l-bas de nombreuses connaissances et amis. Mme la


matire de vtement que nous portons, nous l'achetons l-bas, car il ne
s'en trouve dans aucun autre pays, hormis celui-l, c'est pourquoi nous
sommes obligs d'acheter l-bas ce dont nous avons besoin , Ghazar
PARPETSI, III, 64, p. 114 ; R. W. THOMSON, op. cit., p. 166. Plus
gnralement sur cette priode, cf. C. SANSPEUR, L'Armnie l'po-
que de Peroz , Revue des tudes armniennes, nouvelle srie 12, 1975-
1976, p. 83-172.
18. Ghazar PARPETSI, III, 64, p. 114-115 ; notre traduction.
6LODXWKHQWLFLWpGHFHGLDORJXHUDSSRUWpSDU*KD]DU3DU-
petsi est difficile vrifLHU XQH WHOOH LQFHUWLWXGH QHQOqYH
ULHQDXIDLWTXLOQDSXLQYHQWHUGHWRXWHSLqFHODWKpRULH
exprime dans son rcit. Elle devait constituer un courant
dvelopp dans les milieux ecclsiastiques armniens de la
fin du 5e sicle, peut-rWUHjOLQLWLDWLve de Giut.
,O UHVVRUW GH FH WH[WH TXH GHX[ FRXSOHV GH PRWV VRSpo-
VHQW 'XQ F{Wp juridiction (ishkhanutiun) 19 et fonc-
tion (gorts) 20 TXL UHQYRLHQW DX SDWULDUFDW HW GXQ DXWUH
ordination (piscopale) (dzernadrutiun) 21 et dignit
(pativ) 22 TXL YLVHQW OpSLVFRSDW 3DU FRQVpTXHQW LO H[LVWH
GXQH SDUW OD IRQFWLRQ SDWULDUFDOH TXL HVW RFWUR\pH SDU XQ
pouYRLU KXPDLQ HQ ORFFXUUHQFH OH URL GHV URLV ou ses
reprsentants sur le fondement de la juridiction sculire
que celui-FL SRVVqGH VXU OeJOLVH DUPpQLHQQH. Giut lui-
mme, dans un autre passage de la chronique de Ghazar,
reconnat le pouvoir sculier de Peroz sur cette dernire et
SOXV JpQpUDOHPHQW WRXWH O$UPpQLH HQ VH UpIpUDQW DX SUp-
cepte no-testamentaire qui ordonne chaque serviteur
GREpLU j VRQ PDvWUH 23. Le patriarcat reprsente donc un

19. Ishkhanutiun drive de l'iranien *khshana-, cf. N. GARSOAN,


The Epic Histories Attributed to Pawstos Buzand, HATS 8 Cambridge,
Ma [Trad. anglaise], p. 533-534 (dsormais EH). Ce terme peut revtir
diffrentes acceptions en latin : principatus, potestas, regimen, dominium,
dignitas, auctoritas, paroecia/parrochia, Nouveau dictionnaire de la langue
armnienne, ds. G. AWETIKEAN, Kh. SIWRMELEAN, 2 vol., Venise
1836-1837, I, p. 865-866 (dsormais NDLA).
20. Gorts, gr. ergon, lat. officium, cf. N. GARSOAN, EH, p. 527-
528. Suivant le contexte, ce terme peut aussi signifier opus, operatio, fac-
tum, actus, actio, factura, negotium, res, acta, NDLA, I, p. 573-574.
21. Dzernadrutiun, litt. imposition des mains , gr. cheirotonia,
epithesis tn cheirn, cheirothesia, cheirepithesia, lat. impositio ma-
nuum, ordinatio, designatio, creatio, NDLA, II, p. 152; Dictionnaire ty-
mologique de l'armnien, d. H. ACHARYAN, 4 vol., rvan, 1971-1979,
III, p. 410 ; Dictionnaire explicatif de l'armnien, d. S. Malkhaseants, 4
vol., rvan, 1944-,,,S/HWH[WHPHQWLRQQHpJDOHPHQWOH[-
pression piscopat (episkoposutiun).
22. Pativ, mot d'emprunt iranien, cf. aussi la version sogdienne, N.
GARSOAN, EH, p. 552. Outre dignitas, badiv veut dire honor, donum,
praemium, donarium sacrum, NDLA, II, p. 610-611.
23. Mais notre propre religion nous commande d'obir docilement
nos matres pour les [affaires] pour lesquelles cela est convenable et
juste , Ghazar PARPETSI, III, 64 ; R. W. THOMSON, op. cit., p. 166.
S'agissant du Nouveau Testament, voir Ep 6,5 ; Col 3,22 ; 1 P 2,17.
office administratif que le pouvoir sculier peut attribuer
RX UHWLUHU HQ IRQFWLRQ GH VHV LQWpUrWV 'DXWUH SDUW LO \ D
OpSLVFRSDW TXL XQH IRLV FRQIpUp QH SHXW SOXV rWUH UHWLUp
son titulaire par aucun pouvoir humain, et ni mme par la
PRUW /H WH[WH QH OH GLW SDV PDLV ELHQ pYLGHPPHQW FHVW
thoULTXHPHQW OeJOLVH SDU OLQWHUPpGLDLUH GH VRQ FKHI OH
patriarche, qui pouvait seule ordonner les vques 24. Ds
lors, la rponse de Giut se termine par une rflexion qui,
HQ MXJHU SDU OH WRQ QH SHXW rWUH TXH OH IUXLWGHOLPDgina-
tion de Ghazar Parpetsi : il ne peut tre question pour le
patriarche de craindre un quelconque mortel, fut-il le roi
des rois, car pas mme ce dernier ne peut ni accorder ni
retirer la dignit GHOpSLVFRSDW/HYRFDEXODLUHXWLOLVpSDU
Gha]DUPRQWUHGRQFWUqVFODLUHPHQWTXjXQHVLPSOHFKDUJH
admiQLVWUDWLYHVRSSRVHXQHIRQFWLRQSRVVpGDQWXQHGLmen-
sion sacramentelle.
Cette distinction est confirme par le rituel accompa-
JQDQW ODFFHVVLRQ DX SDWULDUFDW -XVTXDX e sicle, il ne
semEOHSDVH[LVWHUGHULWHVSpFLILTXHSRXUOLQWURQLVDWLRQGX
patriarche 25. Le terme dzernadrutiun ordination (litt.
imposition des mains  QHVW HPSOR\p TXH GDQV OK\SR-
WKqVHRORQFRQIpUDLWOpSLVFRSDWjXQODwFRXjXQFOHUFGH
UDQJ LQIpULHXU DILQ TXLO SXLVVH DFFpGHU DX SDWULDUFDW En
revanche, lorsque le candidat choisi ou lu tait dj v-
TXH DXFXQ ULWH VSpFLILTXH QHVW PHQWLRQQp 26. Un rite
GRUGLQDWLRQ SURSUH DX FDWKROLFRV GLIIpUHQW GH FHOXL GHV
pYrTXHVQHVHPEOHDSSDUDvWUHTXDXe sicle 27.

24. Sur les modalits concrtes d'accession l'piscopat dans l'glise


armnienne, cf. infra p. 381-385.
25. Ch. RENOUX, L'ordination du catholicos armnien , dans
A. M. TRIACA, A. PISTOIA, (d.) Ordination et ministres (Confrences
Saint-Serge, 42e semaine d'tudes liturgiques), Rome 1997, p. 247-274
indique (p. 250) qu'une recherche plus exhaustive que celle prsente
LFL FHVW--dire son article) devrait permettre d'affiner ces constatations
sur l'absence d'un rite jusqu'au 10e sicle. Nous les pensons assures
cependant en raison de l'inexistence, la mme poque, d'un rite ana-
logue dans le monde byzantin .
26. Encore au 9e sicle, tzernatrutiun n'est signal que pour deux
catholicos, Zakaria Ier (855-877) et Georg II (878-898) : le premier tait
un lac et le second n'tait pas vque, voir M. ORMANEAN, op. cit.,
vol. I, 2, col. 949-950, 981-983.
27. Ce rite connu par des manuscrits du 14e sicle est encore en
vigueur dans l'glise armnienne. Il se droule en deux temps : l'lec-
&HUWHVOH[WUDLWFLWpSDU*KD]DU3DUSHWVLQHIRUPXOHSDV
de faon exclusive et explicite la distinction entre ordre et
juridiction. Ainsi, ce sont deux sries de deux termes qui
VRSposent indistinctement 28. De plus, le mot ordre , en
armnien karg QDSSDUDvW SDV 29. Toutefois, le vocable
ordination (dzernadrutiun) renvoie la mme ide et
insiste peut-tre mme davantage sur la dimension sacra-
menWHOOHGHOpSLVFRSDWSDURSSRVLWLRQjODVSHFWDGPLQLVWUD-
tif du patriarcat qui reprsente une juridiction (gorts). En
outre, le texte armnien exprime avant tout une distinction
entre le temporel et le spirituel, qui la mme poque est
exprime de faon tranchante par le pape Glase Ier (492-
494) en Occident 30. Puisant dans le droit romain, Glase

tion du catholicos, puis l'ordination, Ch. RENOUX, op. cit., p. 254-274.


Ce n'est qu' l'occasion du conflit entre le catholicos Anania Mokatsi
(943-967) et l'vque Khosrov Andzevatsi que les sources attestent de
l'existence d'un rite d'accession spcifique au catholicossat. Dans deux
de ses lettres adresses son adversaire, Anania dplore que celui-ci
enseignait que patriarche et vque ont mme honneur et mme
dignit , et TX
LOQDSDVpWpLQVWLWXpSRXUOHSDWULDUFDWXQHRUGLQDWLRQ
diffrente (de celle de l'piscopat), mais c'est la mme dignit qui est
rpte . Malheureusement, il n'existe aucun tmoin manuscrit de
cette poque. Au 10e et au 11e sicle, ce rite catholicossal est appel
ordination (dzernadrutiun), par les sources armniennes, pour les
successeurs d'Anania Mokatsi qui taient vques avant de devenir
catholicos, ibid., p. 250-251. L'absence de rite spcifique avant le 10 e
sicle ne diminuait en rien le prestige de la fonction patriarcale ds ses
dbuts. La prsomption d'lection divine qui s'y attachait et le pouvoir
de consacrer de nouveaux vques garantissaient au catholicos un trs
haut niveau d'autorit, mme s'il tait contraint une certaine collgia-
lit. Mieux, ds le 5e sicle, aprs l'abolition de la royaut, le patriarche
reste la seule institution stable, le seul reprsentant permanent de la
nation entire, J.-P. MAH, Le rle, p. 79, 90.
28. Le texte mentionne les diffrents termes ainsi : juridiction ,
fonction (deux fois), piscopat , fonctions (au pluriel, deux
fois), ordination piscopale , dignit , ordination , dignit .
Bien videmment, dans le dialogue, Ghazar ne prte la distinction entre
les deux catgories de pouvoirs qu'au patriarche Giut.
29. Karg, cf. NDLA, I, p. 1065. De mme, on ne retrouve pas le
terme pouvoir associ ordre et/ou juridiction. Mais en armnien
classique, ishkhanutiun dans une acception juridique peut aussi bien
vouloir dire juridiction que pouvoir , cf. supra n. 19.
30. La pense de Glase qui a fait l'objet de discussions animes
parmi les historiens s'exprime ici travers deux textes. Le premier est
une lettre adresse en 494 l'empereur Byzantin Anastase (491-518). Le
second est extrait du trait De anathematis vinculo, cf. Y. SASSIER,
GLVWLQJXHOauctoritas des papes de la potestas des rois. Cette
thorie confre une dsignation juridique un magistre
spiriWXHO GH OeJOLVH VXU OHV URLV WRXW HQ GLVSRVDQW TXH OH
pouvoir sculier ne peut prtendre assumer les responsabili-
WpV D\DQW WUDLW j Ointerius GH OeJOLVH 31 0DLV FRPPH ORE-
serve trs justement L. Villemin, ELHQTXHOOHV OHVWKpRULHV
dveloppes autour de la distinction entre temporel et spiri-
tuel) ne recoupent jamais exactement cette deuxime dis-
tinction (entre ordre et juridiction), elles ont tout de mme
favoULVp OH GpYHORSSHPHQW GXQ FRXUDQW LQWHOOHFWXHO com-
plexe il est vrai, qui cesse de concevoir le pouvoir dans
OeJOLVHGHPDQLqUHXQLILpHSRXUHQGpJDJHUGHVFRPposan-
tes varies. Il nous semble que cette pratique participe de la
mme epistm que celle qui donnera naissance la distinc-
WLRQHQWUHRUGUHHWMXULGLFWLRQHWTXHOle aide la compren-
dre 32.
3OXV WDUG OHQVHPEOH GH FH PRXYHPHQW VH[SOLTXH HQ
partie par la volont des autorits religieuses de rsoudre la
querelle des InvesWLWXUHV&HVWGDQVFHFRQWH[WHTX,YHVGH
Chartres, notamment 33, procde la distinction entre la
conscration pisFRSDOHTXLVDFFRPSDJQHGHODcura anima-
rum HW OLQvestiture du temporel 34. Hugues de Fleury

Royaut et idologie au Moyen ge, Paris, Armand Colin, 2002, p. 59-61,


qui, concernant la lettre Anastase, renvoie au travail de A. COT-
TRELL, Auctoritas and Potestas : A Reevaluation of the Correspon-
dance of Gelasius I on Papal Imperial Relations , Medieval studies
1993, p. 93-109. Pour une tude de la docrine glasienne sur la plus
longue dure, cf. R. BENSON, The Gelasian Doctrine : Uses and
Transformations , La notion d'autorit au Moyen ge. Islam, Byzance,
Occident. Colloques internationaux de la Napoule, 1982, p. 13-44. On
ne peut manquer d'observer que la lettre de Glase au basileus est con-
temporaine de l'Histoire de Ghazar. Toutefois, en dpit de l'admiration
de ce dernier pour la littrature byzantine, il n'existe aucune preuve
pour affirmer que Ghazar ait pu accder la traduction grecque du
texte de Glase. En outre, il est fort possible que l'ouvrage de l'historien
armnien ait t achev avant 494.
31. Y. SASSIER, op. cit., p. 61.
32. L. VILLEMIN, op. cit., p. 110.
33. M. PARISSE, Les pouvoirs chrtiens face l'glise. La querelle
des investitures et ses aboutissements , dans Histoire du Christianisme,
t. V, Apoge de la papaut et expansion de la chrtient , p. 107-110.
34. En outre, la distinction qui apparat aux 11e-12e sicles entre
autel et glise paroissiale constitue un moyen pour les vques d'assurer
plus fermement leur pouvoir, cf. M. PARISSE, op. cit., p. 110 ; J.-F.
VDWtela la symbolisation de cette thorie en prsentant
ODQneau et la crosse comme les manifestations visibles de la
conscration ecclVLDVWLTXHDORUVTXXQDXWUHV\PEROHFRQV-
tiWXDLW OLQYHVtiture sculire 35 'DERUG pFDUWpH SDU 5RPH
la thoULH G,YHV GH &KDUWUHV GHYLQW ILQDOHPHQW OH IRQGH-
ment du concordat de Worms de 1122 qui dissociera nette-
ment le pouvoir spirituel et les regalia 36.
&HVW SRXU GHV PRWLIV WUqV YRLVLQV TXH Oglise arm-
nienne avait cherch, dans la seconde moiti du 5e sicle,
distinguer entre ordination et juridiction . Plus prci-
sment, cette thorie tait destine contrer le principe
hrGLWDLUH TXL UpJLVVDLW DORUV PDMRULWDLUHPHQW ODFFHVVLRQ
aux ordres majeurs en ne concdant aux autorits ecclsias-
tiTXHV TXXQH IDLEOH PDvWULVH VXU OH UHFUXWHPHQW GH VHV
cadres.

RevenRQVXQLQVWDQWVXUOHVRULJLQHVGHOH[LVWHQFHGXQ
FOHUJp KpUpGLWDLUH GDQV OeJOLVH DUPpQLHQQH /D FRQYHUVLRQ
GHO$UPpQLHDXFKULVWLDQLVPHQDYDLWSDVHQWUDvQpHGHSUR-
fondes remises en cause ni de rorganisation complte des
structures. Bien au contraLUHLODSSDUDvWTXHODFWLRQSROLWL-

LEMARIGNIER, La France mdivale. Institution et socit , Paris 2000 (2


d.), p. 194 et surtout M. PACAUT, L'Investiture en France au dbut
du 12e sicle , tudes d'histoire du droit canonique ddies Gabriel Le
Bras, I, Paris 1965, p. 665-672.
35. HUGUES DE FLEURY, Tractatus de regia potestate et sacerdotali
dignitate, MGH Libelli de lite, t. 2, 1892, p. 465-494 ; cf. Y. SASSIER,
op. cit., p. 274-276. L'anneau et la crosse n'taient pas des symboles nou-
veaux, mais jusqu'alors, ils taient justement remis par l'autorit scu-
lire au nouvel vque avant que celui-ci ne se voit confrer la conscra-
tion par l'archevque.
36. Peu avant, Grgoire VII avait repris de faon particulirement
extensive en faveur de la papaut la distinction opre par Glase
entre auctoritas et potestas dans le Dictatus papae L. VILLEMIN, op. cit.,
p. 110-112 et n. 4 pour une bibliographie sur la question. Sur Grgoire
VII et son action, cf. H. X. ARQUILLIRE, Saint Grgoire VII. Essai sur
sa conception du pouvoir pontifical, Paris 1934 ; G. MICCOLI, Chiesa
Gregoriana. Ricerche sulla riforma del secolo XI, Florence 1966 ; I. S.
ROBINSON, Pope Gregory VII (1073-1085) , The Journal of Ecclesias-
tical History, 1985, p. 439-483 ; G. FORNASARI, Medioevo riformato del
secolo XI, Naples 1996.
TXH GH 7LULGDWH OH *UDQG HW OHIIRUW SDVWRUDO GH *UpJRLUH
O,OOXminateur aient essentiellement vis substituer le
christianisme au mazdisme en modifiant le moins possible
ORUGUHGHODVRFLpWpRXGHOeWDW 37. Cet ordre tait principa-
OHPHQWIRQGpVXUOKpUpGLWpHWOHV\VWqPHGHFODVVHUpSDUWLV-
sant les individus entre les non-nobles (ramik ou shinakan),
les nobles (azat) et les princes et dynastes (ishkhan et nakha-
rar). Ces derniers possdaient de faon hrditaire et inali-
nable les terres et offices du royaume 38. Or cette organisa-
tion ne fut pas remise en cause par le christianisme. Ainsi,
OHFOHUJpQHIRUPHSDVXQHFODVVHGLVWLQFWHPDLVVLQWqJUHDX[
GHX[ FODVVHV VXSpULHXUHV HW HQ SULQFLSH j OHQVHPEOH GHV
offices hrditaires. De mme, le patriarche est un prince
comme la plupart des vques 39 $X[ FKDUJHV TXLOV H[HU-
FHQWVRQWOLpVGHVELHQVIRQFLHUVTXLOVWUDQVPHWWHQWjOHXUV
descendants en mme temps que le sacerdoce. Il y a ainsi de
vritables familles sacerdotales 40.
Le synode de Shahapivan en 444 ne se borna pas lire
<RYVHS FRPPH SDWULDUFKH GH OeJOLVH DUPpQLHQQH 41. Cette
DVVHPEOpHDOODLWHQIDLWVHUpYpOHUFRPPHODFWHIRQGDWHXUGX
droit canonique armnien. En outre, le synode de Shahapi-

37. Seules certaines pratiques totalement incompatibles avec le


christianisme semble avoir t combattues, cf. A. MARDIROSSIAN, Le
Livre, p. 71-100.
38. Cette structure politique qu'il ne faut pas confondre avec la
fodalit occupe une place intermdiaire entre une socit clanique et
un tat centralis, cf. C. TOUMANOFF, Studies in Christian Caucasian
History, Georgetown 1963, p. 33-144.
39. Les contours des diocses correspondent presque toujours
ceux des principauts dynastiques. En outre, les autres membres du
clerg bnficient d'une immunit fiscale.
40. L'existence d'un tel type de clerg est due aux circonstances de
son apparition. Comme on l'a vu prcdemment, le patriarche prend la
place du chef des mages. De la mme faon, les autres membres de la
hirarchie ecclsiastique hritent des biens et des droits des sanctuaires
et des ministres de l'ancien culte. Toutefois, afin d'viter qu'une telle
mesure ne soit assimile une dpossession sommaire qui dboucherait
immanquablement sur un engrenage de vengeance entre les clans des
prtres paens (kurm) et ceux des membres du clerg chrtien, Grgoire
l'Illuminateur dcida d'lever systmatiquement les enfants des kurm
dans la foi chrtienne pour les prparer succder leurs parents
comme prtres du vrai Dieu .
41. Cf. supra n. 15.
van prsHQWH GXQH FHUWDLQH IDoRQ OH SDUDGR[H GrWUH j OD
fois le plus ancien, mais aussi le plus ambitieux et le plus
QRYDWHXUGHVFRQFLOHVDUPpQLHQVMXVTXjQRVMRXUV 42. Ainsi,
LO SURFODPH XQ GURLW GDFFqV pJDO j OD FOpULFDWXUH HQ VXERU-
donnant le recrutement des nouveaux clercs deux princi-
pes : le choix selon le mrite et le contrle des dcisions
tous les chelons 43/HQVHPEOHGHODUpIRUPHPLVHHQSODFH
par les pres de Shahapivan aboutit ce que dsormais
mme un homme de basse origine puisse accder des
ministres et des offices ecclsiastiques qui le transfrent
immdiatement de la classe des non-nobles celle des azat
ou mme des dynastes. Cela signifie que le fils ou le parent
GXQFOHUFQDSOXVODVVXUDQFHGHOXLVXFFpGHUDXFDVRXQ
candidat plus digne ou mritant se prsenterait face lui.
&HWWH PHVXUH UpYROXWLRQQDLUH GRXYHUWXUH GX FOHUJp j OHQ-
semble des classes ne manqua pas de susciter de vives rsis-
tances parmi les autorits sculires du pays. Passant outre
le systme traditionnel des trois classes, la rforme de Sha-
hapiYDQQH SRXYDLWjWHUPH TXDERXWLU DXGpSDVVHPHQWGH
celui-FLSDU XQQRXYHORUGUH VRFLDOGRQWOD[HFHQWUDOVHUDLW
le clivage entre clercs et lacs. En outre, la majeure partie
des familles sacerdotales ne pRXYDLWTXHVLQTXLpWHUGHOLQV-
tiWXWLRQ GXQH FRQFXUUHQFH TXL PHQDoDLW OHXUV GURLWV KpUp-
ditaires 44.
Force est de constater que la rforme entreprise en 444
QH SXW VDSSOLTXHU LQWpJUDOHPHQW HW GXUDEOHPHQW (Q
dehors des rsistances mentionnes prcdemment, il faut
rappeler que dans les annes qui suivirent le synode de Sha-
haSLYDQODVLWXDWLRQGHOeJOLVHDUPpQLHQQHGHYLQWGUDmati-
que. 3URPRWHXUGXQHSROLWLTXHUHOLJLHXVHLQWROprante, le roi
des rois Yazdgert II (438- GpFLGDGLPSRVHUSDUOa force
OH ]RURDVWULVPH j WRXWH O$UPpQLH $SUqV ELHQ GHV KpVLWD-

42. Les 20 (15) dispositions labores par le synode de Shahapivan


FRQVWLWXHQWOHFXU GXGURLWFDQRQLTXH,OV
DJLWG
XQYpULtable concile
de Nice pour l'glise armnienne.
43. Canon 16 du synode de Shahapivan, cf. A. MARDIROSSIAN, Le
Livre, p. 142-159.
44. Elles risquaient de se retrouver mutatis mutandis dans la situa-
tion qu'elles avaient connue l'poque de la christianisation du pays
par Tiridate et Grgoire l'Illuminateur, quand la caste sacerdotale maz-
denne avait t prive de ses fonctions et de ses privilges.
tions une bonne partie des dynastes locaux mens par le
gnral en chef Vardan Mamikonean, et soutenus par le
clerJpOLYUDXQHWHUULEOHEDWDLOOHGDQVODSODLQHG$YDUD\UHQ
mai 451. Bien que vainqueurs, les Perses renoncrent,
devant la rsistance rencontre, poursuivre leur politique
GHFRQYHUVLRQIRUFpH0DOJUpWRXWOeJOLVHDUPpQLHQQHVRU-
tit particulirement affaiblie de ces vnements. De plus, la
cour sassanide imposa successivement sur le trne patriarcal
entre 452 et 461 deux prlats, descendants de la famille
G$JKELDQRV WUDGLWLRQQHOOHPHQW LUDQRSKLOH /H FXPXO GH
ces facteurs ne pouvait que rendre encore plus difficile la
PLVHHQXYUHGHODUpIRUPHSURMHWpHj6KDKDSLYDQ
InstruiW SDU OpFKHF GH OD UpIRUPH OH SDWULDUFKH *LXW HW
plus gnralement les autorits religieuses armniennes de
la seconde moiti du 5e optrent pour une autre politique
afin de reprendre le contrle du recrutement des clercs. Il
VDJLVVDLW GH GLVWLQJXHU GpVormais au sein des offices eccl-
siastiques entre ce qui relevait de ORUGLQDWLRQ et ce qui
appartenait la juridiction , entre le temporel et le spiri-
WXHO&HUWHVFHVWVHXOHPHQWjSURSRVGXSDWULDUFKHTXHOH
texte de Ghazar Parpetsi diffrenciait ces deux dimensions.
Mais au-GHOj GX FKHI GH OeJOLVH DUPpQLHQQH ODSSOLFDWLRQ
de cette distinction tous les ordres majeurs aurait permis
au patriarcat de reprendre, au moins partiellement, en
main le recrutement des vques et des prtres, tout en
concdant aux familles dynastiques et nobles un rle dans
ce domaine.
On ignore les modalits prcises suivant lesquelles ce
partage des comptences entre les autorits ecclsiasti-
ques et sculires se serait concrtis 45. Mais mme en pre-
nant la prcaution de ne pas heurter de front le principe de
OKpUpGLWpGXFOHUJpHWOHV\VWqPHGHVFODVVHVODUpIRUPHLQL-
tie par Giut ne connt gure de succs. Elle contestait en
effet des structures politiques et sociales qui taient trop
profondment ancres dans le pays 46. Et au dbut du 8e si-

45. Aurait-on assist, par exemple, la symbolisation de la nouvelle


thorie par diffrents objets comme ce sera le cas en Occident pour les
vques notamment l'initiative d'Hugues de Fleury avec l'anneau
et la crosse qui taient confrs l'occasion de l'investiture ecclsiasti-
que ?
46. Au dbut du 7e sicle, le docteur julianiste Jean de Mayragom
(Yovhannes Mayragometsi) s'attaquera avec force l'hrdit du clerg
FOHOHFDWKROLFRV-HDQG2G]XQ <RYKDQQHV$XG]QHWVL-
728), rdacteur de la compilation canonique officielle de
OeJOLVH DUPpQLHQQH OpJLWLPH OH SULQFLSH GKpUpGLWp ORUV-
TXLO UpSOLTXH DYHF YLJXHXU DX[FULWLTXHV formules en 692
par le concile in Trullo sur cet aspect des pratiques ecclsias-
tiques armniennes 47.
,QDSSOLFDEOHVXUOHWHUUDLQODWKpRULHGpYHORSSpHjOpSR-
que de Giut resta un stade embryonnaire et disparut rapi-
dement du dbat religieux. Ironie GH OKLVWRLUH FHVW DX
moment o la distinction entre ordre et juridiction apparat
DYHF IRUFH HQ 2FFLGHQW TXHQ $UPpQLH OHVVWUXFWXUHV SROL-
tico-sociales traditionnelles qui avaient empch le dvelop-
pePHQWGHVSUpPLVVHVGXQHWHOOHWKpRULHSUqVGHsept sicles
SOXV W{W ILQLVVHQW SDU VHIIRQGUHU GX IDLW GH OpOLmination
totale des familles de princes et de dynastes. Mais il tait
trop tard.

Aram MARDIROSSIAN
Universit de Paris X - Nanterre

sans jamais toutefois faire rfrence une quelconque distinction entre


ordination et juridiction, cf. A. MARDIROSSIAN, Le Livre, p. 328-352.
47. Le canon 8 du synode de Duin, runi par le catholicos en 719,
dclare qu'il convient selon la rgle des Lvites de recevoir titre
hrditaire la grce de l'glise . Les temps avaient chang. Contraire-
ment aux pres de Shahapivan, qui reprsentaient une glise aux abois
recherchant ardemment la communion avec l'glise grecque, le catholi-
cos Jean d'Otsun est le chef d'une institution fermement tablie, con-
cordataire avec le califat omeyyade et prmunie par les armes arabes
contre toute intrusion byzantine. En outre, promoteur d'une politique
antichalcdonienne de rupture avec l'empire byzantin, Jean d'Odzun
milite pour la prservation des particularismes de l'organisation eccl-
siastique armnienne dont l'hrdit du sacerdoce constitue un des
lments les plus notables, cf. A. MARDIROSSIAN, Le Livre, p. 353-
354.
E
N 1999, LA CONGRGATION pour la doctrine de
la foi publiait La Pastorale des divorcs rema-
ris 1 XQ UHFXHLO GH GRFXPHQWV GpWXGHV HW GH
commentaireV SUpFpGpV GXQH LQWURGXFWLRQ VLJQpH SDU OH
cardinal Joseph Ratzinger, auMRXUGKXLSDSH%HQRvW;9,
Dans cette introduction, le cardinal Ratzinger rsume en
huit thses ( II, n1 8) le contenu essentiel de la doctrine
catholique relative la situation des fidles divorcs remaris
GDQVOeJOLVH1RXVQRXV proposons de prsenter et de com-
menWHU FHV WKqVHV HQ H[DPLQDQW SRXU FKDFXQH GHOOHV OHXU
contenu et leurs implications, mais aussi en laissant merger
OHVLQWHUURJDWLRQVTXHOOHVVRXOqYHQW du triple point de vue de
la thologie, du droit et de la pastorale.
Les huit thses abordent successivement quatre thmes
qui constitueront nos quatre parties : la situation ecclsiale
des fidles divorcs remaris (thses 1 et 2), la proposition
de partLFLSDWLRQDFWLYHjODYLHGHOeJOLVH WKqses 3 5), les
voies de rgularisation possible de leur situation (thses 6 et
 HWHQILQODTXHVWLRQGHODYHQLU WKqVH 

1. CONGRGATION POUR LA DOCTRINE DE LA FOI, La Pastorale des


divorcs remaris, Paris, Cerf, 1999.
La question de la situation ecclsiale des fidles divorcs
remaris pourrait tre rapporte cette interrogation plus
gnrale que Xavier Lacroix formulait ainsi, dans un ouvrage
paru deux ans aprs la publication du document de la Congr-
gation pour la doctrine de la foi : comment tmoigner la
IRLV GH OD QRUPH XQLYHUVHOOH HW GH ODWWHQWLRQ DX[ VLWXDtions
particulires, aux personnes singulires ? . Ce sujet est un
lieu sensible de confrontation entre glise et modernit, entre
discipline ecclsiale et volution des mentalits. Il est aussi un
enjeu interconfessionnel 2.
Il semble bien que nous puissions lire en filigrane des
deux premires thses du cardinal Ratzinger une tentative
GH[primer la fois la raGLFDOLWp GH ODSSHO pYDQJpOLTXH
(thse 1) et la pratique de la misricorde (thse 2), dans les
OLPLWHVGHFHTXLHVWDXMRXUGKXLUHFHYDEOHSDUOHPDJLVWqUH

/pQRQFpGHFHWWHWKqVHHVWXQH[WUDLWGXQ GHOH[horta-
tion Familiaris Consortio, et en particulier du paragraphe dans
lequel Jean Paul ,, pYRTXH OHV GHX[ PRWLIV OXQ GRFtrinal et
ODXWUH GH QDWXUH SDVWRUDOH, rendant imposVLEOH ODFFqV j OD
communion eucharistique des fidles divorcs remaris.
Dans ce paragraphe trs bref, le cardinal Ratzinger se
contente de rappeler les rfrences principales qui fondent
FHWWH DIILUPDWLRQ GX PDJLVWqUH GH OeJOLVH : OHQVHLJQHPHQW
de Jsus et celui du Concile Vatican II dans la constitution
Gaudium et spes (n 48).
Il expose galement la raison, nonce dans le canon
1141 du Code de 1983 3 SRXU ODTXHOOH OeJOLVH VH WURXYH
GDQVOLPSRVVLELOLWpGHUHFRQQDvWUHODYDOLGLWpGXQHQRXvelle

2. Xavier LACROIX, Oser dire le mariage indissoluble, Paris, Cerf,


2001, p. 211.
3. Can. 1141 : Le mariage conclu et consomm ne peut tre dissous
par aucune puissance humaine, ni par aucune cause, sauf par la mort .
union, si le mariage prcdent tait valide : /eJOLVH FURLW
TXHSHUVRQQHSDVPrPHOHSDSHQDOHSRXYRLUGHGLVsoudre
un mariage sacramentel conclu et consomm 4.
&HVW FH PRWLI TXL MXVWLILH OLQWHUGLFWLRQ IRUPXOpH SDU
Jean Paul ,, GDQV OH[KRUWDWLRQ DSRVWROLTXH Familiaris Con-
sortio (n  GHFpOpEUHUGHVFpUpPRQLHVGDXFXQHVRUWHHQ
faveur de ceux qui se remarient. Pour conclure, le cardi-
nal Ratzinger rappelle les raisons invoques par Jean Paul II
ce propos : ceVFpUpPRQLHVGRQQHUDLHQWHQHIIHWOLPSUHV-
VLRQ TXLO VDJLW GH OD FpOpEUDWLRQ GXQ QRXYHDX PDULDJH
sacraPHQWHOHWYLGHUDLHQWGHVDIRUFHODGRFWULQHVXUOLQGLV-
solubilit du mariage .
Cette thse nous invite clarifier quelques affirmations
thologiques et disciplinaires indispensables sa compr-
hension et sa rception, mais aussi nous interroger sur
ses implications pastorales concrtes.

/LQGLVVROXELOLWpGXPDULDJH
/D GRFWULQH GH OeJOLVH IRQGH OLQGLVVROXELOLWp GX PDriage
sur cette parole du Christ : &HTXH'LHXDXQLTXHOKRPPH
ne le spare pas ! (Mc 10,  TXLUHQYRLHjOD*HQqVHFHVW--
dire au commencement de la cration et la volont du cra-
teur.
6L OLQGLVVROXELOLWp D WRXMRXUV pWp GpILQLH SDU OeJOLVH
dans son PDJLVWqUH HW VD GLVFLSOLQH FRPPH OXQH GHV SUR-
priWpVHVVHQWLHOOHVGXQPDULDJHYDOLGHFHWWHFDUDFWpristique
QHVW SDV SURSUH DX VHXO PDULDJH FKUpWLHQ /H &RGH FLYLO
SUHQG pJDOHPHQW HQ FRPSWH GXQH FHUWDLQH IDoRQ FHWWH
proprit du mariage 5. PRXUOeJOLVHGDQVORUGUHGHODFUpD-
WLRQWRXWOLHQPDWULPRQLDOTXLOVRLW naturel ou sacramen-
WHOHVWRULHQWpYHUVOLQGLVVROXELOLWp(QWUHEDSWLss, le mariage
est un sacrement (cf. Ep 5,   'DQV FH FDV OLQdissolubilit
est absolue : en raison du sacrement, elle acquiert une soli-
dit particulire (can.   /LQGLVVRlubiOLWp VRSSRVH DX

4. J. RATZINGER, Introduction , La Pastorale..., p. 15.


5. Voir G. RAYMOND, Les effets du divorce en droit franais : mariage
franais et indissolubilit , dans X. LACROIX (dir.), op. cit., p. 67.
GLYRUFH HW OXQLWp VHFRQGH SURSULpWp HVVHQtielle du mariage,
suppose la monogamie et la fidlit.
'DQVVDOpJLVODWLRQOeJOLVHDSRVpFRPPH principe gn-
ral que le mariage conclu et consomm (ratum et consomma-
tum) ne peut tre dissous par aucune puissance humaine, ni
par aucune cause, sauf par la mort (can. 1141), mais elle a
SULVHQFRPSWHOHFDUDFWqUHSOXVRXPRLQVDEVROXGHOLQdisso-
luELOLWpGXQPDULDJH
'XQH SDUW OeJOLVH FRQVLGqUH TXH OH PDULDJH YDOLGH GH
deux baptiss est ipso facto un mariage sacramentel
(can. 1055 2). 'DQVFHFDVOLQGLVVROXELOLWpGXPDULDJHHVW
absoOXHHWQHSHXWrWUHUHPLVHHQFDXVHTXjODPRrt du con-
MRLQW RX ELHQ ORUVTXH OH PDULDJH ELHQ TXH FRQFOX QD SDV
t consomm.
'DXWUHSDUWOeJOLVHUHFRQQDvWODOpJLWLPLWpGXPDULDJHGH
deux non baptiss, mariage non sacramentel, et donc elle
reconnat son indissolubilit, comme le stipule le can. 1134 :
Du mariage valide nat entre deux conjoints un lien de part
sa nature perptuel et exclusif . celui qui voudrait aprs
divorce se remarier avec un catholique, elle oppose un emp-
FKHPHQWGHOLHQ FDQ WDQWTXHOHSUHPLHUOLHQQDXUa
pas t reconnu canoniquement invalide. Cependant, consi-
dUDQW TXH OLQGLVVROXbilit des mariages non sacramentels
QHVWSDVDEVROXHOeJOLVHDGPHWGDQVFHUWDLQVFDVXQHGLVso-
lution de ces mariages lgitimes, en faveur notamPHQWGXQ
lien plus lev, celui de la foi en cas de conversion. Elle
admet aussi la dissoluWLRQ HQ IDYHXU GH OD IRL GXQ PDULDJH
dispar , galement non sacramentel, entre un baptis et un
non baptis.

2. Le remariage
&HVWj-HDQ Paul II que nous devons la considration de
OHQJDJHPHQWGDQVXQVHFRQGOLHQFRPPHXQH contradic-
tion objective (Familiaris consortio, n 84). Une formule,
plutt heureuse, qui signifie que, sur un plan strictement
objecWLILQGpSHQGDPPHQWGHFHTXRQWYpFXHWYLYHQWH[Ls-
tentiellement les personnes dans leur singularit et la parti-
cularit de leur situation, une contradiction existe entre
OHXU YLH HW OD QRUPH HFFOpVLDOH HQWUH OH[LVWHQFH GH GHX[
liens et le sacrePHQWGHO$OOLDQFHXQLTXH
$XWUHPHQWGLWORUVTXXQmariage sacramentel entre poux
EDSWLVpV D pWp FRQVRPPp HW TXLOV VH VpSDUHQW FHVW OH UHPD-
ULDJHGHOXQRXODXWUHFRQMRLQWTXLFRQVtitue une contradic-
tion objective avec le commandement vanglique (Mc 10, 11-
12) 6 et avec ce signe de communioQGDPRXUHQWUHOH&KULVW
HWOeJOLVHTXHVWOHVDFUHment (Ep 5, 31-32) 7. En effet, objecti-
vement, le remariage atteste que le prcepte vanJpOLTXH QD
pu tre respect.
Selon les documents magistriels les expressions utili-
VpHVGLIIqUHQW/HQJDgement dans un second lien, rappelle
Xavier Lacroix 8, est considr non seulement comme con-
tradiction objective , mais encore comme dsordre moral
objectif 9 ou comme pch grave et manifeste 10. Que
penser de la varit des expressions utilises pour qualifier
la situation des fidles divorcs remaris ?
Au plan de la forme, ces diffrentes dsignations laissent
subsister un certain flou dans la dfinition de la situation
des fidles divorcs remaris, voire peut-tre une certaine
ambigut sur le fond, quant cette distinction indispensa-
ble poser entre la dimension subjective qui prend en
compte la notion de pch, de responsabilit, de conver-
sion, et qui relve de la vie spirituelle des personnes, et la
dimension objective qui relve de la situation ecclsiale
GX FRXSOH 'XQH PDQLqUH JpQpUDOH ODUWLFXODWLRQ HQWUH OH
subjectif et OREMHFWLI pose de vrais problmes dans la
pastorale, que nous voquerons plus loin.
3DUPL FHV GpVLJQDWLRQV FHUWDLQHV IRQW OREMHW Gun vif
dbat auquel participent pasteurs, thologiens, canonistes,

6. Mc 10, 11-12 : Il leur dit VLTXHOTXXQUpSXGLHVDIHPPHHWHQ


pSRXVHXQHDXWUHLOHVWDGXOWqUHjOpJDUGGHODSUHPLqUHHWVLODIHPPH
rpuGLHVRQPDULHWHQpSRXVHXQDXWUHHOOHHVWDGXOWqUH .
7. Ep 5, 31- 32 : &HVWSRXUTXRLOKRPPH TXLWWHUDVRQ SqUH HW VD
PqUH LO VDWWDFKHUD j VD IHPPH HW WRXV GHX[ QH IHURQW TXXQH VHXOH
chair [cf. Gn 2, 24]. Ce mystre est grand MHGpFODUHTXLOconcerne le
&KULVWHWOeJOLVH .
8. X. LACROIX, op. cit., p 216.
9. Jean Paul ,,'LVFRXUV jORFFDVLRQGX -XELOp GHVIDPLOOHV 5RPH
14 octobre 2000.
10. Can. 915 du Code de 1983.
et qui contribue faire progresser la recherche actuelle.
Nous pensons en particulier aux discussions concernant
OLQWHUprtation du canon 915, stipulant que ceux qui per-
sistent avec obstination dans un pch grave et manifeste
ne peuvent tre admis la sainte communion. Le magistre
a souhait mettre un terme ce dbat, en publiant la
DclaUDWLRQGXFRQVHLOSRQWLILFDOSRXUOLQWHUSUpWDWLRQGHV
textes lgislatifs date du 24 juin 2000, dans laquelle il est
clairement affirm que la formulation du canon 915 con-
cerne bien les fidles divorcs remaris ; mais le dbat ne
parat pas clos pour autant. Nous y reviendrons.

/DGHPDQGHGXQHSULqUHGeJOLVH
Avec la question des crmonies religieuses, nous entrons
plus directement dans le domaine de la pastorale. Il est
devenu frquent aujourGKXL TXXQ FRXSOH TXL VH UHPDrie
civilement aprs un divorce demanGH XQH SULqUH GeJOLVH
/LQWHUdiction de clbrer une crmonie reliJLHXVHGDXFXQH
VRUWHVH[SOLTXHSDUOLPSRVVLELOLWpSRXUOeJOLVHGDFFHSWHUOD
YDOLGLWp GHV VHFRQGHV QRFHV &H UHIXV H[FOXW PrPH TXRQ
SXLVVHOLPLWHUODSRUWpHHWOHVIRUPHVGXQHWHOOHFpOpEUDWLRQ
On note en filigrane de cette dcision magistrielle, les ris-
ques de doute et de confusion, risques que ces crmonies
pourUDLHQWVXVFLWHUGDQVOHVSULWGHVILGqOHVCette crainte,
certains gards, est justifie. Mais une question se pose : ne
pourrait-RQ SDV GXQH PDQLqUH RX GXQH DXWUH UpIOpFKLU j OD
faon de prvenir les risques de doute et de confusion ? La
formule ces crmonies donneUDLHQW OLPSUHVVLRQ laisse
perplexe, et pose la question du souci et du besoin rel de cla-
ULILFDWLRQGHODVLWXDWLRQGHVGLYRUFpVUHPDULpVGDQVOeJOLVH
OpJDUGGHOHQVHPEOHGHODFRPPXQDXWpFKUptienne.
Que faire pour rpondre cette demande lgitime de vou-
ORLU VH FRQILHU j OD SULqUH GH OeJOLVH VDQV TXXQH WHOOH SULqUH
puisse faire penser une crmonie cultuelle de remariage ?
1\D-t-il pas une distinction tablir entre une prire pour des
personnes et pour un couple et la clbraWLRQGXQUHPDULDJH ?
La prire universelle de la clbration eucharistique est-elle
OXQLTXHUHFRXUVGRQWGLVSRVHOeJOLVH pour prier pour ces fid-
les ? Faut-il renoQFHUjWRXWHDXWUHIRUPHGLQWpJUDWLRQOLWXUgi-
TXH GXQH SULqUH SRXU OHV ILGqOHV GLYRUFpV UHPDULpV ? Que
OeJOLVHSULHSRXUHX[ demandait Jean Paul II. Mais de quelle
faon ?
Le recours aux sacramentaux ne pourrait-il pas consti-
tuer un moyen terme entre la simple intention de prire
penGDQWOHXFKDULVWLHHWODFpOpEUDWLRQGXQUHPDriage ? Les
sacraPHQWDX[ QRXV SDUDLVVHQW RSSRUWXQV SDUFH TXLOV VRQW
instiWXpVSDUOeJOLVHHQYXHGHODVDQFWLILFDWLRQGH circons-
tances trs varies de la vie chrtienne (CEC 1668). Le
&DWpFKLVPH GH OeJOLVH FDWKROLTXH UHSUHQG OHV WHUPHV GH OD
constitution Sacrosanctum Concilium du concile Vatican II
(cf. SC 60 et 79), en dfinissant les sacramentaux comme
des signes sacrs par lesquels, selon une certaine imitation
des sacrements, des effets surtout spirituels sont signifis et
VRQWREWHQXVSDUODSULqUHGHOeJOLVH (n 1667).
Parmi les sacramentaux figurent les bndictions de per-
sonnes. La bndiction consiste en une louange de Dieu et
une prire pour obtenir ses dons. Un signe peut accompa-
JQHU FHWWH SULqUH VLJQH GH FURL[ LPSRVLWLRQ GHV PDLQV 
En outre, parce que les sacramentaux relvent du sacerdoce
baptismal, les lacs peuvent prsider certaines bndictions
(can. 1168). En effet, tout baptis est appel tre une
bndiction, et bnir (CEC 1669) 11.
Plusieurs questions se posent : les fidles divorcs rema-
ris sont-ils empchs par le droit de recevoir les sacramen-
taux " 1RXV QDYRQV ULHQ WURXYp GDQV OH &RGH GH  TXL
pourrait le laisser penser. Le sacramental risque-t-LO GrWUH
confondu avec un sacrement ? Peut-tre, si aucune explica-
WLRQ QHVW GRQQpH DX[ ILGqOHV SUpVHQWV HW VL FHWWH SULqUH HVW
WURSSURFKHGXPDULDJHFLYLOGHVFRQMRLQWV0DLVQ\DXUDLW-il
SDVPR\HQGpYLWHUFes risques ? Peut-tre conviendrait-il ga-
lement de clarifier le contenu de la demande des poux 12.

11. Gn 12, 2 ; Lc 6, 28 ; Rm 12, 14 ; 1P 3, 9.


12. On observera que plusieurs diocses de France ont prvu officiel-
lement la possibilit de clbrations religieuses pour les divorcs remaris
qui souhaitent une bndiction non sacramentelle .
4. La dimension publique du mariage
Au final, nous pourrions dire que la question de la
GpILQLWLRQ GH OpWDW HW GH OD FRQGLWLRQ GH YLH GHV ILGqOHV
divorcpV UHPDULpV HW FHOOH GH OLQWHUGLFWLRQ GHV FpUpPRQLHV
religieuses pour un remariage, relvent pour une part essen-
tielle de la question, plus gnrale, de la dimension publi-
que, la fois sociale et ecclsiale, du mariage. plusieurs
reprises, ce sujet est abord et son importance souligne avec
insistance par le cardinal Ratzinger : Le mariage a essentielle-
PHQWXQFDUDFWqUHSXEOLF>@/HFRQsentement des poux, qui
constiWXH OH PDULDJH QHVW SDV XQH VLPSOH GpFLsion prive,
mais cre pour chacun des partenaires une situation spcifi-
que, ecclsiale et sociale (introduction 7 ; cf. Lettre de 1994,
7 et 8 13).
Au plan ecclsial, la dimension publique du mariage impli-
TXH OHQJDJHPHQW GH OD FRPPXQDXWp FKUpWLHQQH GDQV VRQ
ensemble. Elle confre tous, pasteurs, fidles et poux, des
droits et des devoirs inscrits dans le code de droit canonique.
Pour la clbration proprement dite, on peut rappeler
OREOLgation de la forme canonique du mariage (can. 1108 1 ;
1117) qui se WUDGXLWSDUODSUpVHQFHGHODVsistant au mariage et
de deux tmoins, ou en cas de dispense, le resSHFWGXQHFHU-
taine forme publique de clbration (can. 1127 2). Il est
bien prcis au can. 1108 2 que le ministre demande et
reoit le consentement des poux DX QRP GH OeJOLVH . La
prVHQFH GH ODVVLVWDQW GHV WpPRLQV OLQscription du mariage
GDQVOHVUHJLVWUHVFRQVHUYpVSDUOeJOLVHH[SULPHQWOHIDLWTXHOH
mariage est une ralit ecclsiale.
Le &DWpFKLVPH GH OeJOLVH FDWKROLTXH explique aux
nos 1630 et 1631 que le mariage est une ralit ecclsiale parce
TXLOHVWLQVpUpGDQVODOLWXUJLHGHOeJOLVHSDUFHTXLOLQWURduit
dans un ordo ecclsial (cf. n  SDUFHTXLOHVWXQpWDWGH
YLHGDQVOeJOLVHSDUFHTXLOQpFHVVLWH la prsence de tmoins
SRXU TXH OHQJDJHPHQW FRQMXJDO VRLW UHFRQQX OD FpOpEUDWLRQ
publique visibilise et atteste) et solidifi (le oui public pro-
tge et soutient).

13. J. RATZINGER, /HWWUH DX[ pYrTXHV GH OeJOLVH FDWKROLTXH VXU


ODFFqV j la communion eucharistique de la part des fidles divorcs
remaris , La Pastorale des divorcs remaris, p. 37 et s.
,OVHUDLWLQWpUHVVDQWGH[DPLQHUTXHOOHVLQFLGHQFHVODGLPHQ-
sion publique du mariage a sur les dclarations disciplinaires
GHOeJOLVHjSURSRVGHVILGqOHVGLYRUFpVUHPDris.
Aussi conviendrait-il de prter attention aux questions sui-
vantes : la dimension publique du mariage constitue-t-elle un
frein ou un tremplin au dveloppement des initiatives pasto-
rales en faveur des fidles divorcs remaris ? Le recours cet
argument pour invalider ou justifier certaines pratiques ou
propositions pastorales ne pourrait-il pas tre rexamin dans
certains cas (comme celui du scandale possible engendr par
diverses situations) "OLQYHUVHVHUDLW-il posVLEOHGHVDSSX\HU
sur cet argument de la dimension publique du mariage,
FRPPHUpDOLWpHFFOpVLDOHHWVRFLDOHSRXUIDYRULVHUOLQWpgration
des fidles divorcs remaris danV OeJOLVH " 3DUFH TXDSUqV
WRXWFHVWXQIDLWLQGpQLDEOHPrPHVLOHVWjGpSORrer, que le
remariage est devenu une ralit publique, non plus seule-
ment sociale, mais dsormais ecclsiale. Le remariage est-il, ou
peut-il devenir une ralit ecclsiale au sens o le catchisme
OHQWHQG " /HQsemble non-indiffrenci , comme nous le
verrons, des fidles divorcs remaris peut-il tre considr
comme un ordo ecclsial avec la visibilit, la reprsentativit,
les dons propres que cela sous-entend, avec les droits et les
devoirs que cela supposerait ?

1. Prsentation
La seconde thse du cardinal Ratzinger, dans son nonc,
regroupe deux affirmations diffrentes du magistre : la pre-
mire mane de Jean Paul II (discours de 1997, 2) 14 ; la
seconde fut nonce par le cardinal Ratzinger lui mme (lettre
aux vques de 1994, 2).
Cette thse concerne le thme de la communion au
&KULVWHWjOeJOLVH&HWKqPHTXLOXLHVWFKHUHWVXUOHTXHO

14$OORFXWLRQSURQRQFpHjORFFDVLRQGHODe Assemble plnire


du Conseil pontifical pour la famille, 24 janvier 1997.
nous reviendrons, a t particulirement dvelopp dans sa
lettre de 1994.
Au plan communautaire : la premire partie de la thse
( les fidles divorcs remaris demeurent membres du peu-
ple de Dieu ) et son commentaire voquent la dimension
communautaire de la communion ecclsiale qui existe entre
OeJOLVHHWOHVILGqOHVGLYRUFpVUHPDULpVHWHQSUpFLVHQWGHX[
aspects :
Du ct des fidles divorcs remaris : le cardinal rappelle
TXLOVQHVRQWSDVH[FOXVGHODFRPPXQLRQHFFOpVLDOHHQFLWDQW
les deux arguments principaux invoqus par Jean Paul II en
faveur de cette communion effective : le baptme et la conser-
vation de la foi chrtienne 15. On noteUDDXSDVVDJHOH[KRUta-
tion du cardinal quant au vocabulaire employer OLQYLtation
ne pas simplement parler des divorcs remaris, mais les
dsigner comme fidles divorcs remaris 16.
Du ct de la communaut chrtienne : la responsabi-
OLWp GH OeJOLVH j OpJDUG GH FHV ILGqOHV FRQVWLWXH OH VHFRQG
aspect de la communion ecclsiale, souligne galement par
Jean Paul II OeJOLVHDOHGHYRLUGHPHWWUHjOHXUGLVSRVLWLRQ
les moyens de salut qui sont les siens 17 OeJOLVHHVWLQYLWpH
tre proche de ces fidles 18 et bien discerner les diffren-
tes situations 19.

15. Les divorcs remaris sont et demeurent ses membres [de


OeJOLVH@FDULOVRQWUHoXOHEDSWrPHHWLOVFRQVHUYHQWODIRLFKUpWLHQQH
(discours de 1997, 2).
16/HFDUGLQDO5DW]LQJHUQDSDVODSDWHUQLWpGHFHWWHH[SUHVVLRQTXL
aurait, semble-t-il, t utilise dj par Jacques Nourrissat ; voir Xavier
LACROIX, op. cit., p. 211, note 3.
17. /eJOLVH HQ HIIHW LQVWLWXpH SRXU PHQHU DX VDOXW WRXV OHV KRP-
mes, et en particulier les baptiss, ne peut pas abandonner eux-mmes
ceux qui, dj unis dans les liens du sacrement de mariage, ont voulu
SDVVHUjGDXWUHVQRFHV(OOHGRLWGRQFVHIIRUFHUVDQVVHODVVHUGHPHWtre
leur disposition les moyens de salut qui sont les siens (FC, n 84).
18. OH[HPSOHGH-pVXVTXLQH[FOXDLWSHUVRQQHGHVRQDPRXU ,
prcise le cardinal Ratzinger, p. 15
19. Il y a en effet une diffrence entre ceux qui se sont efforcs
avec sincrit de sauver un premier mariage et ont t injustement
abandonns, et ceux qui par une faute grave ont dtruit un mariage
canoniquement valide. Il y a enfin le cas de ceux qui ont contract une
VHFRQGH XQLRQ HQ YXH GH OpGXFDWLRQ GH OHXUV HQIDQWV HW TXL RQW SDU-
Au plan individuel : la seconde partie de la thse ( HW
GRLYHQWIDLUHOH[SpULHQFHGHODPRXUGX&KULVWHWGHODSUR[L-
PLWpPDWHUQHOOHGHOeJOLVH ) et son commentaire traitent de
ODFRPPXQLRQSHUVRQQHOOHDX&KULVWHWjOeJOLVHGHVILGqOHV
GLYRUFpVUHPDULpVHWVRQWHQIDLWXQHUHSULVHGXQSDUDgraphe
de la lettre de 1994 crite par le cardinal. /REMHFWLISDVWRUDO
jDWWHLQGUHHVWGDLGHUOHVILdles divorcs remaris se rap-
proFKHUGDYDQWDJHGX&KULVWHWGHOeJOLVH/HFDUGLQDO5DW-
zinger met nouveau en relief le rle spcifique des pas-
teurs en vue de cette tche et leur suggre des orientations
pasWRUDOHV GDFFRPSDJQHPHQW : Les pasteurs indiqueront
aux fidles intresss des chemins concrets de conversion et
de participation la vie ecclsiale , chemins concrets qui
seront prciss dans les thses suivantes (thses trois sept).
Enfin, deux citations conclusives visent rapSHOHUOH[KRUta-
WLRQIDLWHjWRXWHOeJOLVHSDUOHSDSH-HDQ3DXO II 20 et par lui-
PrPH OHWWUH GH    GH VLQWpresser avec sollicitude
ces fidles vivant dans des conditions matrimoniales difficiles
et de ne pas les traiter avec indiffrence ou reproches 21.

/DFRPPXQLRQDX&KULVWHWjOeJOLVH
Un approfondissement du thme de la communion au
Christ et de la communion ecclsiale nous parat capital,
SDUFH TXH VXVFHSWLEOH GXQH SDUW GH FODULILHU OD VLWXDWLRQ

fois, en conscience, la certitude subjective que le mariage prcdent,


irrPpGLDEOHPHQWGpWUXLWQDYDLWMDPDLVpWpYDOLGH (FC, n 84).
20. 4XHOeJOLVHSULHSRXUHX[TXHOOHOHVHQFRXUDJHHWVHPRQWUHj
OHXU pJDUG XQH PqUH PLVpULFRUGLHXVH HW TXDLQVL HOOH OHV PDLQWLHQQH
GDQVODIRLHWOHVSpUDQFH >@ -H[KRUWHFKDOHXUHXVHPHQWOHVSDVWHXUV
et la communaut des fidles dans son ensemble aider les divorcs
UHPDULpV $YHF XQH JUDQGH FKDULWp WRXV IHURQW HQ VRUWH TXLOV QH VH
VHQWHQW SDV VpSDUpV GH OeJOLVH FDU LOV SHXYHQW HW PrPH LOV GRLYHQW
comme baptiss, participer sa vie (FC, n 84).
21. ...pour que ceux-ci reconnaissent, mme au sein de leurs diffi-
cults, le joug facile et le fardeau lger de Jsus . La formule peut sur-
SUHQGUH /H FDUGLQDO 5DW]LQJHU VHQ H[SOLTXH : OHXU IDUGHDX QHVW SDV
doux et lger parce que petit ou insignifiant, mais il devient lger parce
que le Seigneur HWDYHFOXLWRXWHOeJOLVH y prend sa part (lettre de
1994, 10). Dans ce mme paragraphe de la lettre, le cardinal prcise que
ODLGHDSSRUWpHGDQVODFWLRQSDVWRUDOHQHVWSDVH[HPSWH GHVRXIIUDQFH
SRXUWRXVHWVHGRLWGrWUHIRQGpHGDQV ODYpULWpHWGDQVODPRXU
actuelle des fidles diYRUFpVUHPDULpV GDQV OeJOLVHHWSRXU
eux-mmes et pour la communaut chrtienne dans son
HQVHPEOHGDXWUHSDUWGHSHUPHWWUHjFHVILGqOHVGHYLYUHXQ
cheminement spirituel.
Au plan communautaire : certaines questions en particulier
PpULWHUDLHQWGrWre tudies sur un double plan thologique
HW GLVFLSOLQDLUH ,O FRQYLHQGUDLW SDU H[HPSOH GH[SOLFLter la
QDWXUH GH FHWWH FRPPXQLRQ HIIHFWLYH HQWUH OeJOLVH HW FHV
fidles. Suffit-LO GH GLUH TXLOV QHQ VRQW SDV H[FOXV ? Il con-
vienGUDLW pJDOHPHQW GH[aminer les diffrents liens de com-
muQLRQTXHOeJOLVHHQWUHWLHQWHQVRQVHLQRXDYHFGDXWUHV
chrtiens, pour en tirer quelques enseignements ou pistes de
rflexion. La question alors se poserait de la manire sui-
vante : est-il possible de rattacher ou de rfrer la situation
ecclsiale des fidles divorcs remaris une situation eccl-
siale dj existante et plus globale ? Nous tenterons dans
notre quatrime partie de donner des lments de rponse
cette question.
Au plan individuel : /REMHctif pastoral qui vise la crois-
VDQFHGHODFRPPXQLRQDX&KULVWHWjOeJOLVHSRXUFHVILGq-
les, voqu par le cardinal Ratzinger, suppose que leur soient
proposs des moyens concrets pour vivre ce cheminement
spirituel. Dans ce domaine, des propositions existent aujour-
GKXL PrPH VL HOOHV VRQW HQFRUH WURS SHX QRPbreuses, et
VRQWDSSHOpHVjVHGpYHORSSHU4XHOOHSpGDJRJLHGDFFRPpa-
gnement envisager ? Quel cheminement spirituel plus global
proposer et quels en seraient les enjeux ? Dterminer ces
enjeux pour chacun des conjoints et pour le couple, et adap-
ter peut-tre davantage les propositions ecclsiales la nature
de ces enjeux, restent deux priorits ne pas perdre de vue.
1RXV HVVDLHURQV SOXV ORLQ GpYRTXHU TXHOTXHV-uns de ces
eQMHX[ %RQ QRPEUH GH TXHVWLRQV GRUGUH SDVWRUDO DX[-
quelles sont confronts ceux qui sont engags dans la pasto-
rale des fidles divorcs remaris, sont laisses ouvertes dans
cette simple thse.
Dans les propositions de cheminement spirituel destines
aux fidles divorcs remaris, il conviendrait par exemple
GrWUHDWWHQWLIDX[GHX[SRLQWVVXLYDQWV :
Bien distinguer le prcepte et la personne du Christ.
6LO\DHXGpVREpLVVDQFHUXSWXUHDYHFXQHSDUROHXQSUp-
cepte du Christ, souligne Xavier LacroL[ LO Q\ D SDV SRXU
autant rupture avec sa personne. Toute dsobissance au
mesVDJHQHVWSDVGpQLGHVDSHUVRQQH
9LVHU XQH FODULILFDWLRQ GH OKLVWRLUH SDUWLFXOLqUH GHV
fidles divorcs remaris TXLLQWqJUHOHSDVVpOpFKHFHWOHV
souffrances du premier lien et donne la nouvelle union sa
place de second lien. Aider ces fidles entrer dans un che-
min de vrit, de gurison et de rconciliation avec Dieu
PrPH VLOV QRQW SDV DFFqV DX VDFUHPHQW GH OD SpQLWHQFH 
avec eux-PrPHVDYHFOH[-conjoint, avec leurs enfants. Mais
DXVVL RVHU SDUOHU GH OREpLVVDQFH pYDQJpOLTXH FRPPH IUXLW
GXQDPRXUGX&KULVWTXLSDVVHSDUODFURL[

3. La responsabilit de la communaut des fidles


Jean Paul ,,DPLVODFFHQWGDQVVRQHQVHLJQHPHQWVXUOH
rle et la responsabilit de la communaut toute entire vis-
-vis de ces fidles.
/pYROXWLRQGXGURLWHWGHVPHQWDOLWpVFRQVWDWpHGHSXLV
DQVUHQGFRPSWHGXQHUpHOOHYRORQWpGDFFXHLOHFFOpVLDO
de ces fidles.
Il faudrait voquer ici la place donne la question des
fidles divorcs remaris dans plus de cinquante synodes
depuis maintenant plus de quinze ans, la floraison des grou-
SHV GH UpIOH[LRQ HW GHQWUDLGH HQ GLYHUV SD\V OHV SURSRsi-
tions de week-ends de formation ou de sessions spcifi-
ques 22, occasion pour FHV ILGqOHV GDSSURIRQGLU OHXU UHOD-
WLRQDX&KULVWHWjOeJOLVH&HWWHpYROXWLRQVHSHUoRLWpJDle-
ment, souligne Mgr Le Bourgeois, chez les divorcs remaris
eux-mmes. /DTXDVLFHUWLWXGHGrWUH damn , frquente il
y a 35 ans, qui conduisait le plus souvent une sparation
GDYHFOeJOLVHDODLVVpODSODFHjGDYDQWDJHGHVpUpQLWpMme
VLOV UHVVHQtent profondment la dsapprobation, voire la
condamnaWLRQSDUOeJOLVHLOVODYLYHQWGXQHPDnire beau-
coup plus sereine 23.

22. Nous pensons, par exemple, aux sessions Cana Samarie propo-
ses en France aux fidles divorcs remaris par la communaut catholi-
que du Chemin Neuf.
23. A. LE BOURGEOIS, volution des mentalits de la commu-
naut chrtienne , Divorcs remaris mes frres, p. 43.
/DSSHOODQFp LO\DSUqVGHDQVjWRXWHOeJOLVHSDUOH
pape Jean Paul II, semble avoir t entendu aussi bien par
les pasteurs que par la communaut des fidles.

4. La responsabilit des pasteurs


Le cardinal Ratzinger, quant lui, insiste davantage sur le
rle spcifique des pasteurs, rle la fois doctrinal et pastoral.
,OVDJLWGXQHSDUWGDYHUWLUHWGDFFRPSDJQHUOHVILGqles con-
cerQpV PDLV DXVVL GpFODLUHU OD FRPPXQDXWp FKUptienne dans
son ensemble sur certains points de la doctrine et de la disci-
pOLQHGHOeJOLVH'DQVFHWWHVHFRQGHWKqVHFHVWOHXUUHVponsa-
bilit pastorale vis--vis des fidles divorcs remaris qui est
mise en valeur.
Les pasteurs sont invits, rappelle le cardinal Ratzinger,
bien discerner les diffrentes situations, ne serait-ce que
pour tre en mesure de proposer des chemins de conver-
sion et de participation la vie ecclsiale adquats et adap-
ts la particularit des situations et la singularit des per-
sonnes. Les chemins concrets de participation la vie eccl-
siale seront prciss dans les thses suivantes. Une question
se pose jTXRLIDLWUpIpUHQFHOHFDUGLQDOORUVTXLOpYRTXHFHV
chemins de conversion " 6DJLW-LO GXQ FKHPLQHPHQW SHU-
sonnalis de conversion, sur tel ou tel point prcis, adapt la
situaWLRQHWjOKLVWRLUHSDUWLFXOLqUHGHFHVILGqOHV "6DJLW-il des
voies de rgularisation de la situation ecclsiale des fidles
divorFpVUHPDULpVSURSRVpHVSDUOeJOLVH ? Le document ne le
prcise pas.

Les thses 1 et 2 concernaient la situation ecclsiale des


fidles divorcs remaris. Les thses 3 5 traitent de leur
participation la vie ecclsiale.
1. Prsentation
Trop souvent, dplore le cardinal Ratzinger, la question
de la participation la vie ecclsiale est rduite celle de la
rception de la communion. Le cardinal souligne la valeur
GH OD SDUWLFLSDWLRQ j OHXFKDULVWLH FHOOH GH OD FRPPXQLRQ
spirituelle et voque les diffrentes possibilits de participa-
WLRQjODYLHGHOeJOLVHVXJJpUpHVSDU-HDQ Paul II dans deux
documents :
GDQVOH[KRUWDWLRQ Familiaris consortio, le pape indique
les points suivants : couter la parole de Dieu, assister au
sacrifice de la messe, persvrer dans la prire, apporter sa
conWULEXWLRQ DX[ XYUHV GH FKDULWp HW DX[ LQLWLDWLYHV HQ
faveur de la justice, lever les enfants dans la foi chrtienne,
culWLYHUOHVSULWGHSpQLWHQFHHWHQDFFRPSOLUOHVDFWHV afin
GLPplorer, jour aprs jour, la grce de Dieu (FC, n 84).
GHODOORFXWLRQGHOHFDUGLQDO5DW]LQJHUUHOqYHXQ
point tout particulirement soulign par Jean Paul II  OLP-
portance de la formation humaine et chrtienne des enfants
de la nouvelle union 24 XQH XYUH VXVFHSWLEOH GDLGHU OHV
parents eux-mmes dans leur propre cheminement spirituel.

2. Commentaire
/LQYLWDWLRQ la participation active la vie ecclsiale com-
porte trois axes : la prire, la charit, la pnitence. Les diffren-
tes propositions ne diffrent pas notablement de celles qui
sont faites tous les fidles catholiques. Nanmoins, on note
TXXQ DFFHQW SDUWLFXOLHU HVW PLV VXU ODWWHQWLRQ TXH GRLYHQW

24. /HXUIDLUHFRQQDvWUHWRXWOHFRQWHQXGHODVDJHVVHGHOeYDQJLOH
VHORQOHQVHLJQHPHQWGHOeJOLVHHVWXQHXYUHTXLSUpSDUHPHUYHLOOHXse-
PHQWOHVFXUVGHVSDUHQWVjUHFHYRLUODIRUFHHWODFODUWpQpcessaires pour
surmonter les difficults relles qui se trouvent sur leur route et pour
retrouver la pleine transparence du mystre du Christ que le mariage
chrtien signifie et ralise (discours de 1997, 4).
SRUWHU OHV ILGqOHV GLYRUFpV UHPDULpV DX[ DFWHV HW j OHVSULW GH
pnitence.
Trois types de questions mritent approfondissement.
Existe-t-LO SRXU OHV ILGqOHV GLYRUFpV UHPDULpV GDXWUHV IRU-
mes possibles de participation la vie ecclsiale ? Peut-on, par
exemple, considrer que ces fidles ont une mission spci-
ILTXHGDQVOeJOLVH "6LFHVWOHFDVTXHOOHSRXUUDLWrWUHFHWWH
mission ?
Quelles pratiques concrtes implique pour ces fidles,
ODSSHOjFXOWLYHUOHVSULWGHSpQLWHQFHHWjHQDFFRPSOLUOHV
actes ? (voir thse 6).
&RPPHQW FRPSUHQGUH HQ SDUWLFXOLHU OLQYLWDWLRQ GH
Jean Paul II VDSSURFKHU GH OD PLVpULFRUGH GLYLQH SDU
GDXWUHVFKHPLQVWDQWTXLOVQHUHPSOLVVHQWSDVOHVFRQGL-
tions requises (discours de 1997, 3) ? Quels sont ou pour-
raient tre ces autres chemins ?
On remarquera que, pour les fautes de la vie quotidienne
(pchs vniels), les fidles divorcs remaris ne sont pas emp-
FKpVGDFFRPSOLUOHVWURLVDFWHVGHODSpnitence, la contrition,
la confession, la satisfaction. Ainsi dans la pratique pastorale,
FHUWDLQVSUrWUHVQKpVLWHQWSDVjFRQseiller ces fidles de vivre
XQ WHPSV GDFFXHLO VSLULWXHO LQGLYLGXHO PrPH VLOV QH SRXU-
URQW SDV OHXU DFFRUGHU ODEVRlution sacramentelle. Consid-
UDQWTXHODYHXOLEqUHDLGHjIRUPHUODFRQVcience, lutter
contre les penchants mauvais et facilite la rconciliation
DYHFOHVDXWUHVLOVSURSRVHQWGHQWHQGUHFHVILGqOHVHWSULHQW
ensuite pour eux.

1. Prsentation
Le cardinal Ratzinger raffirme la norme ecclsiale ;
norme qui QHVWSDVXQUqJOHPHQWSXUHPHQWGLVFLSOLQDLUH
TXLSRXUUDLWrWUHFKDQJpSDUOeJOLVH SDUFHTXHOOHGpFRXOH
GXQH VLWXDWLRQ REMHFWLYH TXL GH VRL UHQG LPSRVVLEOH
ODFFqV j OD 6DLQWH HXFKDULVWLH . Il cite ce propos le texte
magistriel de rfrence  OH[KRUWDWLRQ Familiaris consortio.
Jean Paul II invoque deux motifs ; un premier motif doctri-
nal : LOV VH VRQW UHQGXV LQFDSDEOHV G\ rWUH DGPLV FDU OHXU
tat et leur condition de vie sont en contradiction objective
avec la cRPPXQLRQ GDPRXU HQWUH OH &KULVW HW OeJOLVH WHOOH
TXHOOH VH[SULPH HW HVW UHQGXH SUpVHQWH GDQV OHXcharistie
(FC, n 84). Un second motif de nature plus pastorale : si
ORQDGPHWWDLWFHVSHUVRQQHVjOHXFKDULVWLHOHVILGqOHVVHUDLHQW
induits en HUUHXUHWFRPSUHQGUDLHQWPDOODGRFWULQHGHOeJOLVH
conFHUQDQWOLQGLVVROXELOLWpGXPDriage (ibid.).
Cette norme ecclsiale a suscit deux objections chez cer-
tains thologiens :
il conviendrait de rendre justice au discernement des
situations diverses, donc faire preuve de souplesse ;
LOFRQYLHQGUDLWGHGLVWLQJXHUHQWUHODGPLVVLRQRIILcielle
OD FRPPXQLRQ HXFKDULVWLTXH QRQ DXWRULVpH HW ODFFqV en
conscience , possible dans certains cas.
Le cardinal rpond ces objections en citant deux
extraits de sa lettre aux vques de 1994 :
OH[KRUWDWLRQ Familiaris consortio dit clairement que
cette pratique prsente comme obligatoire, ne peut tre
change sur la base des diffrentes situations ;
au nom du bien spirituel de la personne (1 Cor 11, 27-
  HW GX ELHQ FRPPXQ GH OeJOLVH OHV SDVWHXUV HW FRQIHV-
VHXUV VH GRLYHQW GDOHUWHU FHX[ TXL VRXKDLWHUDLHQW HQ FRQV-
cience contrevenir cette norme, TXXQ WHO MXJHPHQW GH
conscience est en opposition patente avec la doctrine de
OeJOLVH ; une doctrine dont le sens doit tre rappel tous
les fidles ; une norme qui ne signifie ni exclusion, ni discri-
mination, prcise le cardinal Ratzinger.
(QILQOHFRPPHQWDLUHGHFHWWHWKqVHVDFKqYHSDUGHX[VRX-
haits : que les fidles divorcs remaris accueillent cette norme
GHOeJOLVHSRXUDLQVLWpPRLJQHUjOHXUPDQLqUHGHOLQGLVsolu-
biOLWpGXPDULDJHHWGHOHXUILGpOLWpjOeJOLVH ; que tous les fid-
les rflchissent aux conditions de rception de la communion
eucharistique, car, et ceci est auMRXUGKXL SUDtiquement
RXEOLpGDQVOeJOLVHLOH[LVWHEHDXFRXSGDXWUHVVLWXDWLRQVTXL
VRSSRVHQWjXQHUpFHStion digne et fructueuse de la commu-
nion ; rappeler plus souvent et plus clairement ces points
aiderait les fidles divorcs remaris mieux comprendre leur
situation.

2. Une norme obligatoire


/eJOLVHGHPDQGHDX[SDVWHXUVGHUHIXVHUODFRPPXQLRQ
eucharistique aux fidles divorcs remaris et ces fidles,
de considrer la norme ecclsiale du non accs la commu-
nion eucharistique comme obligatoire.

/DUJXPHQWWKpRORJLTXH
&HWWH QRUPH HFFOpVLDOH QHVW SDV XQH VDQFWLRQ TXH
OeJOLVHHQWHQGUDLWLPSRVHUjFHVILGqOHV(OOHGpFRXOHGHOD
situation dans laquelle les fidles divorcs remaris se sont
placs de leur propre volont, en se remariant, autrement
GLWGXQFRQVWDWREMHFWLIGRQWOeJOLVHWLUHOHVFRQVpTXHQFHV
au nom du bien spirituel des fidles intresss et du bien
FRPPXQGHOeJOLVH . La contradiction objective, invoque
comme fondement doctrinal de la norme ecclsiale, est
implique dans les deux sacrements concerns : le mariage
FRPPH OHXFKDULVWLH RQW YDOHXU GHVLJQHGHODFRPPXQLRQ
GDPRXUHQWUHOH&KULVWHWOeJOLVH
Par ailleurs, souligne le cardinal Ratzinger dans sa lettre
de 1994 au 9, cette obligation est fonde sur le fait que
communion eucharistique et communion ecclsiale sont
intrinsquement lies. Le cardinal Ratzinger dploie son
argumentation de la faon suivante 25 OeJOLVHHVWOH&RUSV
du Christ et vivre dans lDFRPPXQLRQHFFOpVLDOHFHVWYLYUH
GDQVOH&RUSVGX&KULVWHWVHQRXUULUGHOHXFKDULVWLH5HFH-
voir la communion eucharistique quand on est en contraste
avec les normes de la communion ecclsiale est une chose
contradictoire en soi. La communion sacramentelle avec le
Christ inclut et prVXSSRVHOREVHUYDWLRQGHORUGRQQDQFHGH
la communion ecclsiale ; elle ne sera ni juste ni fructueuse si
le fidle, en voulant se rapprocher du Christ, ne respecte pas
FHTXHOeJOLVHOXLGHPDQGH

25. La Pastorale des divorcs remaris, p. 42.


Enfin, comme le rappelle Mgr Tettamanzi, la norme
QHVWSDVH[WULQVqTXHPDLV intrinsque dans la mesure o
elle jaillit de la nature mme des sacrements et de leur signi-
fication 26. En effet, donner les sacrements aux divorcs
remaris qui restent tels signifie mettre en pratique un lan-
gage sacramentel qui est dmenti par le langage existentiel,
si bien que les signes sacramentels finissent par dire le con-
WUDLUHGHOHXUYpULWDEOHFRQWHQXHWTXLOVVHSUpsentent donc
FRPPHGHVVLJQHVIDX[HWIDOVLILFDWHXUV .

/DUJXPHQWSDVWRUDO
Le second motif invoqu par Jean Paul II met en relief le
SUpMXGLFH TXH SRXUUDLW FDXVHU j OHQVHPEOH GH OD FRPPX-
QDXWp FKUpWLHQQH ODFFqV GHV ILGqOHV GLYRUFpV UHPDULpV j OD
communion eucharistique : le contenu substantiel de la doc-
WULQHVXUOLQGLVVROXELOLWpGXPDULDJHQHVHUDLWSOXVFRPpris.
Doute et confusion, non seulement fragiliseraient les fidles
dans leur foi, mais fragiliseraient aussi la communion eccl-
siale. Nous avons dj voqu ce problme et cette crainte
SURSRVGHOLQWHUGLFWLRQGHVFpUpmonies reliJLHXVHVORUVGXQ
remariage.
/D 'pFODUDWLRQ GX &RQVHLO SRQWLILFDO SRXU OLQWHUSUpta-
tion des lois (juin 2000) souligne le risque de scandale : Le
scandale, entendu comme une action qui pousse les autres
vHUVOHPDOFRQFHUQHjODIRLVOHVDFUHPHQWGHOHXFKDULVWLH
HWOLQGLVVROXELOLWpGXPDULDJH .
Contrairement au can. 855 1 du Code de 1917, le
canon 915 du Code de 1983, concernant la non admission
la communion eucharistique, ne fait plus explicitement
mention de cette notion de scandale. Le code de 1917 insis-
tait sur la rparation du scandale 27. Dans Familiaris consor-
tio, Jean Paul ,, PHW ODFFHQW VXU VD SUpYHQWLRQ 2Q SHXW
noter que seize ans plus tard, dans son discours de 1997, ce
second motLIQHVWSOXVLQYRTXpSDU-HDQ Paul II. Les docu-

26. Mgr D. TETTAMANZI, La fidlit dans la vrit , La Pastorale


des divorcs remaris, p. 60-61.
27. Le scandale tait rpar, pensent certains spcialistes, ds lors
TXLOpWDLWSXEOLTXHPHQWFRQQXTXH OH SpFKHXU DYDLWUHFRXUXjODFRQ-
fession.
ments des dicastres romains en revanche ont remis en
avant cette notion de scandale.

/DUJXPHQWGLVFLSOLQDLUH OLQWHUSUpWDWLRQGXFDQRQ
Le canon 912 nonce le principe selon lequel tout bap-
tis TXLQHVWSDVHPSrFKpSDUOHGURLWSHXWHWGRLWrWUHDGmis
la sainte communion .
/HGURLWSUpYRLWHQHIIHWODSRVVLELOLWpGpFDUWHUFHUWDLQHV
personnes de la communion 28. Or, aucun canon ne men-
tionne spcifiquement les fidles divorcs remaris.
Nanmoins, le canon 915 stipule que les excommunis
HWOHVLQWHUGLWVDSUqVOLQIOLFWLRQRXODGpFODUDWLRQGHODSHLQH
et ceux qui persistent avec obstination dans un pch grave
et manifeste, ne seront pas admis la sainte communion .
Si les deux premiers cas de figure (les excommunis et les
interdits ) sont clairs, le troisime pose un problme
GLQWHUSUpWDWLRQ/DTXHVWLRQTXHVXVFLWDOLQWHUSUpWDWLRQGX
canon 915 tait la suivante : les fidles divorcs remaris
doivent-ils tre compts parmi les personnes qui persv-
rent obstinment dans un pch grave et manifeste ?
(QODQOH&RQVHLOSRQWLILFDOSRXUOLQWHUSUpWDWLRQ
des lois a tranch. Ce canon concerne bien les fidles divor-
FpVUHPDULpVPrPHVLOVQHVRQWSDVH[SOLFLWHment nomms.
La notion de pch grave , notion thologique o est
en jeu la relation Dieu, parat dlicate interprter. Cette
QRWLRQQpWDQWSDVH[SOLFLWHPHQWGpILQLHFHUWDLQVRQWSHQVp
que pch grave pWDLWOpTXLYDOHQWGH pch mortel , sup-
posant trois choses : une matire grave, un consentement
dlibr ce pch, et une absence de contrition. Ils en ont
FRQFOX TXH OHV ILGqOHV GLYRUFpV UHPDULpV QpWDLHQW SHXW-tre
pas tous et toujours en tat de pch mortel. Autrement dit,
le texte du canon 915 ne permettrait pas de conclure leur
exclusion systmatique la communion eucharistique.
En outre, la notion de pch grave comporte une dimen-
VLRQ VXEMHFWLYH GRQW ODSSUpFLDWLRQ UHOqYH HQ SUHPLHU OLHX

28. Par exemple les non baptiss (can. 842 1), les baptiss non
catholiques (can. 844), les enfants trop jeunes pour comprendre (can.
913), les excommunis et les interdits aprs sentence dclaratoire ou
condamnatoire (can. 915).
du jugement de conscience de la personne au for interne :
seule la personne elle-mme sait avoir consenti dlibr-
ment un pch. On pourrait donc penser que le refus de
la communion prsuppose une valuaWLRQGHOpWDWVXEMHFWLI
de la personne. Sur ce point, la dclaration du Conseil pon-
tifical a d prciser les choses : le pch grave doit tre com-
SULVREMHFWLYHPHQWSDUFHTXHGHOLPSXWDELOLWpVXEMHFtive le
ministre de la communion ne peut juger. Si, dans un con-
WH[WHFDQRQLTXHRQSHXWVDWWHQdre ce que le mot pch
ne doive pas tre entendu au sens moral et subjectif du
WHUPH PDLV SOXW{W GDQV OH VHQV GXQH IDXWH H[WpULHXUH
objectivement contraire aux lois et la morale, il a tout de
mme t ncessaire que le Conseil pontifical prcise les
FKRVHVSRXUTXLOVRLWELHQFlair que ce canon concernait le
IRU H[WHUQH /H[SUHVVLRQ contradiction objective propo-
se par Jean Paul ,,DOHPpULWHGrWUHSOXVFODLUH
Le Code des glises orientales (CCEO) paru en 1990
utilise la notion GLQGLJQLWpSXEOLTXH (canon 712) plutt
que celle de pch grave . Cette notion fait rfrence au
texte de saint Paul en 1 Cor 11, 27-29 invitant chacun
VH[Dminer soi-mme pour ne pas recevoir indignement le
Corps et le Sang du Seigneur. Le Conseil pontifical a con-
firm officiellement que les deux formules (pch grave et
publiquement indigne) taient quivalentes.
Aprs la qualification de la situation des fidles divorcs
remaris comme contradiction objective , dsordre moral
objectif , pch grave et manifeste vient donc celle des per-
sonnes elles-mmes, dsignes comme publiquement indi-
gnes .
'DQV FHWWH QRXYHOOH GpVLJQDWLRQ QRXV SHUFHYRQV GXQH
SDUWXQJOLVVHPHQWGHODQRWLRQGHSpFKpjFHOOHGHOpWDWGH
SpFKHXU HW GDXWUH SDUW OD SHUVLVWDQFH GXQH DPELJXt, par
ODVVRFLDWLRQ GHV GHX[ WHUPHV HQWUH OH IRU LQWHUQH HW OH IRU
externe, alors que le magistre lui-mme affirme avec fermet
que le canon 915 concerne bien le seul for externe, la situa-
WLRQ SXEOLTXH GH FHV ILGqOHV /DVVRFLDWLRQ GHV GHX[ WHUmes
( indigne et publiquement ) ne parat pas trs heureuse
pour un second motif ; elle induit en effet la possiELOLWpGXQ
jugement de valeur sur les personnes. Ce risque existe,
PRLQVTXHQHVRLWFODULILpORUVTXRQXWLOLVHFHWWHH[SUHVVLRQ
que OLQGLJQLWp peut tre le cas de tout un chacun en
certaiQHVFLUFRQVWDQFHV&HVXMHWFRQVWLWXHGDLOOHXUVOXQHGHV
suggestions de rflexion proposes tous les fidles par le
cardinal Ratzinger dans son commentaire de la thse 4.

6. La question des exceptions jODSSOLFDWLRQGHODQRUPH


ecclsiale
'DQV OpQRQFp GHFHWWHWKqVH Q 4, le cardinal Ratzinger
distingue deux cas de figure non acceptables pour le magis-
tre  ODGPLVVLRQ j OD FRPPXQLRQ HXFKDULVWLTXH SDU DXWR-
risation officielle, et la rception de la communion eucha-
ristique par accession personnelle et volontaire la Table
du Seigneur. Cette distinction entre autorisation officielle
et accession personnelle fait rfrence la proposition des
vques allemands de la province du Rhin suprieur en
1993 29. Elle pose la question plus gnrale de la possibilit
GDGPHWWUHGHV exceptions la norme ecclsiale sur la base
des principes traditionnels de OpSLNLH et de OpTXLWpFDQR-
nique . Ces principes pourraient justifier du point de vue
moral ou juridique une dcision de la conscience qui
VpFDUWHUDLWGHODQRUPHJpQpUDOH
La dclaration des vques allemands avait pour but
GXQLILHU HW GRUGRQQHU OD SUDWLTXH SDVWRUDOH GDQV OHXUV
diocses. Le principe gnral qui guida leur rflexion tait
le suivant : ne pas admettre indistinctement, ne pas
exclure indistinctement  IRQGp VXU OLQYLWDWLRQ GH -HDQ
Paul II bien discerner les diffrentes situations .
$SUqVDYRLUUDSSHOpOHQVHLJQHPHQWGX&KULVWVXUOLQGLVso-
lubilLWpGXPDULDJHHWOLPSRVVLELOLWpGXQHDGPLVsion gnrali-
se des fidles divorcs remaris la communion eucharisti-
que, les vques admettaient la possibilit que, dans des cas
dtermins, ces fidles puissent accder la Table du Sei-
gneur, VLOVHVWLPDLHQW en conscience y tre autoriss. Nan-
PRLQVODGpFLVLRQGHFRQVFLHQFHQHGHYDLWrWUHSULVHTXDSUqV
un entretien pralable avec un prtre prudent et expriment,
entretien visant clairer la conscience des intresss.

29. Lettre pastorale des vques allemands du Rhin suprieur, Le


respect de la dcision prise en conscience , La Documentation Catholi-
que, n 2082, 1993, p. 986-994.
/DQQpHVXLvante, en 1994, la Congrgation pour la doc-
trine de la foi dclarait, en rponse cette proposition, que
la question ne pouvait tre laisse la seule apprciation de
la conscience individuelle, mme correctement claire.
Le cardinal Ratzinger rappelait que le consentement,
SDU OHTXHO HVW FRQVWLWXp OH PDULDJH QHVW SDV XQH VLPSOH
dciVLRQ SULYpH SXLVTXLO FUpH SRXU FKDFXQ GHV pSRX[ HW
pour le couple une situation spcifiquement ecclsiale et
sociale. Ds lors, concluait-il : le jugement de la cons-
cience sur sa propre situation matrimoniale ne regarde pas
seuOHPHQW XQ UDSSRUW LPPpGLDW HQWUH OKRPPH HW 'LHX
comme si on pouvait se passer de cette mdiation ecclsiale
qui inclut galement les lois canoniques qui obligent en
conscience 30. Les vques prirent acte des conclusions de
la congrgation, mais en pratique, il semble que certains
pasteurs aient continu de donner des autorisations en
conscience .
3RXUOHPDJLVWqUHGHOeJOLVHODVROXWLRQGXSUREOqPHGH
ODFFHVVLRQ DX VDFUHPHQW GH OHXFKDULVWLH SRXU OHV ILGqOHV
divorFpVUHPDULpVQHVW SDVjFKHUFKHUGXF{WpGXMXJHPHQW
de conscience des fidles intresss, mais du ct des proc-
dures canoniques actuellement en vigueur, leur permettant
de rgulariser leur situation matrimoniale.
/DGLVFLSOLQHGHOeJOLVHVXERUGRQQHODFRPPXQLRQHXFKD-
ristique la confession sacramentelle en cas de pch grave. Le
canon 916 du code de 1983 stipule en effet que celui qui a
FRQVFLHQFH GrWUH HQ pWDW GH SpFKp JUDYH ne communiera
pas au Corps du Seigneur sans recourir auparavant la con-
fesVLRQ VDFUDPHQWHOOH j PRLQV GXQ PRWLI JUDYH . Or,
mme si les fidles divorcs remaris, en se reconnaissant
pcheurs, vivent le repentir (contrition et aveu du pch),
OLQWHQtion de conversion ncessaire la rception du sacre-
ment reste absente de leur dmarche pnitentielle, dans la
mesure o ils ne veulent ou ne peuvent, ni se sparer, ni
VHQJDJHU j OD FRQWLQHQFH : La rconciliation par le sacre-
ment de pnitence qui ouvrirait la voie au sacrement de
OHXFKDULVWLH ne peut leur tre accord rappelait Jean
Paul II (FC, n 84).

30. Lettre aux vques de 1994, 8, /D3DVWRUDOH, p. 42.


Pour un certain nombre de chercheurs et de pasteurs, la
TXHVWLRQGXQRQDFFqVjOHXFKDULVWLHVHGpSODFHGRQFYHUVOH
sacrement de pnitence. La vritable difficult rsiderait
DORUVGDQVOLPSRVsibiOLWpSRXUFHVILGqOHVGDFFpGHUDXVDFUH-
ment de la pnitence. Aussi posent-ils la question suivante :
serait-LOSRVVLEOHHWjTXHOOHVFRQGLWLRQVGHQvisaJHUGDFFRU-
GHUODEVROXWLRQVDFUDmentelle aux fidles divorcs remaris ?
0DLVDXGHOjGHODSHUVSHFWLYHGXQQRXvel accs possible aux
VDFUHPHQWV OLQWpUrW GH OD UHFKHUFKH DFWXHOOH VXU FHWWH TXHV-
WLRQ HVW TXHOOH SODFH DX FHQWUH GH ODWWHQWLRQ GH OeJOLVH FH
thme de la conversion-rconciliation, un sujet essentiel et
spcifique de la pastorale des divorcs remaris.

7. Loi divine et loi ecclsiastique


/DGpFODUDWLRQGX&RQVHLOSRQWLILFDOGHODQQpHVWL-
SXOH TXH OD SURKLELWLRQ IRUPXOpH SDU FH FDQRQ QDGPHW
DXFXQHH[FHSWLRQGXIDLWTXHOOHGrive de la loi divine.
J. Werckmeister 31 fait remarquer que cette affirmation pr-
VXSSRVH GXQH SDUW TXH OD ORL GLYLQH VRLW FODLUH  GDXWUH SDUW
TXHOOHQDGPHWWHHIIHFWLYHPHQWDXFXQHH[FHSWLRQ
2U H[SOLTXH ODXWHXU OH[DPHQ GHV WH[WHV ELEOLTXHV SDU
exemple les diffrentes interprWDWLRQVGHOLQFLVHPDWWKpHQQH
0W PRQWUHTXH OD ORL GLYLQHWHOOHTXHOOHHVW H[SULPpH
dans la Bible ne parat pas univoque. Ni les exgtes, ni la Tra-
dition des diverses glises ne concordent dans leur interpr-
tation. Le postulat selon lequel la Bible est claire sur ce sujet
parat un peu faible. En outre, note J. Werckmeister, en
citant pluVLHXUV H[HPSOHV OeJOLVH GDQV VRQ KLVWRLUH D GpMj
DEURJp RX QD SDV DSSOLTXp FHUWDLQHV ORLV ELEOLTXHV ; ce qui
parat contreGLUHFRQFOXWODXWHXUODIILUPDWLRQGXFDUDFtre
immuaEOH GH WRXWH ORL GLYLQH /D ORL GLYLQH QDGPHW-elle
aucune exception ? CerWDLQV VH GHPDQGHQW VLO HVW SRVVLEOH
GDSSOLTXHUOHVSULQFLSHVGHOpSLNLHHWGHOpTXLWpFDQRnique
DXFDVGHODGmission des fidles divorcs remaris la com-
munion eucharistique.
Selon P. G. Marcuzzi, la rponse est ngative, car il est
imposVLEOH GH FRUULJHU OD ULJXHXU GXQH ORL TXL QH GpSHQG

31. J. WERCKMEISTER, OLQWHUSUpWDWLRQGXFDQRQ , RDC 51/2.


SDV FRQVWLWXWLYHPHQW GH ODXWRULWp GH OeJOLVH Le fonde-
ment de ODSURKLELWLRQQHVWHQHIIHWSDVpWDEOLVXUXQHORL
simSOHPHQWKXPDLQHPDLVVXUXQHORLGLYLQH 32. La loi de
OXQLWp HW GH OLQGLVVROXELOLWp PDWULPRQLDOH QHQWUH SDV GDQV
le cadre des normes humaines et purement ecclsiales pour
lesquelles ces principes peuvent tre appliqus. La conscience
de chacun est lie sans exception par cette norme de droit
divin qui remonte au Seigneur lui mme, rappelle le cardinal
Ratzinger.

8. Le rle spcifique des pasteurs


Concernant la non admission la communion eucharis-
WLTXHWURLVWkFKHVLQFRPEHQWDX[SDVWHXUVGHOeJOLVH
)RUPHUOHQVHPEOHGHVILGqOHVFHVW--dire faire connatre
cette norme et sa signification dans la prdication, au cours
de la liturgie ou dans la catchse ; mais aussi largir la
rflexion pour aider une meilleure prise de conscience de
la signification de la communion eucharistique elle mme,
SDU H[HPSOH HQ UpIOpFKLVVDQW DX[ FRQGLWLRQV GXQH UpFHS-
tion digne et fructueuse de la communion eucharistique.
Alerter les fidles concerns : la dclaration du Conseil
ponWLILFDOSRXUOLQWHUSUpWDWLRQGHVWH[WHVOpJLVODWLIVGHMXLQ
2000 insistait sur ce point ( 3) : expliquer aux fidles con-
cerns OH YUDL VHQV HFFOpVLDO GH OD QRUPH GH VRUWH TXLOV
puissent la comprendre ou au moins la respecter .
Refuser la communion aux contrevenants : si les prcau-
WLRQV SUpFpGHQWHV QRQW SDV HX OHIIHW HVFRPSWp OH &RQVHLO
pontifical demande que le ministre refuse de donner la com-
munion qui est publiquement indigne . Nanmoins le
Conseil, au nom de la prudence pastorale, conVHLOOHGpYLWHU
TXHORQHQYLHQQHjGHVUHIXVSXEOLFVGHODFRPmunion, sauf
pour parer au risque de scandale.
La notion de scandale appelle trois constatations :
'XQHSDUWODQRWLRQGHVFDQGDOHFRQWLHQWHQHOOH-mme
deux dimensions, objective et subjective : selon les points de
YXHFHVWOXQHRXODXWUHGHQWUHHOOHVTXLHVWPLVHHQDYDQW

32. P. G. MARCUZZI, $SSOLFDWLRQGaequitas et epikeia , La Pasto-


rale des divorcs remaris, p. 95.
GDQV FH GpEDW VXU ORSSRUWXQLWp RX OD QpFHVsit du refus
public de donner la communion.
'DXWUH SDUW RQ SRXUUDLW VH GHPander si un certain
silence sur la prsence dans une communaut de fidles
divorcs remaris ne masque pas tout autre chose : la persis-
WDQFHGXQFHUWDLQVHQWLPHQWGHKRQWHTXLUDSSHOOHFHWWHFHUti-
WXGH GrWUH TXDVL damn , si prgnante il y a quelques
annes PDLVDXVVLODGLIILFXOWpSDUIRLVTXpSURXYHOeJOLVHHQ
certains pasteurs, se situer elle-mme face ces fidles pas
comme les autres , leur donner une parole claire sur leur
situaWLRQHWVXUFHTXHOOHDWWHQGGHX[SRXUOHELHn de toute
OeJOLVH
Enfin, le risque de scandale apparat accentu par la
mconnaissance de la signification ecclsiale de la norme et
plus gnralement par un manque de formation. De fait, ce
constat parat justifier la proposition, mise par le cardinal
RatzinJHU GXQH FODULILFDWLRQ j OLQWHQWLRQ GH OHQVHPEOH
des fidles. Au cours de la liturgie, dans la prdication ou
dans la catchse, pourrait tre abordes les questions rela-
tives la norme ecclsiale, mais galement le sens de la
communion eucharistique et de la communion spirituelle,
OLQGLVVROXELOLWp GX PDULDJH OD YDOHXU GH OD ILGpOLWp HQWUH
pSRX[DX&KULVWjOeJOLVHHWF

/DYRLHGHODEVWLQHQFHHXFKDULVWLTXH 33
/HXFKDULVWLHpWDQWOHOLHXHWOHPRPHQWGHODSOHLQHFRP-
munion DYHF OH &KULVW HW VRQ P\VWqUH FHVW ODEVWLQHQFH j
OpJDUGGHFHOOH-ci qui a t choisie pour manifester la contra-
diction avec la norme vanglique , rsume Xavier Lacroix
en introduisant sa prsentation de cette voie propose par
OeJOLVHTXLSRXU ODXWHXU peut tre vcue paisiblement et
FRPPHXQFKHPLQGDYDQFpHVSLULWXHOOH 34.
%LHQPHWWUHHQYDOHXUOHVUHVVRXUFHVGHFHWWHYRLHFHVW--
dire en dcouvrir son sens et sa signification spirituelle, ne

33'DQVODSUDWLTXHSDVWRUDOHFHUWDLQVSUpIqUHQWXWLOLVHUOH[SUHVVLRQ
jene eucharistique qui renvoie la notion de choix volontaire, tandis
que le terme GDEVWLQHQFH voque plutt la privation.
34. X. LACROIX, Face au divorce , Oser dire le mariage indissoluble,
p 213 et s.
SHXW TXDLGHU OHV ILGqOHV GLYRUFpV UHPDULpV accueillir la
norme ecclsiale. Certains diocses ont travaill dans ce sens.
On note par exemple, la mise en valeur de la communion
de dsir  FRPPXQLRQ VSLULWXHOOH DX &KULVW GDQV ODWWHQWH
de la communion eucharistique, comme le vivent par exem-
ple ceux qui, pour des raisons de distance ou de maladie,
QHSHXYHQWDFFpGHUjOHXFKDULVWLHHWTXLIDLWGLUHjFHUWDLQV
TXLOV QRQW MDPDLV DXVVL ELHQ FRPPXQLp TXH ORUVTXLOV QH
communient pas ; ou bien encore, le recours au tmoignage
GHV 3qUHV GH OeJOise ou des saints : tout est grce affir-
mait sainte Thrse de Lisieux 35 ; mais galePHQWjOH[Sp-
rience spirituelle des fidles divorcs remaris eux-mmes
qui livrent par oral ou par crit leurs propres tmoignages,
HW OHV IUXLWV UHoXV GXQ choix de fidlit ce que
GHPDQGHOeJOLVH : approfondissement du sens du sacrement
TXL QDXUDLW SDV HX OLHX VDQV FHWWH H[LJHQFH GDEVtinence,
dcouYHUWH GH ODWWLWXGH SURIRQGH GH communion au
Christ qui ne se rduit pas la consommation des saintes
espces, interpellation pour les proches sur leur faon de
vivre la communion, redcouverte de cette autre nourriture
TXHVW OD SDUROH GH 'LHX RXYHUWXUH j XQH LQWHUcession plus
grande pour tous ceux qui vivent cette situation (poux de
divorcs, GLYRUFpVUHPDULpVFKUpWLHQVGDXWUHVFRQfesVLRQV 
/H[SpULHQFHPRQWUHTXLOHVWSOXVIDFLOHGHPSUXQWHUFHWWH
YRLHGHODEVWLQHQFHHXFKDULVWLTXHORUVTXHOHVSHUVRQnes sont
accompagnes individuellement et communautairement dans
ce cheminement qui inclut bien souvent des dmarches spiri-
WXHOOHVGHFODULILFDWLRQHWGHJXpULVRQ/DFFRPpagnement spi-
riWXHOODUHQFRQWUHDYHFGDXWUHVTXLYLYHQWODPrPHVLWXDWLRQ
FRQVWLWXHQWGLQFRQWHVWDEOHVVRXtiens.

10. La rception de la norme : enjeux et difficults


Pour les fidles divorcs remaris, la rception de la
norme ecclsiale concernant la communion eucharistique
QHVW SDV WRXMRXUV IDFLOH PrPH VL FHWWH GLIILFXOWp GDFFXHLO

35. 6DQV GRXWH FHVW XQH JUkFH GH UHFHYRLU OHV VDFUHPHQWV PDLV
TXDQGOHERQ'LHXQHOHSHUPHWSDVFHVWELen quand mme. Tout est
grce (Carnet jaune 4,6,1. Cit dans Guy GAUCHER, Thrse Martin,
KLVWRLUHGXQHYLH, Cerf, 1995, p. 204).
QHVW SDV JpQprale. En tmoignent les ractions diverses
mentionnes dans un livre crit par quelques-XQV GHQWUH
eux, Nous, divorcs remaris 36 : pour certains, la communion
est ressentie comme un besoin dont ils ne souhaitent pas se
priver GDXWUHVDJLVVHQWVHORQOHXUFRQVFLHQFHFRQVLGpUDQW
TXH FHVW XQH KLVWRLUH HQWUH HX[ et Dieu  SRXU GDXWUHV
ODEVWLQHQFH HXFKDULVWLTXH QHVW SOXV SHUoXH FRPPH XQH
souffrance ou un manque, car ils ont acquis la conviction
TXH 'LHX OHV DLPH GXQH DXWUH PDQLqUH /XQH GHV GLIIL-
cults majeures dans cette rception est le caractre perp-
tuHOGHODEVWLQHQFHGHPDQGpH
Certains pasteurs, tel Mgr Le Bourgeois, constatent que,
ORUVTXHOHVILGqOHVGLYRUFpVUHPDULpVIRQWOHFKRL[GDFFXHLO-
lir la norme ecclsiale, leur attitude constitue pour les
autres chrtiens un vritable tmoignage 37 &pWDit gale-
ment la conviction des vques de la province du Rhin
suprieur 38. De quoi les fidles divorcs remaris peuvent-
ils tre les tmoins au sein de la communaut chrtienne ?
GH OD VLJQLILFDWLRQ SURIRQGH GX VDFUHPHQW GH OHXFKD-
ristie ou du sacrement de la pnitence ?
GXQFKHPLQHPHQWVSLULWXHOGHFRPPXQLRQDX&KULVW
HWjOeJOLVHjWUDYHUVODILGpOLWpHWOREpLVVDQFH ?
GXQDPRXUFRQMXJDOSOXVDXWKHQWLTXHRFFDVLRQQpSDU
ODQRXYHOOHXQLRQTXHORQVRXKDLWHGXUDEOHGpVRUPDLV ?
du sens et GHODYDOHXUGHOLQGLVVROXELOLWpGXPDULDJH ?
GXQFKHPLQGHFKDULWpHWGHYpULWpGHUHQDLVVDQFHHW
GKXPLOLWpDSUqVDYRLUWUDYHUVpOpSUHXYHHWODVRXIIUDQFH ?
Quant la communaut chrtienne dans son ensemble,
elle pourrait recevoir du tmoignage des fidles divorcs
remaris :
XQHLQYLWDWLRQjODSDUROHjXQHTXDOLWpGDFFXHLOLQGL-
viduel et communautaire,
une interpellation sur ce que chacun vit personnelle-
ment dans son mariage, dans sa faon de recevoir la commu-
nion eucharistique, de recourir au sacrement de la pnitence,

36. Nous, divorcs remaris , Descle de Brouwer 1996, cit dans


Monseigneur A. LE BOURGEOIS, Divorcs remaris mes frres, p. 43.
37. A. LE BOURGEOIS, Divorcs remaris mes frres, p. 97.
38. Lettre pastorale des vques allemands du Rhin suprieur , La
Documentation catholique, n2082, 1993, p 991.
mais aussi une invitation une comprhension renou-
YHOpH GHODGRXEOH H[LJHQFH FKUpWLHQQH GHODPRXUHWGHOD
YpULWpGHODYDOHXUGHOREpLVVDQFHDX&KULVWHWjOeJOLVHGH
la signification des sacrements.
Autrement dit, parce que leur prsence reconnue nces-
site et induit des clarifications, elle peut devenir une chance
pour la communaut toute entire. Encourager les fidles
GLYRUFpVUHPDULpVjDFFXHLOOLUODQRUPHHFFOpVLDOHSRXUTXLOV
puissent offrir la communaut toute entire leur tmoi-
gnage et vivre leur mission spcifique, et inversement, leur
laisser prendre cette place du tmoignage et de la mission
pour que la norme puisse tre davantage reue, tel est nous
semble-t-LO XQ FKHPLQ SRVVLEOH GHVSpUDQFH SRXU ODYHQLU

( suivre)

Claire SENON-DUPLESSIS
Facult de thologie catholique
Strasbourg
U
NE TUDE de l,QVWLWXWQDWLRQDOGpWXGHVdmo-
graphiques, signe de Mme France Prioux et
publie en avril 2006, souligne la grande diver-
sit des comportements matrimoniaux en Europe 1.
2QOHVDLWGDQVGLYHUVSD\VG(XURSHGRQWOD)UDQFHOHV
gnrations nes aprs la deuxime guerre mondiale ne
vivent plus comme les prcdentes. On doit parler non
GXQH VLPSOH pYROXWLRQ PDLV GXQH YpULWDEOH UXSWXUH /RUV-
que, vers 1970, ces gQpUDWLRQV VRQW DUULYpHV j OkJH GX
mariage, les courbes dmographiques classiques se sont
profondment modifies. Le nombre de mariages, qui tait
rest stable aussi loin que les statistiques existent (sauf les
priodes de guerre), a soudainement et fortement flchi.
En France, on est pass en une gnration de 417.000
mariages par an (en 1972) 254.000 (en 1995), soit une
baisse de 40 % en vingt ans. La cohabitation prnuptiale,
OXQLRQ OLEUH OHV QRXYHOOHV IRUPHV GXQLRQ WHO OH 3DFV se
sont largement rpandueVDXSRLQWTXDXMRXUGKXLSOXVGH
50 % des enfants naissent hors mariage (en 2007). Le
nombre de divorces a t multipli par cinq, passant en
France de 30.000 prs de 150.000 par an.

1. France PRIOUX, Vivre en couple, se marier, se sparer : con-


trastes europens , Populations et socits, n 422, 2006 (consultable sur
www.ined.fr). Nous avons arrondi les chiffres et simplifi les tableaux
pour en faciliter la lecture. Nous avons aussi ajout quelques chiffres,
SDUH[HPSOHVXUO,UODQGH2QWURXYHUDGDQVOpWXGHGH0PH3ULRX[GHV
tableaux dtaills et plus prcis, qui seuls font foi.
0DLVODVLWXDWLRQGHOD)UDQFHQHVWSDVFHOOHGHO(XUope
tout entire. /LQWpUrW GH ODUWLFOH GH 0PH 3ULRX[ HVW GH
montrer que ces volutions ne sont pas identiques GXQ
SD\VHXURSpHQjODXWUH(OOHGLVWLQJXHWURLVJUDQGHV]RQHV :
OHQRUGOHVXGHWOHVWGHO(urope, avec dans chaque zone
OXQHRXODXWUHexception.
CHVWGDQVOHVSD\VQRUGLTXHV, principalement la Sude,
que les modifications de comportement sont apparues, ds
les annes 1960. Puis elles se sont tendues progressive-
ment vers la Mditerrane. Mais RQOLJQRUHVRXYHQW les
diffrences entre, par exemple, la France HW OItalie restent
trs fortes.

6L ORQ SUHQG OH GpYHORSSHPHQW GH OD FRKDELWDWLRQ SUp-


nuptiale, les chiffres sont particulirement loquents : en
Sude, 90 % des couples ont cohabit avant leur mariage,
contre seulement 10 % en Italie. Le tableau 1 montre
clairement deux groupes : celui des pays mditerranens
(Italie, Espagne, Portugal) et celui des pays du Nord (Sude,
Finlande, Autriche, etc.).
/HVSD\VGHO(VWVHVLWXHQWHQWUHOHVGHX[ SDUHxemple la
Rpublique tchque). Leurs comportements matrimoniaux
ont chang GHSXLV OD ILQ GH O8566 PDLV FHV pYRlutions,
trop rcentes, sont encore mal connues.
La Pologne fait exception : pays du Nord, elle ne connat
presque pas la cohabitation prnuptiale. On pourrait consi-
drer que la France aussi fait exception : pays mditer-
ranen, elle se comporte comme les pays du Nord.
Comme on le voit aussi dans le tableau 1, les volutions
sur une vingWDLQH GDQQpHV IHPPHV QpHV HQ  HW
femmes nes en 1970) ont t spectaculaires. En France, la
cohabitation prnuptiale est passe en vingt ans de 20 %
80 %. Elle se dveloppe rapidement mme dans les pays o
elle demeure minoritaire : en Italie, elle est passe de 3 %
10 %, en Espagne de 3 % 20 %, etc.
En Sude, seules 2 % des femmes ges de 25 ans vivent
HQFRUHFKH]OHXUVSDUHQWVDORUVTXHQ,WDOLHHOOHVVRQW %.
Ces diffUHQFHVFRQVLGpUDEOHVVH[SOLTXHQWVDQVGRXWHHVWLPH
Mme Prioux, par des lments matriels (difficult de trou-
YHUXQORJHPHQW PDLVVXUWRXWSDUOHIDLWTXHQ(XURSHGX
Nord, on se met en couple avant de se marier (donc tt),
DORUVTXHQ,WDOLHHWGDQVOHVDXWUHVSD\VPpGLterranens, on
ne quitte majoritairement le foyer parental que pour se
mDULHU GRQF WDUGLYHPHQW SXLVTXH OkJH DX PDULDJH DXJ-
mente). Mme Prioux parle de mariages directs , encore
largement majoULWDLUHV GDQV OHV SD\V GX VXG DORUV TXLOV
sont devenus rares dans les pays du nord (sauf la Pologne).

/DFRKDELWDWLRQQHVWSDVWRXMRXUVSUpQXSWLDOH ; elle con-


duit de moins en moins souvent au mariage. L aussi, les
diffrences entre les pays sont importantes. Le tableau sui-
vant montre le taux de clibat dfinitif des femmes nes en
1965, selon unHSURMHFWLRQGX&RQVHLOGHO(XURSH RQFRQ-
VLGqUH VWDWLVWLTXHPHQW TXXQH IHPPH HVW GpILQLWLYHPHQW
FpOLEDWDLUHVLHOOHOHVWjOkJHGHDQV 

Tableau 2 : Clibat dfinitif des femmes nes en 1965

Pologne 12%

Espagne 15%

Italie 17%

Pays-Bas 22%

Suisse 23%

Autriche 24%

France 27%

Finlande 28%

Sude 39%

Le taux de clibat naturel FHVW--dire incompressible


(personnes malades KDQGLFDSpHV HWF  HVW GHQYLURQ  %.
Dans la gnration ne en 1945, le taux tait effectivement
infrieur 10 % dans tous les pays europens, sauf la Sude
(13 %).
Vingt ans plus tard, dans la gnration ne en 1965, ce
taux est pass partout au-dessus de 10 %, sauf en Grce et
en Rpublique tchque (8 %). Il atteint prs de 40 % en
Sude, prs de 30 % dans de nombreux autres pays, dont la
)UDQFH /HV SD\V GH O(st sont les moins touchs, avec des
taux autour de 10 %. Les pays mditerranens sont modr-
ment concerns, autour de 15  PDLV OkJH DX SUHPLHU
mariage y a beaucoup recul.
Des premires unions plus tardives, des unions qui
prennent de plus en plus souvent la forme de cohabita-
tions, et des cohabitations qui se transforment de moins en
moins souvent en mariage, sont les trois composantes du
dclin de la nuptialit en Europe , conclut Mme Prioux.
Les statistiques concernant la divortialit sont bien con-
nues (tableau 3). La diffrence nord-sud est trs marque
avec un taux de 55 divorces pour 100 mariages en Sude et
de 13 % en Italie. Mais le cas du Portugal, qui est pass en
quelques annes de 8 % 32 %, oblige nuancer les
conclusions : les pays mditerranens sont de plus en plus
FRQFHUQpVDXVVLPrPHVLOVQDWWHLJQHQW pas les chiffres nor-
diques.

Tableau 3 : Nombre de divorces pour 100 mariages

Italie 13
3

Irlande 16

Pologne 20
15

Portugal 32
8

Pays-Bas 33
25

42 2003
Suisse 27 1980
Autriche 43
26

France 43
23

Tchquie 48
31

Finlande 51
28

Sude 55
42

Une des explications de ces diffrences se trouve dans les


lgislations en la matire. Ainsi, les pays mditerranens
QRQWDGRSWpOHGLYRUFHTXDXFRXUVGHVDQQpHVDORUV
que la France, par H[HPSOH ODYDLW LQWURGXLW GqV 
VXSSULPpHQHWUpLQWURGXLWHQ/,UODQGHROH
GLYRUFH QD pWp OpJDOLVp TXHQ  D GpMj GpSDVVp O,WDOLH
avec un taux de 16 divorces pour 100 mariages en 2004.
/,WDOLH SDUDvW GRQF OH SD\V OH PRLQV WRXFK. Mais il
faudrait en ralit ajouter aux divorFHVOHVGpFODUDWLRQVGLQ-
validit prononces par les tribunaux ecclsiastiques et
enregistres par les tribunaux civils italiens. Ces nullits
civilement enregistres, mme si elles sont juridiquement
difIpUHQWHV GXQ GLYRUFH DERXWLVsent au mme rsultat
dmographique ODUXSWXUHGXQHXQLRQ 2.
Mme Prioux signale que les mariages qui ont t prc-
GpVGXQHFRKDELWDWLRQDERXWLVVHQWGHX[IRLVSOXVVRXYHQWj
un divorce que les mariages directs  /Hxplication de ce
phnomne a priori surprenant a t donne par diverses
enqutes : il existe deux modles de mariage. Dans le
modle traditionnel, on se marie jeune, sans cohabitation
prnuptiale, et on divorce peu. Dans le modle moderne,
on cohabite, on se marie tard, on divorce facilement. Ainsi,
VHPDULHUMHXQHHWVDQV FRKDELWDWLRQSUpDODEOH QHVWSDV HQ
soi un gage de dure, mais cela correspond une mentalit
(qui tend disparatre) dans laquelle le divorce est quasi
exclu.

*
* *

La conclXVLRQJpQpUDOHGH0PH3ULRX[HVWTX en dpit de
tendances communes, les modes de vie en couple et la dure
des unions revtent encore une grande diversit en Europe .
Il resterait expliquer ces diffrences. Les volutions lgis-
latives y ont leur SDUW RQ OD YX PDLV FRPPH LO HVW ELHQ
FRQQXOHVORLVVXLYHQWOHVPXUVDXWDQWTXHOOHVOHVRULHQWHQW
/HVORLVQH[SOLTXHQWGRQFSDVWRXW
(QSDUWLFXOLHULOVHUDLWLQWpUHVVDQWGHFRQQDvWUHOLQIOXHQce
du facteur religieux : les diffrences nord-sud sH[SOLquent-
elles, au moins partiellement, par le clivage protestants-
catholiques " /H[HPSOH GH OD 3RORJQH SD\V GX QRUG qui

2. (Q  O,WDOie a compt quelque 47.000 divorces civils. Nous


QDYRQVSDVWURXYpOHQRPEUHGHQXOOLWpVFDQRQLTXHVD\DQWHIIHWFLYLO
offre la plus grande rsistance ces nouveaux comporte-
ments SRXUUDLWOHIDLUHFURLUH 0PH3ULRX[UHOqYHGDLOleurs
que la Pologne est trs catholique ).
Mais le cas de la France, pays mditerranen majorit
catholique, qui volue comme les pays protestants du nord,
montre que la religion ne joue pas ncessairement un rle
dterminant. Encore faudrait-il prciser que la )UDQFHQHVW
pas seulement un pays mditerranen ; elle est historique-
ment et culturellement partage entre nord et sud. Et elle
QHVW SHXW-tre plus vraiment un pays majorit catho-
lique .
6LORQSUHQDLWHQFRPSWHGDXWUHVFKLIIUHVFRPPHFHX[
de la natalit, on verrait que la religion ne joue pas, ou ne
joue plus, un rle prpondrant sur les comportements. Les
pays mditerranens ne sont pas ceux qui suivent le mieux
OD PRUDOH FDWKROLTXH HQ OD PDWLqUH SXLVTXH O,WDOLH HVW XQ
GHVSD\VG(XURSe o la natalit est la plus faible (moins de
HQIDQWVSDU IHPPH DORUVTXHOOHHVWODSOXVIRUWHGDQV
les pays du nord (Irlande, Norvge, Finlande, Pays-Bas,
Danemark, Royaume Uni, Sude). La France, l encore, se
rapproche plutt du nord que du sud, puisTXHOOH VH VLWXH
au deuxime rang en Europe avec un taux proche de 2,0,
immdiatement derULqUHO,UODQGH,OHVWYUDLTXHplus de la
moiti de ces enfants naissent, en France, hors mariage, ce
qui explique peut-tre cela : en Italie, o la cohabitation
hors PDULDJHHVWSHXUpSDQGXHHWRORQVHPDULHWDUGOD
fcondit est faible  HQ )UDQFH RX HQ 6XqGH R ORQ
cohabite et procre hors mariage, la fcondit est forte 3.
Il semble que, aussi bien pour le divorce que pour la
natalit, le facteur dominant soit la situation conomique,
HQSDUWLFXOLHUOHPSORLGHVIHPPHV

Jean WERCKMEISTER

3. Le pays europen o la proportion de naissances hors mariage est


ODSOXVIRUWHHVWO,VODQGHDYHFXQWDX[GH %.
Ren HEYER, La Condition sexue, Paris, Presses universitaires
GH)UDQFHeWXGHVGKLVWRLUHHWGHSKLORVRSKLHUHOLJLHXVHV
2006, 173 pages.
/RXYUDJHTXH5HQp+H\HU 1 vient de publier aux Presses uni-
versitaires de France a trait aux alas historiques et aux enjeux
sociaux de la condition sexue . Cet essai vise anthropolo-
gique est original plusieurs titres.
/DUpIOH[LRQHVWFHOOHGXQPRUDOLVWHUpWLIDXFRQFRUGLVPHDX
PRUDOLVPHHWjODSRORJpWLTXHODUYpVDX[TXHOVVDEDQGRQQHnt bien
des thologiens qui abordent la question de la sexualit. Le choix
GHOpGLWHXUJDUDQWLWjFHWpJDUGODMXVWHVVHGXQpFULWTXLVHQWLHQW
DX[IDLWVHWjODQDO\VHGHODORJLTXHGXGLVFRXUVFKUpWLHQ
/DXWUHRULJLQDOLWpGXOLYUHWLHQWjODTXDOLW de son criture. La
SOXPHGHODXWHXUDOHUWHHWVHUUpHPDQLIHVWHODPDvWULVHGHODODQgue
HWFHOOHGXQHTXHVWLRQTXL DXUDQRXUULDXWDQWGH FRQWURYHUVHV TXH
celles qui furent rgles aux conciles de Nice et de Chalcdoine.
La troisime spcificitpGHORXYUDJHWLHQWjODILQHVVHGXSUR-
pos et la prudence de Ren Heyer. On relve en effet pas moins
de neuf mentions du comme si , cher Kant, dans un crit qui
allie la rigueur la circonspection et qui exige de son lecteur atten-
tion et persvrance.
/HVVDL FRPSRUWH FLQT SDUWLHV DX[TXHOOHV VDMRXWHQW HQ DQQH[H
WURLVFRQWULEXWLRQVVXVFHSWLEOHVGDSSRUWHUXQFRPSOpPHQWGLQIRU-
mation certaines notions (la formation du lien du mariage chez
Gratien ; aspect du fminisme en thologie ; questions sur la figure
paternelle). Une brve introduction plante le dcor. En voici
OLQFLSLW : mancipation des femmes, libration sexuelle, affirma-

1. Ren Heyer est membre du Comit de rdaction de la Revue de


droit canonique.
tion publique des unions homosexuelles : ces trois mouvements se
VXLYHQWDYHFXQVXFFqVVLODUJHTXRQHQ oublierait quel point leur
reconnaissance est rcente (p. 1). Ces nouveauts qui ne rel-
vent pas des caprices passagers de la mode branlent une tradi-
tion chrtienne peu prpare prendre en compte les ruptures
TXHOOHDSDUDGR[DOHPHQWUHQdu possibles.
/H&KULVWGHOeYDQJLOHDVVXUpPHQWQHSDUOHSDVGHVH[HPDLV
OKLVWRLUH GH OeJOLVH PRQWUH TXH FHOOH-FL QH VHVW SDV ODVVpH GH
manifester son intrt pour celui-l. Cette curiosit pour la chose
VH[XHOOHDXUDLPSRVpOLGpHGHGLIIpUHQFHODTXHOOHQDSDVFHVVpGH
troubler le sommeil des thologiens aprs avoir engendr les rves
des philosophes et nourri les questions des gouvernants.
3DUFHTXHOKRPPHHVWXQ tre social (p. 9) qui se reproduit,
il faut rpondre ces questions. Et pour ce faire, on commence
par ordonner et dfinir les termes utiliss : sexuation au niveau de
OKXPDQLWp VH[XDOLWp DX QLYHDX GH OLQGLYLGX VH[H HW JHQUH DX
niveau de la socit. Pour Ren Heyer, il est cependant bien
entendu que ces derniers termes ne sont ULHQ GDXWUHV TXH GHV
catJRULHV >@ XWLOLVpHV SDU OD VRFLpWp GDQV VHV UHSUpVHQWDWLRQV
(p. 11).
&HODpWDQWODXWHXUSDUWGXPRXYHPHQWIpPLQLVWHTXLUHYHQdi-
TXHOpJDOLWpGHVVH[HVDILQGHPHWWUHILQDX[GLVFULPLQDWLRQVVRFLD-
OHVGRQWOHVIHPPHVQRQWSDVFHVVpGrWUHOREMHWDXFRXUVGHOKLV-
WRLUH&HSRLQWGHGpSDUWODPqQHjPHWWUHHQDYDQWOH principe de
non-discrimination (p. 3) qui JRXYHUQHORUGUHSROLWLTXHGHQRV
socits (quatrime de couverture). La revendication fministe
QHVWSDV sans ressemblance avec la prdication de s. Paul annon-
ant aux chrtiens : LO Q\ D QL KRPPH QL IHPPH ; car vous ne
IDLWHVTXXQGDQVOH&KULVW-pVXV (p. 20).
/HQTXrWH TXL GHYUDLW FRQILUPHU XQH WHOOH DIILUPDWLRQ REOLJH
cependant reconnatre que, GHO$QWLTXLWpDX[WHPSVPRGHUQHV
OpJDOLWp SROLWLTXH GHV VH[HV HVW GHPHXUpH XQ YX SLHX /pJDOLWp
devant Dieu serait-elle moins sujette caution ? Les chrtiens,
certes, posent une galit inne devant Dieu (47) et celle-ci
intJUH OpJDOLWp GHV Vexes fonde sur le mariage. Mais cette der-
nire demeure secrte, rserve au face face des conjoints. Il
faudra attendre la constitution de 1791 pour que le contrat civil
UDWLILH OpJDOLWp GHV SDUWLHV FRQWUDFWDQWHV HW FRQVDFUH DLQVL OpJDOLWp
prive des femmes et des hommes en justifiant la non-discrimina-
tion qui aura incub si longtemps (p. 54).
/DWURLVLqPHSDUWLHGHORXYUDJHLQWLWXOpH /HVH[HOkPHHWOH
plaisir (p.   FRPPHQFH SDU UDSSHOHU OpSLVRGH URFDPEROHVTXH
du prtendu concile de 0kFRQ TXL DXUDLW VXVSHFWp OH[LVWHQFH GH
OkPH GH OD IHPPH /DQHFGRWH SHUPHW j ODXWHXU GH VRXOLJQHU OH
primat de la grammaire sur la valeur dnotative des mots. Un tel
SULPDW OXL SHUPHW GLQWURGXLUH OD SUREOpPDWLTXH GX JHQUH TXL
enfivre les cours et les bureaux de la Curie romaine. Et si aujour-
GKXL OH VH[H VH UpIqUH j OD ELRORJLH VLJQDQW OLQFRPPHQVXUDELOLWp
LQKpUHQWHDXELSDUWLVPHVH[XHOLOIXWXQWHPSVROXWLOLVDWLRQGX
masculin et du fminin SHUPLWHQWDQWTXHJHQUHGXWLOLVHUOHVFRQ-
traires du plus et du moins pour justifier la libido dominandi
des mles.
/DOLELGRVHUpIpUDQWDXSODLVLULOFRQYLHQWGHSDVVHUjOpWXGHGX
SODLVLU VH[XHO 3RXU O$QWLTXLWp SODLVLU VH[XHO HW SODLVLUV GH OD WDEOH
sont analogues, gros de tous les excs. La morale est donc une
affaire de bon usage (p.  HWGpTXLOLEUHOHVTXHOVLPSOLquent la
YHUWX GHV PDvWUHV OLpV SDU ODPLWLp RSSRVpH j ODPRXU ,O IDXGUD
DWWHQGUH .DQW HW 5RXVVHDX SRXU TXH ODPRXU VH YRLH LGHQWLfi au
penchant sexuel et le plaisir au plaisir sexuel (p. 75). Rousseau
invente le PDULDJH GDPRXU (p. 79)  RQ VH PDULH SDUFH TXRQ
DLPH HW TXDQG RQ DLPH RQ VRXYUH j ODXWUH j ODXWUH VH[H TXL IDLW
SDVVHU OH SXFHDX LPSXEqUH GH ODPRXU-propre la relation sociale.
&HVWDLQVLTXH surgit DXFXUPrPHGHODSROLWLTXH>@OpFODWGH
OLQWLPHODMRXLVVDQFHGHODXWUH (p.  HQWDQWTXDXWUHMRXLVVDQFH
/DGHUQLqUHSDUWLHGHORXYUDJHSUpFLVHOHU{OHGXFKULVWLDQLVPH
GDQV OKLVWRLUH GH OD SHQVpH HW GHV SUDWLTXHV VRFLDOHV SURSUHV
O2FFLGHQW&HU{OHHVWFHOXLGXQGpSODFHPHQWTXLjOLQWpULHXUGX
chrisWLDQLVPHPpQDJHUDODSRVVLELOLWpGHVRXYULUDXPRQGH'qVOH
2e VLqFOHODFDXVHGHFHTXLHVWYpFXFRPPHODIUDJLOLWpGHOKRPPH
est dporte de la mort au sexe. Ce dplacement permet de passer
GH OLUUpPpGLDEOH DX SRVVLEOH /D JHVWLRQ GX VH[H SHXW GqV ORUV
VRUJDniser et permettre de matriser une chair voue au drgle-
PHQW &HVW SRXUTXRL OkPH OD YRORQWp HW O(VSULW VRQW LQYRTXpV
tour tour pour conjurer la fragilit et les drives du sexe, pour
GpWDFKHU OKRPPH GH VD nature physique (p.   HW ORXYULU j
OXQLYHUVHO&HWWHGp-QDWXUDWLRQQHVWQLPDQLFKpHQQHQLHQFUDWLVWH ;
OHVVDFUHPHQWVHQWpPRLJQHQWTXLFRQMXJXHQWOHFRUSVHWO(VSULW
Baptme et pnitence, mariage et eucharistie prolongent le
dportePHQWLQLWLDOTXLDYDLWGpSODFpODFFHQWGXFRUSVPRUWHOYHUV
le corps sexu (p. 103).
/DSSRUWGXFKULVWLDQLVPHQHVHOLPLWHSDVjODVHXOHUpKDbilita-
tion du corps. De s. Augustin s. Thomas, la thologie y ajoutera
la notion de relation subsistante qui permet de penser aussi
bien la structure relationnelle de la famille que celle du sujet. Ainsi,
tout sujet humain, tant la fois sexu et de condition filiale ,
(p.   YRLW VRXYULU GHYDQW OXL une SURPHVVH TXL VDWWDFKH DX
rapport parental et au rapport conjugal (p. 112). Cette promesse
HVW OHIIHW GH OD OHFWXUH FDU VL OH VXMHW HVW XQ VXMHW TXL SDUOH LO OLW
aussi sa propre fragilit, interprte les lois de la nature pure et
dcrypte les traces vnementielles de ce qui arrive (p. 121). Et
quoi sommes-nous convis ? dpasser la mal-GLFWLRQ GXQH
chair dclare pcheresse, pour reconnatre que le pch de
OKRPPH FRPPHFHOXLGHODQJH consiste refuser la possibi-
lit de continuer pouvoir choisir en se rfugiant dans ODVVX-
rance immobile de savoir (p. 123).
%UHI OKRPPH FRPPH ODQJH HVW DSSHOp j GpSDVVHU VD QDWXUH
Mais cet appel demeure un questionnement. Celui-ci invite pour-
suivre une lecture qui mne vers une altrit dont la substance
est relation (p. 131), ouverte sur une intimit abyssale qui entame
aussi bien les thories morales que les productions thologico-
politiques.
Roland SUBLON

Anne JENSEN, Femmes des premiers sicles chrtiens, Berne, Peter


Lang, 2002 (Traditio christiana XI), LXXII et 316 p. Ver-
sion franaise par Grard POUPON. ISBN 3-86577-101-7.
Publi dans la collection Traditio christiana , ce recueil de
textes chrtiens antiques en suit les principes directeurs, avec quel-
ques amnagemenWV$SUqVDYRLUSUpVHQWpORUJDQLVDWLRQGXUHFXHLO
et ses thmatiques dans une introduction claire et substantielle,
ODXWHXUSURSRVHSUqVGHFHQWFLQTXDQWHH[WUDLWVGHORQJXHXUYDULD-
ble, regroups en quatre sections. Dans la premire ont t runies
des esquisses de biographies fminines, prsentant des femmes
aptres, prophtesses, martyres, asctes, veuves et diaconesses,
docteures, pouses et mres. Parmi les crits des martyres figure
videmment le rcit de Perptue, une des premires autobiogra-
phies fminines connues, et parmi les textes des asctes, le journal
GeJpULH La deuxime section offre un aperu suggestif sur des
thories qui ont eu cours chez les chrtiens concerQDQWOLGHQtit et
le salut des femmes : ve et Marie, galit et ingalit entre homme
et femme, les doutes entretenus par certains crits chrtiens sur la
SRVVLELOLWpSRXUOHVIHPPHVGrWUHLPDJHGH'LHXSXLVGHVH[WUDLWV
VXUODSURMHFWLRQGHOLGpDOPDVculin, la femme virile , et enfin des
tmoignages sur la hirarchie des sexes et la division du travail. La
troisime section fait connatre cinq figures exemplaires : Proba,
XQH SRpWHVVH FKUpWLHQQH URPDLQH GRQW OXYUH HQWUH  HW  
fut trs lue, mais nullement recommanGpHSDUODXWRULWpHFFOpsiasti-
TXHSXLV0DFULQHODVXUGHVVDLQWV%DVLOHHW*UpJRLUHGH1\VVH
0DUFHOOD ODVFqWH URPDLQH TXL DSSDUtenait au cercle hironimien,
Olympias, la diaconesse de ConstantiQRSOH HW 3XOFKpULH OLPSpra-
trice. La littrature explorer est immense Oauteur a d procder
j XQH VpOHFWLRQ ULJRXUHXVH (OOH OD IDLW HQ IRQFtion des thmes
reteQXV HW VHORQ FH SULQFLSH TXHOOH pQRQFH GDQV OLQWURGXFWLRQ :
On donnera la prfrence des textes parlant de manire positive
des femmes et avant tout des textes rdigs par des femmes et
UHQVHLJQDQW GLUHFWHPHQW VXU OLGpH TXHOOHV DYDLHQW GHOOHV-mmes
(p. XIV). On le sait, les textes ngatifs ne manquent pas, com-
mencer par le Nouveau Testament, dont tous les extraits concerns,
positifs et autres, ont t transFULWVHQWrWHGHODQWKRlogie (p. 2-15).
La littrature canonique est bien reprsente dans le choix des
extraits : conciles, canons de diverses provenances et attributions,
recueils de traditions apostoliques, rglements sur les ministres,
etc. La lecture du volume est trs stimulante, elle permet aussi de
dcouvrir des documents peu connus, elle contribuera certai-
nement renouveler les mentalits dans le domaine concern.
Marcel METZGER

Kanon XVII (2005), Frauenrollen & Frauenrechte in der Euro-


pischen Orthodoxie, herausgegeben von Eva SYNEK, XII et
306 p. [ISBN 3-86577-100-9].
/HQWUHSULVH D FRPPHQFp RIILFLHOOHPHQW j $WKqQHV HQ VHSWHP-
EUHORUVGXQFRQJUqVPpPRUDEOHTXLIXWOHTXDWRU]LqPHGHOD
Socit pour le Droit des glises orientales. Le thme en tait : la situation
des femmes dans les glises orientales selon le droit canonique. Les
seize contributions qui y furent prsentes ont t publies dans
Kanon XVI (2000), sous le titre Mutter, Nonne, Diakonin, Frauenbilder
im Recht der Ostkirche (Mre, moniale, diaconesse, modles fminins
GDQVOHGURLWGHOeJOLVHRULHQWDOH  Les perspectives taient la fois
historiques et actuelles. Les contributions couYUDLHQWOHQsemble des
situations prises en compte dDQVORUJDnisation des glises : le statut
des femmes en droit canonique, les normes les concernant pour le
mariage et la famille, le diaconat fmiQLQ MDYDLVpWpLQYLWpjLQWHUvenir
sur ce sujet, voir p. 144-166), le monachisme fminin, les pouses des
clercs, la participation des femmes aux activits catchtiques et
thologiques. La cheville ouvrire du conJUqVHWPDvWUHGXYUHGHOD
publication, Eva M. Synek, a elle-mme prsent et publi une impor-
tante contribution sur la rception eWOpYROXWLRQGDQVOHVeJOLVHVGHV
REVHUYDQFHVGLQVpiration vtrotestamentaire, imposes aux femmes
pendant les menstrues et aprs un accouchement.
/HQVHPEOH GH FHV UHFKHUFKHV D pWp SRXUVXLYL V\VWpPDWLque-
PHQWjO,QVWLWXW'URLWHW5HOLJLRn (nouvel intitul : Philosophie du
droit, Religions et Culture) de Vienne, par un sminaire dirig par
Richard Potz et Eva M. Synek, qui a men des enqutes et recueilli
des contributions concernant huit glises orthodoxes : Grce,
Chypre, Finlande, Roumanie, Russie, Serbie, Bulgarie, la huitime
glise comprenant les parchies de la Rpublique tchque et de la
Slovaquie qui, malgr la sparation politique, sont restes runies.
/H UpVXOWDW GHV UHFKHUFKHV YLHQW GrWUH SXEOLp GDQV Kanon XVII.
Pour chaque gOLVHOHQTXrWHDSRUWpVXUOHVPrPHVWKqPHVTXDX
conJUqVG$WKqQHVpQXPpUpVFL-dessus, et, en outre, sur la partici-
pation des femmes la gestion des glises et paroisses, sur les
QRUPHVHQYLJXHXUSRXUODFFqVGHVIHPPHVDXVDQFWXDLUHGDQVOHV
glises et sur les fonctions liturgiques ouvertes aux femmes dans
les monastres et dans les paroisses.
3DUOHQVHPEOHGH FHV H[SRVpVFHUHFXHLOIRXUQLWSDU XQHGRFX-
mentation prcise et de premire main, les informations ncessaires
la connaissance de ces glises, dcrivant leur organisation et les con-
textes socio-politiques. En effet, chaque glise est prsente par son
histoire particulire et dans sa situation actuelle. La prsentation de
OeJOLVH UXVVH HVW SDUWLFXOLqUHPHQW GpYHORSSpH VWDWLVWLTXHV j ODSSXL
Celles des glises de Grce et de Chypre informent en dtail sur les
institutions paroissiales. propos des pays jadis sous rgime commu-
QLVWHRQH[SOLTXHDXVVLFRPPHQWOHVeJOLVHVVLQYHVtissent de plus en
plus dans le domaine sRFLDO SDUFH TXH OHV eWDWV VHQ GpJDJHQW HW
comment elles grent les questions de biothique, en tenant compte
pasWRUDOHPHQWGHVPXUVDGPLVHVVRXVOHVUpJLmes athes.
De ce fait, la prsentation de chaque glise dans son histoire per-
PHWGDSSUpFLHUFomment ces communauts chrtiennes, et plus pr-
cisment des groupes et des mouvements de femmes orthodoxes, ont
pu faire voluer la discipline dans des situations souvent difficiles et
ODGDSter : invasions du pays et annexions, occupation ottomane,
priode sovitique (importance des femmes dans la transmission de la
foi), retour la libert religieuse, invasion de la culture consumriste,
apports des mouvements fministes modernes, etc.
/DSXEOLFDWLRQGHFHVpWXGHVDSSRUWHXQpFODLUDJHFXPpnique
la pratique du droit canonique, car on y dcouvre comment, dans
ORUWKRGR[LH FHV GHX[ SULQFLSHV GH EDVH TXH VRQW ODXWRnomie (le
FDV pFKpDQW ODXWRFpSKDOLH  HW OD V\QRGDOLWp SHUPHWWHQW DX[ eJOLVHV
GpYRluer localement, dans la souplesse, sans tre obliges, du moins
dans les domaines dcrits, de solliciter des autorisations de la part
GLQVtances lointaines ni de rsoudre de faon uniforme des difficul-
ts locales. De ce fait, un tel fonctionnement stimule la prise de res-
ponsabilit divers chelons, pour faire voluer la discipline et
ODGDSWHUjGHVVLWXDWLRQVQRXYHOOHVVHORQOpYROXWLRQGHVVRFLpWpV/HV
mouvements de femmes orthodoxes sont pleinement engags dans
cette dynamique et proposent des adaptations canoniques signi-
ficatives, que leurs homologues catholiques osent peine imaginer,
FRPPHORQFWLRQGHVPDODGHVGDQVFHUWDLQHVVLWXDtions (p. 8-9).
En Finlande, o la parit entre hommes et femmes est inscrite
GDQV OHQVHPEOH GHV LQVWLWXWLRQV FLYLOHV OHV eJOLVHVQH SHXYHnt se
droEHUHWOHVLQVWLWXWLRQVRUWKRGR[HVV\VRQWDGDSWpHVHOOHVDXVVL
eYLGHPPHQWXQWHOFRQWH[WHSRVHjOeJOLVHRUWKRGR[HODTXHVWLRQ
GHORUGLQDWLRQGHVIHPPHV S 120). 2UOeJOLVHGH*UqFHTXDQWj
elle, a dj rtabli le diaconat fminin, du moins et pour le moment
dans les monastres, par une dcision du Saint Synode en date du 8
octobre 2004 (voir p. VIII, IX, 6-8, 85-87).
Ce volume de Kanon XVII HWOpTXLSHGHUHFKHUFKHTXLODSXEOLp
VLQVFULYHQWGDQVOHFDGUHGHV Gender Studies , ou Genderfors-
chung (p. VII). cet effet, la contribution de A. M. Himmel-Agis-
burg, place en tte du volume (p. 3- UHWUDFHOKLVtoire des mou-
vements de femmes orthodoxes, en prsentant la srie des conf-
rences et consultations panorthodoxes qui en ont constitu les pre-
mires tapes (Agapia 1976, Rhodes 1988, Crte 1990), puis les
autres rencontres qui ont contribu tisser un rseau actif. Les
documents correspondants sont produits en annexe.
Deux tudes historiques compltent le recueil et enrichissent son
DUJXPHQWDLUH/DSUHPLqUHUpGLJpHSDU0PH6\QHNpWXGLHOH[HUcice
du pouvoir par des impratrices et des rgentes Byzance, comme
Irne (790, 797-802), avec des implications videntes dans le domaine
religieux. La seconde, due ) 6FKLSSHU DSHUoRLW ORULJLQH HW OHV
premiers dveloppements des monastres mixtes dans des engage-
ments familiaux, entranant toute la maisonne dans la vie monasti-
que, comme le rvle la Vie de sainte Macrine, crite par son frre,
Grgoire de NyVVH YRLUOpGLWLRQ6RXUces chrtiennes, n 178).
/LQWpUrW GH FH UHFXHLO Kanon XVII, est encore accru par les
nombreuses informations rares que le canoniste peut glaner au
ORQJGHVSDJHV2QDSSUHQGDLQVLTXHQ5XVVLHMXVTXDXe sicle,
la clbration religieuse du mariage tait considre comme un pri-
viOqJH GH OD QREOHVVH HW TXH OH SHXSOHVHQ WHQDLW j GHVFRXWXPHV
ancestrales (p. 156). Mais on dcouvre surtout la place faite aux
lacs, hommes et femmes, dans la gestion des institutions des gli-
ses orthodoxes. Une autre publication est venue confirmer et com-
plter ces informations : Le Concile de Moscou (1917-1918), de Hyacin-
WKH 'HVWLYHOOH 3DULV &HUI   0DLV OD FRQQDLVVDQFH GH O$Qti-
TXLWpQHVWSDVHQUHVWHSXLVTXHODFROOHFWLRQ Traditio christiana
(Peter Lang, Berne, 2002) propose un volume sur les questions
abordes ici, Femmes des premiers sicles chrtiens, de Anne Jensen.
Marcel METZGER

Eva M. SYNEK, :HUDEHUQLFKWY|OOLJUHLQLVWDQ6HHOHXQG/HLE .


Reinheitstabus im Orthodoxen Kirchenrecht, Egling (Wien), Edi-
tion Roman Kovar, 2006 (Kanon, Sonderheft 1), XIV et
187 p. ISBN 3-86577-101-7.
4XDQWDX[IHPPHVHQSpULRGHPHQVWUXHOOH>@VLHOOHVVRQW
FUR\DQWHVHWSLHXVHVHOOHVQRVHURQWHQFHWpWDWQLVDSSURFKHUGHla
WDEOH VDLQWH QLWRXFKHU DX FRUSV HW DX VDQJ GX &KULVW>@ &HOXL
TXLQHVWSDVHQWLqUHPHQWSXUGkPHHWGHFRUSVVHUDHPSrFKpGH
VDSSURFKHUGXVDLQWHWGXVDLQWGHVVDLQWV &HWH[WUDLWGXQHOHWWUH
GHOpYrTXH'HQ\VG$OH[DQGULH HQ DLQVSLUpOe titre de cette
publication. La lettre a t reue dans la collection des canons des
Pres (concile In Trullo 691, canon 2 ; textes dans P.-P. JOAN-
NOU, Discipline gnrale antique, 1, 1, p. 123, et II, p. 12). Pourtant,
OpYrTXH 'HQ\V QDYDLW FHUWDLQHPHQt pas imagin que les femmes
du 21e VLqFOH DXUDLHQW XQ DXWUH VHQWLPHQW TXH FHOXL TXLO SUpVHQWH
comme allant de soi. Mais pendant des sicles, ce canon a impos
DX[FKUpWLHQQHVGHVeJOLVHVG2ULHQWOHVUqJOHVGHSXUHWpGHODQcienne
/RL HQ GpSLW GH ODIIranchissement obtenu par le Christ (Rm 7, 6).
Des mouvements de femmes orthodoxes contestent le maintien de
telles observances et ce livre, trs document et bien argument du
point de vue canonique, les accompagne et les claire dans leur
engagement pour faire voluer les mentalits et les usages.
/DSUDWLTXHGRQWIDLVDLWpWDW'HQ\VG$OH[DQGULHDDERXWLjGH
QRPEUHX[LQWHUGLWVDIIHFWDQWODYHQXHGHVFKUpWLHQQHVGDQVOpJOLVH
et leur contact avec les sancta, de la communion eucharistique jus-
TXDX[YDVes et objets liturgiques. Certaines interdictions sont tem-
porelles, lies la dure des menstrues ou de la purification
DSUqVODFFRXFKHPHQWPDLVGDXWUHVVRQWSHUPDQHQWHVHQWDQWTXH
les femmes sont considres comme inaptes des fonctions et des
services dans les glises, cause de ces prtendues impurets
rituelles. De ce fait, dans la clbration baptismale, garons et filles
sont traits de faon ingalitaire dans les rites appels ekklesiamos :
OH SHWLW HQIDQW HVW SRUWp j OpJOLVH TXDUDQWH jours aprs sa nais-
sance VLFHVWXQJDUoRQLOHVWGpSRVpVXUODXWHOPDLVVLFHVWXQH
ILOOHRQQHODSRUWHTXHMXVTXjOLFRQRVWDVH
/DXWHXUTXLGLULJHXQHpTXLSHGHUHFKHUFKHVWUqVDFWLYH 3KLOR-
sophie du droit, Religions et Culture, Vienne), poursuit, avec cons-
tance et rigueur, ses enqutes sur la condition et les missions des
femmes dans les glises orientales. Elle a dj publi une partie
des recherches dans Kanon XVI (Mutter, Nonne, Diakonin, 2000), et
dans Kanon XVII (Frauenrollen & Frauenrechte in der Europischen
Orthodoxie, 2005). Dans cette nouvelle publication, elle examine
systmatiquement, selon un parcours historique, la rception de
ces observances de puret lies des phnomnes physiologi-
TXHV (OOH VLQWpUHVVH SULQFLSDOement aux observances imposes
DX[ IHPPHV PDLV j ORFFDVLRQ HOOH pWHQG VRQ HQTXrWH j FHOOHV
imposes aux hommes, et ne manque pas de signaler au passage
la diffrence de traitement, en faveur des hommes, videmment !
Les diffrentes questions canoniques et thologiques que posent
ces observances en rgime chrtien sont prises en compte, et
ODXWHXU IRXUQLW GDQV FKDTXH FDV GHV pOpPHQWV GH UpSRQVH DUJX-
ments, en particulier sur les confusions entretenues, selon les
cultures, entre inaptitude au culte et pch.
/H FKRF GHV FXOWXUHV GDQV OH PRQGH DFWXHO HW ORXYHUWXUH GHV
pays prcdemment sous rgime communiste provoquent la remise
en question de ces interdits que le Nouveau Testament ignore.
/DXWHXU PHW HQWUH SDUHQWKqVHV OHV YDOHXUV GH VD propre culture
reliJLHXVHODWLQHHQORFFXUUHQFHSRXUrWUHjOpFRXWHGHVIHPPHV
concernes, dans les glises orientales. Elle leur a donn la parole.
2U MXVTXj SUpVHQW OHV REVHUYDQFHV LPSRVpHV DX[ IHPPHV pWDLHQW
dbattues et dcides par des clercs masculins. Avec cette tude, ce
sont des femmes qui prennent leur condition religieuse en main.
Marcel METZGER

Jol-%HQRvW GONORIO, 3RUWDOLV /(VSULW GHV VLqFOHV. Dalloz,


Paris, 2005, 365 p. [ISBN : 978-224706042-9 ; 30 euros].
2XYUDJH PDJLVWUDO GXQ DXWHXU TXH ORQ QH SUpVHQWH SOXV FH
livre vient son heure dans une Europe la recherche de ses
valeurs  LO UDSSHOOH DX[ FLYLOLVWHV FRPPH DX[ FDQRQLVWHV OXYUH
conVLGpUDEOH GXQ DYRFDW SURYHQoDO GHYHQX SDUOHPHQWDLUH SXLV
conVHLOOHU GeWDW HW PLQLVWUH GHV FXOWHV VRXV O(PSLUH D\DQW pWp
ODUFKLtecte du Code civil (p. 185) et lartisan du Concordat
(p. 243). Marqu au coin de la modration et du ralisme politique,
son Discours prliminaire au projet du Code civil figure, dans ODQtho-
logie de la pense juridique , comme le plus beau texte sur la
lgislation qui en tout lieu ait jamais t crit , estime Philippe
Malaurie (Cujas, PUF, 1996, p. 146).
Le professeur J.-%G2QRULRDYDLWTXDOLWpSRXUUHQGUHXQKRP-
PDJH PRWLYp j OXQ GHV plus illustres juristes, ayant exerc la
charQLqUHGHO$QFLHQGURLWHWGHODOpJLVODWLRQFRQVXODLUHLVVXHGH
la Rvolution SDUVHVOLHQVXQLYHUVLWDLUHVDYHFOInstitut Portalis et la
)DFXOWp GH GURLW G$L[-Marseille, il a dirig en 2004 un ouvrage
collectif sur Portalis le juste, publi par les Presses Universitaires
G$L[-Marseille.
/DYRFDW GLSO{Pp in utroque jure, devait son talent une con-
naissance approfondie des rgles et des coutumes anciennes, asso-
cie sa passion du droit romain et GXGURLWFDQRQLTXHDLQVLTXj
son immense culture, qui firent sa rputation de jurisconsulte.
Ainsi, avant Malesherbe mais pour un motif diffrent, il conclut,
dans sa consultation de 1770, la validit des mariages protes-
tants en France (clbrs au Dsert), en fondant sur la possession
GpWDWXQHVROXWLRQTXHOdit de Tolrance tendra, en 1787, tout
non catholique (cf J. CARBONNIER, Droit civil, II, PUF, 1999,
p. 691 et passim).
Proscrit de la rvolution , le jeune avocat trouve refuge
LyRQSXLVGHUHWRXUj3DULVLOFRQQDvWODSULVRQDYDQWGHQWUHUDX
conseil des anciens (p. 117 et 137). Malgr une ccit prcoce et
grce sa prodigieuse mmoire, le parlementaire dfend avec cou-
UDJH OHV IDPLOOHV GpPLJUpV HW OHV SUrWUHV UpIUDFWDLUHV ; il soutient
aussi la libert de la presse (p. 148). Mais en 1797, fructidor le
SRXVVHjOH[LOHQ6XLVVHSXLVHQ$OOHPDJQHRSHQGDQWGHX[DQV
il rdige un trait monumental de philosophie compare et de
science politique  VLQVSLUDQW GH 0RQWHVTXLHX LO y dnonce les
SLqJHVGHOLGpRORJLHOLEHUWDLUHHWGHOpJDOLWDULVPH (p. 161-179).
la faveur du 18 Brumaire, Portalis rentre Paris en fvrier
 HW GRLW j OD SURWHFWLRQ GH &DPEDFpUqV OHVVRU GH VD FDUULqUH
politique. Nomm au tout nouveau Conseil GeWDWSXLVjODFRP-
mission de rdaction du Code civil, il y exerce une influence pr-
pondrante : restaurer la religion par le concordat et la socit
SDU OH FRGH WHOOHV VHURQW OHV GHX[ JUDQGHV XYUHV GH 3RUWDOLV ,
FDSDEOHGDGDSWHUODWUDGLWLRQjOa modernit et, au besoin, de con-
cilier les opinions antagonistes.
Sur le premier point, sa science du droit canonique le dsignait
la prparation officieuse du concordat, conclu entre le Gouver-
nement et le Saint-Sige en 1801, et la rdaction des Articles orga-
niques YLVDQW OeJOLVH FDWKROLTXH DLQVL TXH FHX[ GHV FXOWHV SURtes-
tants. ce titre, il devint directeur puis ministre des cultes, veillant
jODSSOLFDWLRQGHODORLGX18 Germinal X TXLSURPXOJXDOHQVHPEOH
de ces textes. En ce sens, Portalis fut regard comme ODUWLVDQGX
concordat  S GDQVODPLVHHQXYUHGHFHOXL-ci : ferme sur
la libert de conscience et celle des cultes, il veille en particulier
OXQLWpGHOpSLVFRSDW DVVRFLDQWDX[QRXYHDX[SUpODWVGDQFLHQV
vques FRQVWLWXWLRQQHOV ,O QKpVLWH SDV j WHPSpUHU OH ]qOH RX OD
svrit de tel ou tel (p. 266-271).
/DWXWHOOHDGPLQLVWUDWLYHGHOeWDWVXUOHVPLQLVWUHVGXFXOWHSHU-
GLWGHVDULJLGLWpLQLWLDOHHWQHVHPEOHSDVDYRLUMXVWLILpOLPDJHGXQ
carcan , avance par certains historiens. /DXWHXUUHJUHWWHGDLOOHXUV
OHVSULW PrPH GX SDFWH VRFLDO SRLQW GpTXLOLEUH pODERUp SDU 3RUWD-
lis ; dans une rconciliation concordataire certes laborieuse et, sur
certains points discutaEOHOKpULWDJHOpJLVODWLIGHce rgime a subsist
avec bonKHXU GDQV OHV WURLV GpSDUWHPHQWV G$OVDFH HW GH 0RVHOOH
Approuvs par la doctrine juridique, les pouvoirs publics surent
FRQVHUYHUOXYUHGH3RUWDOLVSDUXQHFRKpUHQFHFRQVWLWXWLRQQHOOH
entre la lacit de la Rpublique et le respect de celle-ci envers
toutes les croyances, notamment en faveur des Cultes reconnus
(cf. F. MESSNER et J.-M. WOEHRLING, Trait de droit franais des
religions, Litec, 2003, p. 139 et s.).
0DLVOXYUHOpJLVODWLYHGXJUDQGMXULVWHVH[HUoD surtout dans la
rdaction du Code civil, dont il fut tenu pour ODUFKLWHFWH (p. 185)
et le philosophe aux yeux du Doyen J. Carbonnier.
Associ au gnie politique de Bonaparte, Portalis possdait en
effet celui du compromis, ncessaire pour surmonter les divergen-
FHV LGpRORJLTXHV TXL VDIIURQWqUHQW SDUIRLV ORUV GH OD UpGDFWLRQ
notamment propos du mariage et du divorce. Fru de droit cano-
QLTXHLOILWSUpYDORLUOHFDUDFWqUHLQVWLWXWLRQQHOGHOpWDWPDWULmonial,
irrductible un contrat de droit commun (p. 215). Le divorce
devint, en revanche, XQHYpULWDEOHSLHUUHGDFKRSpement , en par-
ticulier sur le consentement mutuel qui opposa Portalis au Pre-
PLHU&RQVXO/DIIURQWHPHQWGRFWULQDOQHVpWHQGLWWRXWHIRLVSDVj
la consolidation de la famille et sa restauration par le Code
civil . Enclin aux options de la droite, Portalis su modrer ses
convictions afin de favoriser une transaction conforme aux posi-
tions de Bonaparte. Car celui-ci entendait soustraire le projet de
O$QVIII aux idologues , soucieux de fonder la nouvelle lgis-
lation sur des valeurs trop mtaphysiques : ces esprits, selon lui,
SOXVSDVVLRQQpVSDUODVSpFXODWLRQTXDWWHQWLIVDX[OHoRQVGHOKLV-
WRLUHHWjOH[SpULHQFHGXFXUKXPDLQ FI- CARBONNIER, Essai
sur les lois, Defrnois, 1979, p. 221-223).
Ptri  GH GURLW URPDLQ OH MXULVFRQVXOWH G$L[ V\ UpIqUH j
PDLQWHV UHSULVHV DILQ GKDUPRQLVHU OHV UqJOHV pFULWHV HW OHV FRX-
WXPHV GH O$QFLHQ GURLW DYHF OH OpJDOLVPH LVVX GH OD 5pYROXWLRQ
non sans un compromis souvent malais pour mettre un vin
nouYHDX GDQV ORXWUH DQFLHQQH (p. 208-  *UkFH j OKpULWDJH
FRQFHSWXHOG$ULVWRWHLOWHQWHUDGHVDXYHJDUGHUOHVIRQGHPHQWVGX
droit naturel, selon OHVSULW GHV VLqFOHV  LQWLWXODQW ORXYUDJH HW
repULVGDQVOHWH[WH S 3RUWDOLVVDWWDFKHHQHIIHWjUHFKHUFKHU
la suprme raison fonde sur la nature des choses : on croirait
relire /(VSULWGHV/RLV propos de OHXUVUDSSRUWVDYHFORUGUHGHV
choses  GDQV OLQWLWXOp GX er chapitre ouvrant le Livre XXVI !
&DUjOLQVWDUGH0RQWHVTXLHXLOFRQVLGqUHOHGURLWQDWXUHOFRPPH
OkPHGXGURLWSRVLWLI (p. 202-205).
Par tous ces traits, le grand Portalis fut, aux yeux de Sainte-
Beuve, ORUDFOH GX &RQVHLO GeWDW HW OXQH GHV OXPLqUHV GX Consu-
lat .
Georges DOLE
Alberto MELLONI, Silvia SCATENA (dir.), Synod and Synoda-
lity : Theology, History, Canon Law and Ecumenism in new con-
tact, International Colloquium Bruges 2003, Coll. Chris-
tianity and History, Series of the John XXIII Foundation
for Religious Studies in Bologna , 1, Mnster, Lit Verlag,
2005, 720 p.
/RXYUDJHSXEOLpVRXVODGLUHFWLRQGH$0HOORQLHW66FDWHQDTXL
inaugure une collection ( Christianity and History ) cre sous les
auspices de la Fondation Jean XXIII pour les sciences religieuses
(Bologne), rassemble les textes des communications prsentes au
colORTXH LQWHUQDWLRQDO WHQX j %UXJHV HQ  j OLQLWLDWLYH GH ODGLWH
Fondation, autour du thme de la synodalit, et qui avait runi de
nombreux spcialistes mondialement reconnus, appartenant diff-
rentes confessions chrtiennes. Comme le sous-WLWUH OLQGLTXH OD
question de la synodalit fut envisage par les organisateurs dans sa
quadruple dimension, thologique, historique, canonique eWFXm-
nique.
/DV\QRGDOLWpFRPPHPRGHGHJRXYHUQHPHQWGHOeJOLVHUHPRQWH
une trs haute antiquit. Le Concile apostolique (Ac 15, 5-29),
WHQXVHORQODWUDGLWLRQj-pUXVDOHPYHUVODQoffrirait un premier
PRGqOH GDSSOLFDWLRQ FRQFUqWH GX Srincipe synodal. Ce principe
VDIILUPHDYHFIRUFHHWWURXYHVRQH[SUHVVLRQODSOXVIUDQche dans
OHVFRQFLOHVHWV\QRGHVUpJLRQDX[HWFXPpQLTXHVUpXnis depuis,
en particulier partir du 4e sicle.
&HSHQGDQWFHPRGHFROOpJLDOGHJRXYHUQHPHQWGHOeJOLse ne
manqua pas par la suite de provoquer questionnements et dbats,
VXVFLWpVQRWDPPHQWSDUOpSLQHX[SUREOqPHGHOpTXLOLEUHjPDLQ-
tenir entre pratique synodale et autonomie ecclsiologique des
eJOLVHV ORFDOHV HW VXUWRXW SDU OH FHQWUDOLVPH TXL VLPSRVDit peu
SHXDXVHLQGHOeJOLVHFDWKROLTXHURPDLQH&HQpWDLWGDLOOHXUVSDV
un hasard que ce thme ft omniprsent au concile Vatican II,
SRXU TXL OH GLDORJXH FXPpQLTXH IXW OXQH GHV SUpRFFXSDWLRQV
PDMHXUHV,OQDFHVVpGHSXLVGLQWHUSHOOHUOeJOLVH
/RXYUDJHTXLDSRXUDPELWLRQGHIDLUHOHSRLQWVXUFHWWHTXHV-
WLRQGXQHFULDQWHDFWXDOLWpQHUHQIHUPHSDVPRLQVGHWUHQWHFRQ-
tributions, rdiges en quatre langues diffrentes (anglais, franais,
italien et espagnol) et rparties en sept blocs : les fondements tho-
logiques du principe de synodalit (5), le creuset historique (4),
OpSRTXHPRGHUQH e-20e s.) (4), la synodalit au niveau rgional
(3), un panorama de quelques cas de pratiques synodales au sein de
OeJOLVH FDWKROLTXH   gouvernement central et communion (5) et
enfin quelques tudes de cas de prise de dcision et de pratique
synodale (5).
Il est naturellement impossible de prsenter ici dans le menu dtail
OHFRQWHQXGHOHQVHPEOHGHFHVFRQWULEXWLRQVHWHQFRUHPRLQs de les
discuter  QRXV QRXV FRQWHQWHURQV SDU FRQVpTXHQW GHQ GpJDger les
grandes lignes.
L. rsy revisite le principe de la collgialit piscopale (p. 27-
32). Il regrette que les pres du concile Vatican II se soient conten-
WpV GHQ SURFODPHU OH[LVWHQFH VDQV DOOHU MXVTXj UHFRQQDvWUH XQH
vritable collgialit degrs variables : en tant que ralit tho-
logique  SRXUYXH GXQ FKDULVPH SURSUH WRXWH DVVHPEOpH GpYr-
TXHVjFRQGLWLRQQDWXUHOOHPHQWTXHOOHVRLWHQFRPPXQLRQDYHFOH
PaSHGHYUDLWrWUHVHORQ/gUV\LQYHVWLHGXQDXWKHQWLTXHSRXvoir
collgial.
Cette forme de collgialits intermdiaires entre les glises
ORFDOHV HW OeJOLVH XQLYHUVHOOH H[LVWH ELHQ DX QLYHDX VXSUDQDWLRQDO
comme nous le montre M. Wijlens (p. 33-60), en Amrique latine
(CELAM), en Asie (FABC), en Europe (CCEE, ComECE), etc.
/DXWHXUSRVHODTXHVWLRQGHVDYRLUVLOHFRQFHSWGH synodalit ,
au lieu de celui de collgialit , ne peut pas tre plus fructueux
pour mieux apprhender la coopration entre vques au niveau
rgional.
5HYHQDQW VXU OHV IRQGHPHQWV WKpRORJLTXHV GH OLQVWLWXWLRQ
synodale, B. Flanagan expose la pense du dominicain J.-M.-R.
Tillard sur la synodalit et la collgialit, qui repose sur la notion
GHO ecclsiologie de communion et prsente un certain nom-
EUHGLPplications pratiques de la collgialit comme sacrement de
communion (p. 61-73).
Le point de vue des glises rformes est exprim par A. Bir-
mel (p. 75- 3DUWDQWGXQHDQDO\VHKLVWRULTXHGH*+DPman sur
ODV\QRGDOLWpODXWHXUYRLWGDQVOHV\QRGHOH lieu ecclsial GHOXQLWp
dans la diversit des diffrentes glises issues de la Rforme.
Gilles Routhier (p. 91-103) plaide pour sa part pour une
rflexion sur la synodalit qui soit affranchie des insuffisances
dont elle a pu souffrir par le pass. Une telle rflexion devra int-
JUHUVHORQODXWHXU quatre lments : une approche systmique de la
TXHVWLRQGHODV\QRGDOLWpXQHGLPHQVLRQFXPpQLTXHXQHH[SUHV-
sion juridique de la rflexion thologique et enfin le dveloppement
GXQHDSSURFKHGHWKpRORJLHSUDWLTXH
- 7D\ORU UHFRQVLGqUH OD TXHVWLRQ GH OKLVWRULFLWp GX Concile
apostolique (p. 107-113). Sa conclusion est sans appel : le Con-
cile de Jrusalem , tel que dcrit par Luc (Ac 15, 5- QDMDPDLV
eu lieu !
P. Bernardini offre un aperu des travaux qui, durant les vingt
dernires annes, ont t consacrs aux conciles africains du
3e sicle (p. 115-142). Un prcieux tableau, produit en annexe,
numre les conciles africains, runis entre 220 et 535, avec la
mention de la date, du lieu, du type et du nom du prsident de
FKDFXQGHX[
Les vicissitudes que le Consistoire GHOeJOLVHFDWKROLTXHURPDLQH
(consistorium) a connues, en particulier durant la seconde moiti du
16e sicle, sont tudies par M. T. Fattori (p. 143-  /DXWHXU
montre surtout comment ce collge de cardinaux fut alors srieu-
VHPHQWFRQFXUUHQFpSDUOD&RQJUpJDWLRQGHO,QTXLVLWLRQSXLVSDUOD
Congrgation de la Sainte Inquisition, dont le rle revtit la forme
GXQ pWURLW FRQWU{OH GX &ROOqJH HQIHUPp GpV ORUV GDQV XQH REp-
GLHQFHSDVVLYHjOpJDUGGXSRQWLIHURPDLQ
R. $ 0HQW]HU GpYHORSSH OLGpH VHORQ ODTXHOOH OH SULQFLSH IRQ-
daPHQWDO GpJDOLWp DEVROXH HQWUH OHV eJOLVHV ORFDOHVVH WURXYH j OD
base du systme presbytro-synodal, en vigueur au sein des glises
rformes (p. 173-184).
la lumire du concile local tenu Moscou en 1917-1918, H.
Destivelle expose (p. 187-  GXQH SDUW OHV GLIIpUHQWHV DFFHS-
tions de la notion de conciliarit du point de vXH GH OeJOLVH
orthoGR[HGH5XVVLHHWGDXWUHSDUWODTXHVWLRQGHODSDUWLFLSDWLRQ
des lacs aux conciles locaux.
*6FKXO]VLQWpUHVVHjVRQWRXUjFHWLPSRUWDQWFRQFLOHGH0RV-
cou (p. 201-212). Celui-FLDSURIRQGpPHQWPDUTXpOeJOLVHRUWKRdoxe
de 5XVVLH HQ FH TXLO D SHUPLV GDQV XQ FRQWH[WH UpYRlutionnaire, la
participation de tout le peuple de Dieu (clercs et lacs) la prise
FROOpJLDOH GH GpFLVLRQ HW D SHUPLV j OeJOLVH UXVVH GRQW OD VWUXFture
SDWULDUFDOHVHVWUHWURXYpHUHVWDXUpHGHVXUYLYUHjOqUHVRYLptique.
/KLVWRLUHHWOHVSULQFLSHVTXLUpJLVVHQWOHJRXYHUQHPHQWV\QRdal
GH OeJOLVH G$QJOHWHUUH VRQW HQYLVDJpV SDU & 3RGPRUH S 213-
236). Deux termes rsument son volution historique : continuit et
adaptation. Pour ce qui concerne les principes, on retiendra le carac-
tre permanent du synode ainsi que la place importante accorde
aux lacs. Ainsi, si OH U{OH GH OpYrTXH GHPHXUH FHQWUDO OeJOLVH
G$QJOHWHUUHpWDQWpSLVFRSDOHSDUH[FHOOHQFH celui-ci agit toujours
de concert avec le clerg mais aussi avec les lacs.
A. Indelicato revient (p. 237-261) sur le parcours qui a dbou-
FKpVXUOLQVWLWXWLRQDXFRQFLOH9DWLFDQ,,GX6\QRGHGHVpYrTXHV
(cf. motu proprio Apostolica sollicitudo ). travers une relecture des
sourceV ODXWHXU UHPDUTXH TXH FHWWH LQVWLWXWLRQ IXW GLFWpH SDU OH
concours de trois facteurs convergents, partiellement intention-
nels : les orientations du pape, la subordination de la commission
des vques et la pression exerce par une partie de la Curie.
0)DJJLROLVLQWpUHVVHjODSUDWLTXHHWDX[QRUPHVUHODWLYHVDX[
confrences piscopales depuis Vatican II (1959-  /DXWHXU
montre (p. 265-296) comment les pouvoirs de cette institution, plu-
tt tendus durant la priode post-conciliaire (1966-1980), ont par la
suite connu, surtout avec la promulgation du Codex Iuris Canonici en
1983 (cc. 447-  HW MXVTXDX motu proprio Apostolos suos (1998),
de srieuses restrictions.
Ce mme motu proprio DYDLWGDQVFHUWDLQVFDVVXEVWLWXpOXQDni-
mit ODPDMRULWpGHVGHX[WLHUVSRXUODGRSWLRQGHVGpFLVLRQVSUL-
ses par les confrences des vques. P. C. Nol dcle dans cette
volution des procdures de dcision un enjeu pour la synodalit
des confrences piscopales (p. 297-313).
J. Grootaers se propose de revenir sur les Huit Journes
GpWXGHV JHUPDQRSKRQHV ( Internationale Studientagungen ber Syno-
denfragen ), organises entre 1969 et 1976, et consacres aux six
synodes nationaux runis la mme poque aux Pays-Bas, en Alle-
magne (fdrale et dmocratique), en Autriche, en Suisse et au
Luxembourg. Les documents issus de ces Journes refltent, selon
ODXWHXUOHVXFFqVGHOLGpHGHVV\QRGHV nationaux , mais aussi ses
OLPLWHVSXLVTXHOHPRXYHPHQWILQLUDSDUVpWHLQGUHDYHFOHGpFOLQdu
pontificat du pape Paul VI.
/DEVHQFH GpWXGHV VXU OHV SUDWLTXHV V\QRGDOHV VXSUD-diocsai-
nes au Canada, incite Gilles Routhier poser quelques jalons pour
une telle tude (p. 345-372).
S. Arulsamy dresse un panorama des confrences piscopales
catholiques prsentes en Inde (p. 373-426). Le pluralisme rituel qui
caracWpULVHFHSD\VH[SOLTXHOH[LVWHQFHGHTXDWUHFRQIpUHQFHVRXUpX-
nions piscopales, dotes chacune de structures propres : Catholic
%LVKRSV &RQIHUHQFH RI ,QGLD (CBCI), Conference of Catholic
Bishops of India (CCBI), Synod of Bishops of Syro-Malabar
Major Archiepiscopal Church (SMMAC), Council of Syro-Malan-
kara Church (CMC).
8Q H[HPSOH GH V\QRGDOLWp URPDLQH HVW GRQQp SRXU O$IULTXH
par I. Ndongala (p. 427-433), travers la Confrence piscopale
rgioQDOHGHO$IULTXHGHORXHVW &(5$2 IRQGpHHQ
Enfin pour la Belgique et les Pays-Bas, P. De Mey envisage les
confrences piscopales dans ces deux pays (p. 435-460). Il dcrit
essentiellemenW OHXUV FKDPSV GDFWLRQ HW OHXUV UDSSRUWV DYHF 5RPH
DYHFGDXWUHVFRQIpUHQFHVpSLVFRSDOHVDLQVLTXDYHFGLYHUVHVVWUXFWXUHV
synodales au niveau national.
*$OEHULJRYRLWGDQVODFRQFLOLDULWpOHIXWXUGHOeJOLVH S 463-
  /H FRQFHSW HW OH[SpULHQFH Ge la conciliarit ont cependant
EHVRLQGXQDSSURIRQGLVVHPHQWGRFWULQDOTXLIDLWHQFRUHGpIDXW
L. Vischer (p.489- DFKRLVLGHVLQWpUHVVHUDXU{OHMRXpSDUOHV
Communions chrtiennes mondiales ( Christian World Commu-
nions &:&V GDQVOHPRXYHPHQWFXPpQLTXHDYDQWHWDSUqVOD
cration en 1948 du &RQVHLO FXPpQLTXH GHV eJOLVHV ( World
Council of Churches : WCC).
La Communion ecclsiale de Leuenberg (devenue en 2003
Communion des glises protestantes en Europe ), fonde en
1973IXWXQOLHXGHFRQWURYHUVHDXWRXUGHODQpFHVVLWpRXQRQGXQ
synode protestant pan-europen. M. Friedrich rcapiWXOH OKLVWRLUH
de cette Communion HW GpYHORSSH OHV UDLVRQV GX EHVRLQ GXQH WHOOH
structure synodale (p. 519-530).
/HFFOpVLRORJLHGHOeJOLVHEDSWLVWHHVWIRQGpHVXUOLGpHGHOeJOLVH
FUR\DQWHFRPSRVpHGHOHQVHPEOHGHVILGqOHVTXLRQWUHoXOHEDSWrPH
par immersion. B. J. Leonard montre comment, de type congrga-
niste, cette glise, travers les congrgations et associations de con-
grgations, fait une large part la participation des lacs (p. 531-543).
/DSDUWLFLSDWLRQGHOeJOLVHPpWKRGLVWHDX[GpEDWVVXUODV\QRdalit
est assure par D. Carter (p. 545- /DXWHXUFRQVLGqUHQRWDPment
que la tradition et la pratique de cette JOLVHGRQWOHFFOpsiologie est
finaOHPHQWWUqVSURFKHGHFHOOHGHOeJOLVHURPDLQHSHXvent apporter
une prcieuse contribution la rflexion sur la synodalit, engage au
VHLQGHOeJOLVHFDWKROLTXH.
/REMHWGHOpWXGHSURSRVpHSDU/6HUUDQR%lanco (p. 559-583)
HVW OAssembl conjointe ( Asamblea Conjunta de obispos y sacerdotes )
UpXQLHGDQVO(VSDJQHIUDQTXLVWHHQHWTXLD\DQWUpXQLpYrTXHV
et clercs, avait pour objectif la rception des dcisions du concile
Vatican II ainsi que la UpQRYDWLRQ LQWHUQH GH OeJOLVH G(Vpagne,
notamment pour ce qui touche aux mcanismes de prise de dci-
VLRQVGHFROOpJLDOLWpGHFRUHVSRQVDELOLWp/$SURduit en annexe les
FRQFOXVLRQVDXQLYHDXGHVGLRFqVHVGHOAssemble conjointe de 1971.
Le contexte historique qui a prsid la prparation puis la ru-
QLRQ j 0HGHOOLQ GH OD &RQIpUHQFH GHV pYrTXHV G$PpULTXH ODWLQH
(CELAM) est longuement tudi par S. Scatena (p. 589-646).
R. Puza examine la question de la synodalit, en particulier au
niveau des diocses, telle TXHOOH VH GpJDJH GHV GHX[ FRGHV ODWLQV
de 1917 et 1983 (p. 647-662).
/DYHQLUGHOD Communion des glises protestantes en Europe
(cf. supra  TXL FRQVWLWXH XQ FDV LQWpUHVVDQW GXQLRQ HQWUH GLIfrentes
identits ecclsiales, est envisag par E. Parmentier (p. 663-675). Cette
communion dclare demande encore tre ralise. Cela passe nces-
saiUHPHQWVHORQODXWHXUSDUODPLVHHQSODFHGHVWUXFWXUHVDGpquates.
La dernire contribution (p. 677-702), celle de P. V. Aimone,
traite de la participation des lacs aux synodes diocsains durant la
priode post-conciliaire (1966-1983), en particulier au sein de
OeJOLVHVXLVVH/H Synode 72 (synodes runis en 1972 simultan-
ment dans les six diocses de Suisse) est trs instructif cet gard ; il
SHUPHW HQ HIIHW GH PHVXUHUOHV GLIILFXOWpV TXL GpFRXOHQW GH OLQWHU-
prtation des orientations romaines en la matire.
Il ne fait aucun doute que cet imposant ouvrage constitue dsor-
mais un passage oblig pour quiconque VLQWpUHVVH DX[ SURblmes
de la synodalit et de la collgialit comme mode de gouvernement
des glises. Si nous devions exprimer un regret, ce serait celui de ne
pas voir examin dans ce volume la pratique des glises orientales
en matire de synodalit. Structure originale propre ces glises,
absolument distincte de la confrence piscopale, le Synode patriarcal,
LQVWDQFH VXSUrPH GRWpH GLPportantes prrogatives, aurait notam-
PHQW PpULWp XQH pWXGH SDUWLFXOLqUH 0DLV LO VDJLW Oj GXQH REVHU-
vation qui ne diminue en rien la grande valeur de cette publication.
Marc AOUN

Jacqueline FLAUSS-DIEM (dir.), Secret, Religion, Normes tati-


ques 3UHVVHV XQLYHUVLWDLUHV GH 6WUDVERXUJ &ROO GH O8QL-
versit Robert Schuman - Socit, droit et religion en
Europe), 2005, 198 p.
/RXYUDJHSXEOLpVRXVODGLUHFWLRQGH0me J. Flauss-Diem, pro-
fesVHXU j O8QLYHUVLWp de Picardie, rassemble les communications
prVHQWpHV ORUV GXQH MRXUQpH GpWXGHV WHQXH j 6WUDVERXUJ OH 
fvrier 2003, sur le thme Secret, religion et normes tatiques. Comme le
rappelle Mme J. Flauss-Diem dans la prface, les problmes que
suscite le secret en matire de religion avaient t particulirement
PLVHQOXPLqUHjORFFDVLRQGHODIIDLUH3LFDQGXQRPGHOpYrTXH
de Bayeux-Lisieu[ 0JU 3LHUUH 3LFDQ SRXUVXLYL SRXU QDYRLU SDV
port la connaissance de la justice les actes de pdophilie, com-
mis par un prtre de son diocse.
Un premier dossier, ayant trait au secret dans les religions ,
avait t publi, en 2002, dans la Revue de droit canonique (t. 52/2,
p. 241-354). Il avait runi les contributions de nombreux auteurs
XQHMRXUQpHGpWXGHFRQVDFUpHDXWKqPHHQTXHVWLRQHWDYDLWPLVHQ
pYLGHQFHOLPSRUWDQWHSODFH TXHOHVHFUHWRFFXSH DXVHLQGHWRXWHV
les religions (et mouvements religieux), et qui se manifeste sous dif-
frentes formes et plusieurs niveaux, en fonction de la religion con-
cerne : en matire de confessions (de confidences, de rvlations), de
procs (canonique ou disciplinaire), de tmoignaJHGDGPLnistration
GHVeJOLVHV
Ce dossier, extrmement riche en soi, se limitait cependant,
YRORQWDLUHPHQW DX VHFUHW j OLQWpULHXU GH FKDFXQH GHV UHOLJLRQV
'ROLGpHGpODUJLUOHGpEDWHWGHFRQIURQWHUODTXHVWLRQGXVHFUHW
religieux aux normes tatiques en vigueur, dans une perspective
SURSUHPHQW MXULGLTXH &HVW ELHQ OHVSULW TXL D DQLPp OD MRXUQpH
GpWXGHjORULJLQHGHODSUpVHQWHSXEOLFDWLRQ
Mais peut-on apprhender la phnomnologie du religieux
travers le prisme du secret partir de la seule exception fran-
aise de la lacit ? La rponse, videmment ngative, conduisit les
orgaQLVDWHXUVjIDLUHDSSHOjGDXWUHVH[SpULHQFHVYpFXHVGDQVXQ
FHUWDLQQRPEUHGHSD\VHXURSpHQVDLQVLTXjVRQGHUODWWLWXGHGH
OD&RXUHXURSpHQQHGHVGURLWVGHOKRPPHen la matire.
&HV GHX[ D[HV IRUPHQW OD WUDPH JpQpUDOH GH ORXYUDJH TXL
consacre ainsi sa premire partie au secret et [ la] religion en
droit franais (p. 11- DORUVTXHODVHFRQGHSDUWLHVLQWpUHVVHDX
VHFUHW HW >j OD@ UHOLJLRQ GDQV GDXWUHV Vystmes juridiques , y
FRPSULVGDQVOD&RQYHQWLRQHXURSpHQQHGHVGURLWVGHOKRPPHHW
dans la jurisprudence de la Cour europenne des droits de
OKRPPH S-157).
Pour ce qui est du systme franais, trois domaines sont envi-
saJpVVRXVODQJOHGXVHFUet religieux, respectivement celui du droit
du travail (J. Bouton, p. 13-48), du droit pnal (J. Leblois-Happe,
p. 49-74), et enfin celui se rapportant la vie civile (J. Flauss-
Diem, p. 75-89).
La lgislation du travail en vigueur exige le respect du secret
des croyances religieuses du candidat un emploi salari. Cette
exiJHQFHHVWLQGXLWHSDUOHSULQFLSHGHQRQGLVFULPLQDWLRQTXLVLP-
SRVHjOHPSOR\HXU/HVHFUHWUHODWLIDX[FRQYLFWLRQVUHOLJLHXVHVHVW
donc un droit dont bnficie tout candidat un emploi quelcon-
TXH&HGURLWDXVHFUHWUHVWHYDODEOHWRXWDXORQJGHOH[pFXWLRQGX
contrat de travail, tout comme reste exig le respect du principe de
QRQGLVFULPLQDWLRQGHODSDUWGHOHPSOR\HXUTXLYLHQGUDLWjDYRLU
connaissance de la religion du salDULp SHQGDQW OH[pFXWLRQ GH OD
prestation de travail. Mais il est des cas o ce secret pourrait tre
lev. Une telle leve du secret des convictions religieuses est
notamment obligatoire dans le cadre des entreprises de tendance
(paroisses, associations,  PDLV DXVVL GDSUqV OD MXULVSUXGHQFH
dans les entreprises en gnral, si le salari souhaite se prvaloir de
ses engagements religieux dans le cadre de son contrat de travail.
Le secret, droit dont jouit le salari, peut tre logiquement aussi
lev lLQLWLDWLYHGHFHPrPHVDODULpDXVVLELHQORUVGHVRQUHFUXte-
PHQWTXHSOXVWDUGSHQGDQWOH[pFXWLRQGXFRQWUDWGHWUDYDLO
Le secret religieux est galement apprhend par le droit pnal.
Celui-ci le protge en principe, le combat titre exceptionnel. La
SURWHFWLRQ SpQDOH GX VHFUHW UHOLJLHX[ GpFRXOH GH ODVVLPLODWLRQ GH
celui-ci au secret professionnel, dont la leve volontaire et non
justifie constitue un dlit sanctionne par la loi. Mais le fait de
taire un secret peut tre dans certains cas pnalement rprhen-
VLEOH,OHQHVWDLQVLQRWDPPHQWORUVTXRQDJDUGpOHVLOHQFHVXUGHV
infractions particulirement graves - tel un crime ou des svisses
perSpWUpVjOHQFRQWUHGXQmineur de quinze ans - dont la dnon-
ciation est exige par la lgislateur VRXVSHLQHGHVDQFWLRQV&HVW
bien ce principe qui a t expressment tendu au secret religieux
jORFFDVLRQGHODIIDLUH3LFDQpYRTXpHSOXVKDXW
La trilogie secret, religion, normes tatiques ne se limite
cependant pas au domaine de la vie prive stricto sensu ; certains
aspects de la vie civile (au sens de civitas) se trouvent aussi
directement concerns. Deux principes, celui de pertinence et
celui de contrle lgitime , peuvent en donner une bonne illus-
tration : la religion peut-HOOHFRQVWLWXHUXQpOpPHQWGLGHQWLILFDWLRQ
GHOLQGLYLGX ? Peut-HOOHrWUHFRXYHUWHSDUOHVHFUHWTXLVDSSOLTXHj
ODYLHSULYpHHQJpQpUDOHWTXLGpFRXOHSULQFLSDOHPHQWGHODUWLFOH
du Code civil ?
4XDQWjODSUHPLqUHTXHVWLRQGXQHSDUWSOXVLHXUVWH[tes, aussi
ELHQQDWLRQDX[ ORLVGXMDQYLHUHWGXPDUV TXH[WUD-
nationaux (telle la directive communautaire du 12 juillet 2002) exi-
JHQW OD SURWHFWLRQ GHV GRQQpHV LQGLYLGXHOOHV GRQW ODSSDUtenance
religieuse fait partie intgrante. TouteIRLV SRXU GHV PRWLIV GRUGUH
public, de telles donnes, stockes par certains organismes spciali-
ss dans la collecte de donnes sensibles (tel Europol), peuvent
tres changes titre drogatoire, la fin justifiant ainsi les moyens.
'DXWUHSDUWOLdentification des personnes demeure possible grce
OpWDWFLYLO grand livre de la vie prive (QHIIHWELHQTXDXFXQH
PHQWLRQ GH OD UHOLJLRQ QH SHXW rWUH IDLWH VXU OHV DFWHV GpWDW FLYLO
certains lments distinctifs, en particulier les noms et prnoms
connotation religieuse, peuvent rendre aise une telle identification.
La seconde question pose le problme de la concordance entre
religion et vie prive, dans la mesure o, en toute logique, toute
manifestation publique de ses croyances ferait immanquablement
pFKDSSHUODSSDUWHQDQFHUHOLJLHXVHjODVSKqUHGHODYLHSULYpH2U
la jurisprudence semble considrer les rvlations faites dans cer-
taines conditions comme pouvant constituer effectivement une
atteinte la vie prive, ouvrant droit rparation.
/D GHX[LqPH SDUWLH GH ORXYUDJH HVW FRQVDFUpH DX[ TXHVWLRQV
que suscite le secret en matire de religion en Belgique (R. Torfs,
p. 93-102), en Italie (S. Ferrari et D. Milani, p. 103-117), au
Royaume-Uni (N. Doe et R. Ruston, p. 119-143), ainsi que dans la
ConYHQWLRQ HXURSpHQQH GHV GURLWV GH OKRPPH * *RQ]DOH]
p. 145-157).
Le fondement lgal du secret dans le domaine religieux dcoule
HQ %HOJLTXH GH ODUWLFOH  GX &RGH SpQDO TXL GLVSRVH TXH les
mdecins, chirurgiens, officiers de sant, pharmaciens, sages fem-
mes et toutes les autres personnes dpositaires, par tat ou par profession,
GXQVHFUHWTXRQOHXUFRQILH, qui, hors le cas o ils sont appels ren-
dre tmoignage en justice et celui o la loi les oblige faire
connatre ces seFUHWVOHVDXURQWUpYpOpVVHURQWSXQLVGXQHPSUL-
VRQQHPHQWGHKXLWMRXUVjVL[PRLVHWGXQHDPHQGHGHj
francs . Il convient donc de compter les clercs au nombre de ces
DXWUHVSHUVRQQHVGpSRVLWDLUHVSDUpWDWRXSDUSURIHVVLRQGXQVHFUHW . Ne
dit-on pas que le mdecin est le confesseur du corps comme le
SUrWUHHVWFHOXLGHOkPH ",OVDJLWHQORFFXUUHQFHGXVHFUHWGHOD
confession et du secret religieux, le premier, en raison de sa nature
mme, tant absolu, contrairement au second.
Oinstar du droit franais, la protection du secret connat dans
le droit belge un certain nombre de drogations. Celles-ci ont trait
jORUGUHSXEOLF DUWHWGX&RGHGLQVWUXFWLRQFULPLQHOOH jOD
protection des mineurs (art. 458 bis du Code pnal, insr en
  DLQVL TXj OD PDUJH GDSSUpFLDWLRQ ODLVVpH DX MXJH SDU
ODUW GX&RGHMXGLFLDLUHjOHIIHWGHQWHQGUH RXQRQ OHWpPRL-
JQDJHGXQGpSRVLWDLUHGXQVHFUHWSURIHVVLRQQHO
En droit pnal italien, la protection du secret religieux dcoule
GHFHOOHVDSSOLTXDQWGHPDQLqUHJpQpUDOHDXVHFUHWSURIHVVLRQQHO
/DUWLFOH  GX &RGH GH SURFpGXUH SpQDOH PHQWLRQQH H[SUHVs-
ment, parmi les personnes tenues au secret professionnel, les
ministres des confessions religieuses ; il prvoit galement la
posVLELOLWp SRXU OH MXJH GH VRSSRVHU OH FDV pFKpDQW DX UHIXV GH
tmoigner. Cet article est repris, avec une importante variante
touteIRLVGDQVODUWLFOHGX&RQFRUGDWDYHFOeJOLVHFDWKROLTXHHW
par les articles contenus dans les ententes avHFO8QLRQGHVFRP-
muQDXWpVMXLYHVHWOeJOLVHpYDQJpOLTXHOXWKpULHQQH/DYDULDQWHHQ
TXHVWLRQ WLHQW j ODEVHQFH GDQV FHV GHUQLHUV WH[WHV GH WRXWH UpIp-
rence au pouvoir de juge de vrifier le bien-IRQGp GX UHIXV GXQ
ministre de culte de divulguer des informations recueillies dans
OH[HUcice de son ministre.
Le droit anglais ignore pour sa part, traditionnellement, toute
affirPDWLRQ GXQ GURLW VSpFLILTXH j OD SURWHFWLRQ GH OD YLH SULYpH
/LQFRUSRUDWLRQGHOD&RQYHQWLRQHXURSpHQQHGHVGURLWVGHOKRmme
GRQW ODUWLFOH  HVW FRQVDFUp j OD SURWHFWLRQ GH OD YLH SULYpH  GDQV
ORUGUHMXULGLTXHLQWHUQHGX5R\DXPH-Uni (Human Rights Act, 1998) a
touteIRLV SHUPLV GDWWpQXHU FH SULQFLSH &HWWH pYROXWLRQ DIIHFWH WRXW
naturellement le domaine du religieux.
/LQYLRODELOLWp GX VHFUHW GH OD FRQIHVVLRQ QHVW SDV DXVVL DEVROXH
GDQV OH GURLW GH OeJOLVH DQJOLFDQH G$QJOHWHUUH TXLO QH OHVW GDQV OH
GURLWFDQRQLTXHGHOeJOLVHFDWKROLTXH RXDXVVLGDQVFHOXLGHOeJOLVH
pSLVFRSDOLHQQH GeFRVVH  3OXW{W TXXQH obligation (can. 983, 1 et
984, 2 du CIC LOVDJLWGXQHrecommandationGXQdevoir moral de
QHSDVUpYpOHUOHVLQIRUPDWLRQVUHFXHLOOLHVGDQVOHFDGUHGHOH[HU-
cice du ministre sacr, en particulier lors de la confession (cf. can.
113 des Canons Ecclesiastical de 1603). Devant les juridictions tati-
ques, et dfaut de jurisprudence tablie en la matire, rien ne
permet de dire si le juge peut vritablement ou non contraindre un
ministre sacr violer le sceau du confessionnal . Mais il y a lieu
de pHQVHUTXDXUHJDUGGHOD&RQYHQWLRQHXURSpHQQHGHVGURLWVGH
OKRPPHTXLIDLWGHSXLVSDUWLHLQWpJUDQWHGHORUGUHMXULGLTXH
anglais, sauf certains cas qui revWHQWXQHJUDYLWpDYpUpHODWWLWXGH
du juge irait dans le sens du respect de la vie prive des individus
concerns.
/eJOLVHDQJOLFDQHG$QJOHWHUUH cf. Policy Statement on Child Abuse,
  PDLV DXVVL GDXWUHV eJOLVHV QRQ pWDEOLHV FRPPH OeJOLVH
anglicane du Pays de Galles (cf. The Care and Protection of Children : Sta-
tement of Policy and Guidance for Implementation RXOeJOLVHFDWKR-
lique romaine (cf. Rapport Nolan, 2001), ont de leur propre chef prit
GHVPHVXUHVWHQGDQWjDVVXUHUXQHSURWHFWLRQDFFUXHGXQHFDWpgorie
GHSHUVRQQHVMXJpHIUDJLOHjVDYRLUOHQIDQW$LQVLODGLvulgation de
secrets ou de confidences, ncesVDLUHjODSURWHFWLRQGHOHQIDQWQH
serait pas considre comme une violation du principe de confiden-
tialit.
(Q PDWLqUH GH GpWHQWLRQ GLQIRUPDWLRQV SHUVRQQHOOHV QRWDP-
ment par le biais de fichiers, il suffit de noter que la loi sur la pro-
WHFWLRQ GH OLQIRUPDWLRQ Data Protection Act, 1998) peut trouver
application galement en matire de secret religieux.
0DLVLOHVWGHVGRPDLQHVROHVHFUHWHQPDWLqUHUHOLJLHXVHQHVW
pas admis. Ainsi en est-il, tLWUHGH[HPSOHGHVVHVVLRQVGHWUDYDLO
des institutions religieuses ou des sances des tribunaux ecclsias-
tiques, ouvertes, par souci de transparence, au public, ou aussi de
OH[HUFLFH SXEOLF GHV ULWHV UHOLJLHX[ HW GH OD FpOpEUDWLRQ GHV VDFUH-
ments, telVOHXFKDULVWLHOHPDULDJHRXOHEDSWrPHIl y a lieu nan-
moins de se demander dans quelle mesure cette pratique peut tre
comSDWLEOHDYHFOD&RQYHQWLRQHXURSpHQQHGHVGURLWVGHOKRPPH
en particulier son article 9, qui garantit la libert de manifester sa
religion ou sa conviction individuellement ou collectivement, en
public ou en priv SDU OH FXOWH OHQVHLJQHPHQW OHV SUDtiques et
ODFFRPplissement des rites .
Ladite Convention interpelle justement le secret, dans sa con-
ception la plus ODUJH j SOXV GXQ WLWUH /D &RXU HXURSpHQQH GHV
GURLWVGHOKRPPHDHXjGHQRPEUHXVHVUHSULVHVjFRQQDvWUHGH
OLWLJHVROHVHFUHWpWDLWLQYRTXpjWLWUHSULQFLSDO0DLVLOQHVHVWDJL
MXVTXjSUpVHQWTXHGHVHFUHWSURIHVVLRQQHOHQOLHQDYHFGHVDFWLvi-
WpVVpFXOLqUHV&HVWGRQFSDUDQDORJLHTXLOFRQYLHQWGHSURFpGHU
VL RQ D OLQWHQWLRQ GHQYLVDJHU OD TXHVWLRQ GX VHFUHW UHOLJLHX[ DX
VHQVGHOD&RQYHQWLRQHXURSpHQQHGHVGURLWVGHOKRPPH
/RXYUDJH GRQW QRXV YHQRQV GH SUpVHQWHU OHV JUDQGHV OLJQHV
mDOJUpXQQRPEUHGHSDJHVUHODWLYHPHQWOLPLWpVDYqUHjODOHFWXUH
particulirement dense. Il vient fort heureusement alimenter la
UpIOH[LRQGHVVSpFLDOLVWHVVXUXQHTXHVWLRQTXLQDFHUWDLQHPHQWSDV
fini de se poser dans nos socits actuelles, partages entre une
QpFHVVDLUH SURWHFWLRQ GH OD YLH SULYpH HW OpYHQWXHO GDQJHU TXH
pourrait reprsenter, dans certains cas, un droit au secret inhrent
la sphre du religieux. De nouvelles dispositions nationales rela-
tives au secret professionnel (voir F. Curtit, Annexe 1, p. 161-171,
pour les dispositions dj en vigueur), des travaux novateurs (voir
A. Messner, Annexe 2, p. 173-181, pour la bibliographie dj dis-
SRQLEOH  DLQVL TXXQH MXULVSUXGHQFH QRXYHOOH ibid., p. 181-182,
pour la jurisprudence dj existante), nationale et /ou europenne,
GHYUDLHQWSHUPHWWUHjODYHQLUGHYRLUSOXVFODLUGDQVFHWHQVHPEOH
dj bien fourni.
Marc AOUN

Xavier DELSOL, Alain GARAY, Emmanuel TAWIL, Droit des


Cultes. Personnes, activits, biens et structures, Paris, Dalloz,
coll. Juris associations , 2005, 639 pages, ISBN 2-
910992-66-
Le manuel publi par X. Delsol, A. Garay et E. Tawil, consacr
au droit des cultes , a pour ambition GDSSRUWHUXQHFRQtribu-
tion pratique et technique la comprhension du droit des
cultes , vu que OHV UqJOHV MXULGLTXHV GRUJDQLVDWLon et de fonc-
tionQHPHQWGHVFXOWHVUHVWHQWPpFRQQXHVSDUOHSXEOLF (p. 19).
/RXYUDJH HVW SXEOLp GHX[ DQV DSUqV OD SDUXWLRQ GX Trait de droit
franais des religions (Litec, 1317 pages, compte-rendu dans la RDC,
55/1, 2005, p. 193-198), vaste expos V\VWpPDWLTXHTXLVpWDLWGpMj
assign pour but de rendre compte de la cohrence du droit des
religions, mais aussi de suggrer la manire de rsoudre quelques
uns des problmes actuels et venir , qui dcoulent des activits et
des pratiques religieuses.
/RXYUDJHUHSUHQGDYHFXQHGLVWULEXWLRQXQSHXGLIIpUHQWHOHV
grands thmes envisags dans le Trait : les sources du droit des
cultes, le cadre juridique des activits et des biens cultuels, les
ministres du culte et les fidles, les structures cuOWXHOOHV/H[pres-
sion droit des cultes , prfre jusque dans le titre droit des
religions VHPEOHDLQVLUHOHYHUGXQFKRL[SXUHPHQWVpPDQWLTXH ;
celui-FLSHXWQpDQPRLQVVDYpUHUFRQWHVWDEOH(QHIIHWQXOQHSHXW
ignorer le caractre particulirement restrictif de la notion de
culte par rapport celle de religion , du moins de nos jours :
UHYrWXHGXQFDUDFWqUHMXULGLTXHSDUOD5pYROXWLRQIUDQoDLVHGDQV
un contexte violemment antireligieux, cette notion de culte
tait minimaliste dessein ; elle cantonnait la religion aux seules
pratiques rituelles. Son contenu a nanmoins connu une rapide
volution lui permettant notamment, ds le dbut du 19e s., de
qualifier juridiquement une religion organise, reconnue ou non
(cf. la loi relaWLYHjORUJDQLVDWLRQGHVFXOWHVdu 18 germinal, an X).
Cette volution lui a permis de se maintenir par la suite, par un
phnomne de mimtisme, jusque dans la loi de 1905. Toute la
question est de savoir si cette notion de droit des cultes peut
continuer de nos jours rsister face celle, plus englobante, de
droit des religions . Celle-FLDHQHIIHWODYDQWDJHGHPLHX[FRU-
respondre la conception que la plupart des nations europennes
VHIRQWDXMRXUGKXLGXIDLWUHOLJLHX[TXLLQFOXWGHVFRQcepts, parta-
gs une chelle supranationale, tels que la libert de conscience,
de croyance ou de religion.
Le droit des cultes , formule que prfrent les auteurs, fait
OREMHWGHQVHLJQHPHQWVHWGHUHFKHUFKHVHQ)UDQFHHWOHVDXWHXUV
ont choisi de prsenter un rapide panorama des principaux centres
actifs dans ce domaine (p. 32-35). Parmi ceux-ci figurent les
FHQWUHVGHQVHLJQHPHQW HW GH UHFKHUFKHVWUDVERXUJHRLV , savoir
O,QVWLWXWGHGURLWFDQRQLTXHGHO8QLYHUVLWp0DUF%ORFKTXLSXEOLH
la Revue de droit canonique et le Centre PRISME / Socit, droit et
religions en Europe (CNRS / Universit Robert Schuman) qui
collabore cette publication. Or, les quelques lignes qui leur sont
consacres mritent plusieurs mises au point.
Les auteurs affirmHQW TXH O,QVWLWXW GH GURLW FDQRQLTXH de
Strasbourg, qui a longtemps comport dans son corps ensei-
gnant les meilleurs spcialistes du droit des cultes : Gabriel le Bras,
-HDQ *DXGHPHW QH FRQWLHQW SOXV HQ VRQ VHLQ DXFXQ VSpFLDOLVWH
de droit des cultes (p. 34). Les lecteurs de la RDC apprcieront.
LD V\QHUJLH TXL FDUDFWpULVH OHV UDSSRUWV HQWUH O,QVWLWXW GH GURLW
canonique et le Centre PRISME / Socit, droit et religions en
Europe, dirig par Francis Messner, spcialiste reconnu du droit
des cultes, fait du droit des religions  XQ S{OH GH[FHOOHQFH TXL
cohabite Strasbourg avec le ple droit canonique , aussi bien
au sein du Master 2 de droit canonique et de droit europen
compar des religions, prpar en cohabilitation avec la Facult de
droLW GH O8QLYHUVLWp 5REHUW 6FKXPDQ TXH GDQV OH FDGUH GHV
nombreuses manifestations scientifiques, organises conjointement
par les deux institutions, qui rassemblent canonistes et spcialistes
du droit des religions, et dont les Actes sont rgulirement publis
dans la Revue de droit canonique.
Quant la rorientation  GH O,QVWLWXW GH GURLW FDQRQLTXH
YHUV OpWXGH GH OKLVWRLUH GH OeJOLVH DQFLHQQH HW GHV WKpRORJLHV
orientales  DLQVL TXH OpFULYHQW OHV DXWHXUV S   LO FRQYLHQW GH
prcLVHUTXHO,QVWLWXWDWRXMRXUVHXOHVRXFLGHUpVHUYHUjOKLVWRLUH
GXGURLWHWGHVLQVWLWXWLRQVGHOeJOLVHDQFLHQQHHWPpGLpYDOHXQH
SODFHLPSRUWDQWH(QUpDOLWpO,QVWLWXWVpWDLWDVVXUpGqVVDFUpDtion
en 1920, le concours de professeurs de la Facult de droit de
Strasbourg, qui taient avant tout des historiens du droit et des
LQVWLWXWLRQV &HWWH WUDGLWLRQVHVW GHSXLV SHUSpWXpH HW HVW WRXMRXUV
vivante de nos jours ! Par ailleurs, le droit canonique oriental, aussi
bien ses sources que le droit actuel, fait partie intgrante du pro-
gramme, en pleine conformit avec les directives promulgues en
 SDU OD &RQJUpJDWLRQ SRXU OpGXFDWLRQ FDWKROLTXH GDQV OH
dcret Novo Codice Iuris Canonice qui exigent, entre autres, que le
droit canonique oriental soiWpWXGLpGDQVOHQVHPEOHGHVIDFXOWpVHW
instituts de droit canonique travers le monde.
Marc AOUN

Christa FRATEANTONIO, Religise Autonomie der Stadt im Impe-


rium Romanum. ffentliche Religionen im Kontext rmischer
Rechts- und Verwaltungspraxis, Tubingen, Mohr Siebeck,
2003 (Studien und Texte zu Antike und Christentum, 19),
260 p.
/DXWHXUUpSRQGjXQHTXHVWLRQHVVHQWLHOOHSRXUODFRPSUpKHQ-
sion du dveloppement du christianisme : comment la religion chr-
tienne a-t-HOOHUpXVVLjVLPSRVHUYLV--vis des cultes polythistes au
4e VLqFOH DORUV TXHOOH QpWDLW TXXQH UHOLJLRQ PLQRULWDLUH WDQW GDQV
O(PSLUHG2ULHQWTXHGDQVO(PSLUHG2FFLGHQW ?
/RXYUDJHFRPSUHQGWURLVJUDQGHVSDUWLHV8QHSUHPLqUHSDUWLH
assez courte dfinit les concepts utiliss dans cette recherche sur
OKLVWRLUH GHV LQVWLWXWLRQV URPDLQHV DX e sicle qui se rclame de
ODQDO\VHV\VWpPLTXH'DQVODGHX[LqPHSDUWLHODXWHXULOOXVWUHSDU
de nombreux exemples un inventaire des formes que prend la reli-
JLRQXUEDLQHjWUDYHUVO(PSLUH. La troisime partie, la plus impor-
tante tous gards, analyse les donnes rassembles la lumire
du droit romain rpublicain et imprial et des pratiques adminis-
traWLYHV SURSUHV DX[ FLWpV /DXWHXU \ GpYHORSSH VD WKqVH GXQH
grande autonomie des cits romaines dans la gestion politique et
sociale de leurs religions.
Aprs un tat de la question substantiel (Harnack, Brown, Luh-
mann, MacMullen, Dodds, Chuvin, Barcelo, Thrams, Gottlieb, Van
Dam, Wolff etc.), un premier chapitre rappelle les thmatiques essen-
WLHOOHVWHOOHVODWROpUDQFHUHOLJLHXVHFKH]OHV$QFLHQVODXWRnomie reli-
JLHXVHGDQVOH FDGUHGXQHJHVWLRQ ORFDOHGHVFXOWHVODPRUphologie
sociale et administrative des princiSDOHV UHOLJLRQV GH O$QWLTXLWp OD
dviance religieuse, etc. Aprs cette entre en matire mthodologi-
TXH ODXWHXU FRPPHQFH XQ LQYHQtaire parfois rptitif des formes
prises par la sacra publica dans les cits romaines qui sont ainsi revi-
sites du centre vers la priphrie. On distingue ainsi :
- le culte de la ville de Rome, autrement dit la religion du peu-
ple romain
- les sacra publica des villes latines (Alba, Lavinium, Caenina
p. ex.)
- les sacra publica des villes italiennes (Lanuvium, Tusculum,
Laurentum, Cora, Tibur p. ex.)
- les sacra publica des villes libres et des villes allies (Pergamon,
Thugga p. ex.)
- OHVFRPPXQDXWpVKRUVGHO,WDOLHOHVFRORQLHV Urso, Corinthe
p. ex.).
/H[SORUDWLRQV\VWpPDWLTXHGHODXWHXUUpYqOHOHFRQWHQXPrPH
de ces sacra publica qui touchent aux biens et aux personnes (rle et
statut des pontifeces RIIUDQGHV FpUpPRQLHV FRQVpTXHQFHV GXQH
deditio GURLW SpQDO UHODWLI DX YRO GREMHWV VDFUpV RX DX VDFULOqJH
etc.). De cet examen approfondi des donnes archologiques et de
ODOLWWpUDWXUHMXULGLTXHGHOpSRTXHOHDigeste en particulier, les Ins-
titutiones de Gaus ou encore la Constitutio Antoniniana, il ressort que
les religions du 4e VLqFOH MRXLVVHQW GXQH UHFRQQDLVVDQFH SXEOLque
qui trouve son fondement dans un droit imprial organisant de
IDLW ODXWRQRPLH DGministrative et religieuse de la civitas au plan
ORFDO  OpSRTXH SRVWFRQVWDQWLQLHQQH OHV GpVRUGUHV LQWHUQHV TXL
opposent diffrents groupes chrtiens concurrents entre eux et, de
manire plus gnrale, la concurrence entre chrtiens et non chr-
tiens conduisent une nouvelle gestion politico-religieuse en ter-
mes de seditio et de stasis HWFHVWDLQVLTXHOHVsacra publica sont pro-
gressivement redfinies au profit de la religion chrtienne.
6DQVrWUHREOLJpGHVXLYUHODXWHXUGDQVVHVFRQFOXVLRQVWKpori-
ques clairement anti-OXKPDQLHQQHVRQHVWIUDSSpSDUOLPSRUWDQFH
GXFDGUHXUEDLQ ODYLOOH TXLODVVLJQHDXGpYHORSSHPHQWGHVUHOL-
gions dans ce temps de fondation du christianisme et qui sans
GRXWH FRQWLQXH GRSpUHU GDQV OHV pYROXWLRQV UHOLJLHXVHV Ge notre
WHPSV/RXYUDJHWUqVGRFXPHQWpFRPSUHQGXQUHJLVWUHGHVVRXU-
FHVDLQVLTXHGHX[LQGH[ QRPVHWPDWLqUHV WUqVXWLOHV/DXWHXUD
VRXWHQX XQH KDELOLWDWLRQ VXU 3DXVDQLDV GH 'DPDV j OInstitut fr
Altertumwissenschaften GHO8QLYHUVLWpGH*LHVVHQHQmai 2005 (Von
der Wissensordnung zur Weltordnung. Sophistische Theologie und Geschichte
EHL3DXVDQLDVYRQ'DPDVNXVXQGVHLQHU=HLWJHQRVVHQ).
Jean-Luc HIEBEL

Domingo ANDRS GUTIRREZ, Le forme di vita consacrata.


Commentario teologico-giuridico al codice di diritto canonico,
4XLQWD HGL]LRQH GL (O GHUHFKR GH ORV UHOLJLRVRV 
Ediurcla Roma 2005, 821 p.
&RPPHOHFDUGLQDO3(UG|OLQGLTXHGDQVODSUpIDFHPrPHGX
livre, la cinquime dition (en langue italienne OpGLWLRQRULJinale
en espagnol date de 1984 mais les notes de bas de page ont t
gardes dans la langue de Cervants) du commentaire du droit de
la vie consacre par le canoniste professeur de droit canonique la
IDFXOWpGHGURLWFDQRQLTXHGHO,QVWLWXWSRQWLILFDO utriusque iuris de
O8QLYHUsit du Latran, directeur de la revue canonique bien
connue Apollinaris HW UHVSRQVDEOH GH O Instituto Juridico Clare-
tiano , dont le sige est Rome, est un vnement stimulant et
encourageant pour la science du droit canonique.
%LHQTXLOVDJLVVHGXQFRPPHQWDLUHVXUOHVFDQRQVUHODWLIVDX[
formes de vie consacre dans le Code de 1983, ORXYUDJH a aussi
un certain caractre systmatique et se divise en sept chapitres. Au
premier chapitre sur les normes communes toutes les formes de
vie consacre (can. 573-606, p. 25-96), succde le second et grand
chapitre consacr aux normes des instituts religieux IVCR (can.
608-709, p. 97-708). Le troisime chapitre traite des normes
relatives aux instituts sculiers IVCS (can. 710-730, p. 709-742),
tandis qXH OH TXDWULqPH VLQWpUHVVH aux normes concernant les
socits de vie apostolique SVA (can. 731-746, p. 745-774).
/pWXGHHQILQGDQVOHVWURLVGHUQLHUVFKDSLWUHVH[DPLQHVXFcessi-
vement les normes propres de la vie rmitique ou anachortique
(chap. 5, can. 603, p. 775-786), celles GHORUGUHGHVYLHUJHV FKDS
6, can. 604, p. 787-800) et les normes particulires pour les nou-
velles formes de vie consacre (chap. 7, can. 605, p. 801-810).
Les trois derniers chapitres traitent assez sommairement de ce
qui ne concerne TXun nombre restreint de personnes, ou envisa-
gent les nouvelles formes de dons et de vie consacre. Dans ces
chapitres, la rflexion plus exactement juridique est toujours pr-
cde par une rflexion thologique, ce pour souligner le lien
intrinsque entre fondement thologique et institut juridique, aussi
bien sur le fond que dans la mthode.
Le chapitre introductif ainsi que les suivants, relatifs aux trois
formes de vie consacre actuelles, savoir les instituts religieux,
les instituts sculiers et les socits de vie apostolique, mritent
natuUHOOHPHQW GrWUH WUDLWpV DYHF SOXV GH dveloppements. Dans
XQHQRWHDXOHFWHXUODXWHXULQGLTXHODPpWKRGHHWOHVFULWqUHVTXL
ORQW JXLGp GDQV OD FRQGXLWH GH VRQ pWXGH TXLO D YRXOX GpIinir,
VHORQOHVSULWPrPHGX&RQFLOH9DWLFDQ,,FRPPHWKpRORJLTXHHW
canonique.
Chaque canon est comment dans un triple ou mme quadru-
ple aspect. En premier lieu, la prsentation de la norme, suivie des
sources juridiques et thologiques qui la fondent. Parfois est mise
DXVVLHQUHOLHIODJHQqVHGXWH[WHTXLFRPPHXQHQRWHOH[SOLTXH
renvoie toujours ce qui est contenu dans la revue Communicatio-
nesODVRXUFHSOXVILDEOHSRXUXQHFRPSUpKHQVLRQH[DFWHGHOpYR-
lution du texte. Vient en dernier lieu la partie plus importante et
SHUVRQQHOOH GX FRPPHQWDLUH LQGLTXpH FRPPH JORVH PrPH VLO
VDJLW HQ YpULWp GH JORVH DPSOH GpYHORSSpH GH PDQLqUH j GRQQHU
YLHjXQDSSDUDWGHJORVHVFHVW--dire un commentaire. Enfin, la
bibliographie est toujours donne dans la note de bas de page
correspondante.
LDXWHXU QH VH GpWDFKH MDPDLV de cette mthode bien prcise,
PrPHVLOHFDUDFWqUHV\VWpPDWLTXHGHOpWXGHUHVVRUWGHODFDSDFLWp
GHODXWHXUGLQVpUHUOHVGLIIpUHQWVFDQRQVGDQVXQGpYHORSSHPHQW
ordonn des chapLWUHVHWGHVSDUDJUDSKHV'DQVOLQWURGXFWLRQSDU
exemple, compose de 15 paragraphes, il commence par le con-
cept thologique de vie consacre (1) pour finir avec le paragraphe
relatif la vie fraternelle partage par toutes les formes de vie
consacre. De cette manire la prsentation continue de chaque
FDQRQ VLQVqUH GDQV XQH prsentation KDUPRQLHXVH GH OHQVHPEOH
qui rend comprhensible de faon synthtique une exposition ana-
lytique et particulire.
Il aurait t prfrable que de la mme manire soit maintenue
dans les chapitres suivants cette subdivision en paragraphes (avec
les ncessaires sous paragraphes). Une mthode de numrotation
continue a t au contraire adopte qui quelquefois peut laisser
SHUSOH[H SXLVTXRQ DWWHLQW DYHF OH FKDSLWUH VII) le nombre ou
paragraphe 214 ; la distinction systmatique entre paragraphes et
sous paragraphes QHVWGRQFSOXVUHVWpHFODLUH2QDXUDLWHQRXWUH
souhait, outre OLQGLFH GHs sigles et abrviations, un indice
systmatique (partiellement prsent dans certaines ditions prc-
denWHV  DVVH] XWLOH SRXU OH OHFWHXU GDQV XQH XYUH DXVVL JUDQGH
SRXU XQH PDWLqUH GDQV ODTXHOOH ODXWHXU HVW UpSXWp rWUH XQ PDvWUH
dans le domaine canonique, mais dans laquelle aussi des collgues
de travail et de recherche commune sont moins informs.
Nous aSSURXYRQV OH FKRL[ IDLW SDU ODXWHXU Palgr des opi-
QLRQVOpJLWLPHPHQWGLYHUVHVGXIDLWTXHQHIIHWOHVVRFLpWpVGHYLH
apostoOLTXHQHVHUDLHQWSDVOLpHVSDUGHVYX[HWPDOJUpOHQFDdre-
ment spcifique qui leur est rserv par le code latin) de les inclure
parmi les formes de vie consacre, du moins dans un sens plus
large et surtout substantiel.
Assurment un aspect qui pourrait merger, compte tenu du
fait que les instituts et les personnes de vie consacre vivent dans
la quasi-totalit des pays du mondeFRQFHUQHGXQHSDUWODSSOLca-
tion des rgles canoniques aux divers systmes juridiques (surtout
pour ce qui regarde les questions patrimoniales, can. 634-640),
GDXWUHSDUWODSRVVLEOHFDQRQLVDWLRQGHGLYHUVHVQRUPHVtatiques
(de droit civil, mais aussi de droit public) compatibles avec les
principes du systme canonique. Mais cela aurait comport une
analyse comparative trs complexe et probablement allant au-del
GHVFRPSpWHQFHVSHUVRQQHOOHVGHODXWHXU
Ce compte rendu enfin pourrait entrer dans les dtails de cha-
cune des gloses en trouvant des aspects apprciables et en critiquant
ventuellement certaines interprtations donnes. De manire
gnrale, RQ SHXW VRXOLJQHU ODPSOHXU HW ODSSURfondissement avec
lesquels chaque canon a t comment, soit au plan littraire, soit
par les renvois et les comparaisons avec la matire toute entire, et
par des confrontations avec des figures juridiques analogues.
3XLVTXLOQHVWWRXWHIRLVSDVSRVVLEOHGHQWUHUGDQV les dtails de
chacun des canons, on se limitera un exemple qui pourra valoir
SRXU WRXWH OXYUH 1RXV QRXV DUUrWRQV GRQF VXU XQ FDQRQ TXL
SHXWSUpVHQWHUXQDVSHFWGLJQHGrWUHUHOHYp LOVDJLWGXFDQ
qui tend aux religieux certaines des obligations rserves aux
clercs. Parmi elles celle prvue par le can. 286 qui leur interdit
OH[HUFLFH GH WRXWH DFWLYLWp OXFUDWLYH RX FRPPHUFLDOH 8Q FDQRQ
trs technique et difficile interprter. Mais dans le commentaire
TXLO IDLW ODXWHXU HQ GRQQH VXEVWDQWiellement (renversant ainsi la
lettre du canon) une interprtation positive : Dans le concret, il
VHGpGXLWTXHOHVUHOLJLHX[DYHFODXWRULVDWLRQUHTXLVHGHODSDUWGH
ODXWRULWpUHOLJLHXVHSHXYHQWIDLUHOHQpJRFHHWOHFRPPHUFHSRXU
soi-mme ou pour les autres, pour leur utilit personnelle ou celle
des autres  /H[FHSWLRQ GH ODXWRULVDWLRQ SDU ODXWRULWp HFFOp-
siastique transforme donc la porte de la norme, mme si ensuite
il ajoute que la chose dont il faut tenir compte est celle de
dcouvrir ce que le lgislateur entend par ngoce dans toutes ses
variantes . Dans la suite du commentaire il se prcisera avec
PXOWLSOHV GLVWLQFWLRQV FH TXHVW OH QpJRFH SHUPLV HW FH TXHVW OH
commerce interdit.
&RPPHOH[HPSOHOHPRQWUHDVVH]ELHQOpWXGHQHVHOLmite pas
une simple exgse littrale, mais travers une interprtation
adTXDWH HW LQWHOOLJHQWH SHUPHW GDOOHU DX-del de la lettre et de
pnWUHUOHVSULWDXWKHQWLTXHHWODSRUWpHSOXVFRUUHFWHGHODQRUPH
prise en considration.
En conclusion, commHGDXWUHVUHPDUTXDEOHVUHFHQVHXUVORQW
indiqu, nous sommes devant un travail qui, sur le plan thorique
et pratique, offre une des analyses les plus amples et approfondies
GDQVFHGRPDLQHSDUIRLVFRPSOH[HGHODGLVFLSOHFDQRQLTXHFHVW-
-dire le droit (latin) des religieux. Justement parce que cette tude
concerne la thorie et la pratique, soit la science et la doctrine soit
les oprateurs juridiques sur le terrain peuvent y trouver, les uns
des stimulations pour des analyses ultrieures et un approfondisse-
ment scientifique, les autres des approches utiles pour une solu-
tion adquate GpYHQWXHOVSUREOqPHV
Pier V. AIMONE
Matthias PULTE, Das Missionsrecht, ein Vorreiter des universalen
Kirchenrechts, (Studia Instituti Missiologici Societatis Verbi
Divini, Nr. 87), Steyler Verlag / Nettertal 2006, 663 p.
Le travail ici recens (Le droit missionnaire, un prcurseur du
droit canonique universel) qui a t DFFHSWp DX VHPHVWUH GKLYHU
2004/05 FRPPH WUDYDLO GKDELOLWDWLRQ SDU OD )DFXOWp GH 7KpRORJLH
catholLTXHGHO8QLYHUVLWpGH5XKU%RFKXPSRUWHOHVRXV-titre sui-
vant : Einflsse aus den Missionen auf die konziliare und nach-
konziliare Gesetzgebung der lateinischen Kirche (Les influences
du droit missionnaire sur la lgislation conciliaire et postconciliaire
GHOeglise latine).
2QOHVDLWFHVWDYHFOH&RGHGH83 seulement que le droit mis-
sionQDLUH D IDLW OREMHW GXQH pODERUDWLRQSOXV V\VWpPDtique (Livre
III, titre II, can. 781-792), laquelle faisait dfaut dans le code
prcdent, qui ne lui aYDLW GDLOOHXUV FRQVDFUp TXH  FDQRQV (Q
effet, on trouve une quivalence partielle du can. 782, 1 dans le
can. 1350, 2 (CIC/1917) qui dsigne en substance le Saint-Sige
comme responsable des missions, ainsi que le can. 252 en ce qui
concerne la congrgation de la Propagande de la foi, alors que le
can. 787, 2 reprend en quelque sorte le can. 1351 relatif la
OLEHUWpGDGKpUHUjODIRLFDWKROLTXH
,OVDJLWGXQHpWXGHDSSURIRQGLHVXUOHGURLWPLVVLRQQDLUHYX
sous un profil historico-systmatique, structure de la manire
suivante : une introduction gnrale, cinq chapitres et une conclu-
sion enrichie de certaines observations. FHFRQWHQXVDMRXWHQWXQ
LQGLFHGHVQRPVHWGHVFKRVHVDLQVLTXXQHOLVWHGpWDLOOpHGHVVRXU-
ces et la bibliographie.
SURSRV GH OpWXGH HOOH-mme, une petite critique for-
melle VLPSRVHSHXW-tre HOOHFRQFHUQHFHUWDLQHVIDXWHVGLPSUHV-
VLRQTXLORUVTXLOVDJLWGHVSDUROHVRXH[SUHVVLRQVODWLQHVSRVHQW
quelTXHV SUREOqPHV GLQWHUSUpWDWLRQ SDU H[HPSOH S  GHX[
fois servissime au lieu de severissime, ou aussi OIndex librorum prohibito-
rum devenu OIndex verborum prohibitorum, p. 73). Par ailleurs, les
congrgations de la curie romaine (souvent cites) ayant perdu,
par une juste dcision de Paul VI en 1967 (Const. Regimini Ecclesiae
Universae ODGMHFWLIVDFUpH 6 TXLOHVDYDLWDFFRPSDJQpHVSHQGDQW
quatre sicles, elles auraient d ne pas porter le S ORUVTXHOOHV
taient cites pour des activits ou des dcrets publis aprs 1967.
Certaines prises de positLRQ SDUH[HPSOHTXHO,QVWUXFWLRQGH
1997 Ecclesia de mysterio, sur la collaboration des lacs au ministre
RUGRQQp GDQV ODFWLYLWp SDVWRUDOH GHYLHQQH XQ GpFUHW JpQpUDO GX
IDLW TXHOOH D pWp SDUWLFXOLqUHPHQW DSSURXYpH SDU OH SDSH  VRQW
sujettes discussLRQ2QQRWHUDGDLOOHXUVTXHOHVHXOFRPPHQWDLUH
VXUOHTXHOVDSSXLHFHWWHDIILUPDWLRQSURYLHQWGXQHpFROHFDQRQL-
que bien dtermine.
Le premier chapitre (p. 35-258), de caractre historique, pr-
sente les dispositions du droit missionnaire du 16e sicle au
Concile Vatican II. Trois poques y sont distingues, subdivises
leur tour en priodes : - GHV SUHPLHUV VLqFOHV j OpUHFWLRQ GH OD 6
Congrgation de propagande fide (SCPF) au 17e sicle ; - de 1622
1917 ; - de la promulgation du CIC 1917 la veille du Concile
Vatican II. La dernire priode de la premire poque (16e sicle)
est caractrise par le droit de concession et du patronat de la part
du pape aux ordres religieux et aux puissances sculires. Au cours
GHODVHFRQGHpSRTXHODXWHXUIL[H un premier terme de division
en 1803 (le pillage napolonien de la curie romaine, a provoqu de
graves pertes dans les archives de la SCPF) ; considre le 19e sicle
comme la priode la plus florissante de la mission extra-euro-
penne et tablit une dernire priode, partir de 1908 (anne o
O$PpULTXH GX 1RUG FHVVH GrWUH WHUULWRLUH GH PLVVLRQ  MXVTXj
Vatican II. Une nouvelle poque du droit missionnaire commence
sans doute avec Vatican II et trouve une premire systmatisation
dans la codification de 1983.
'XSUHPLHUFKDSLWUHRQSHXWDSSUpFLHUOpWHQGXHGHODUHFKHU-
che par rapport aux documents pontificaux et ceux de la curie.
&HSHQGDQWLOQDSDVWRXMRXUVpWpIDFLOHGHFLEOHUWRXWFHTXLLQWp-
UHVVH XQ GRPDLQH GpWHUPLQp 3DU H[HPSOH OLQWHUGLFWLRQ pour les
SUrWUHV GH[HUFHU XQH DFWLYLWp FRPPHUFLDOH RX GHQWUHSULVH FDQ
286 CIC/83) avait trouv une particulire importance (aussi sur le
plan du droit pnal) exactement par rapport au droit missionnaire.
/RQVDLWTXHGDQVFHGRPDLQHSUpFLVOHSDSH8rbain VIII (Const.
Ex debito du 22 fvrier 1633) avait svrement prohib aux mis-
sionnaires toute activit commerciale, interdiction que Clment IX
(Const. Sollicitudo GXMXLQ FRQILUPDLW DMRXWDQWGDLOOHXUVOD
clause qui demeura par la suite, de OLQWHUGLFWLRQGXFRPPHUFHHW
GHQpJRFHPrPHDXSURILWGDXWUXL HWVDQFWLRQQDLWSDUGHVSHLQHV
SOXV JUDYHV FRPPH OH[FRPPXQLFDWLRQ latae sententiae, sanctions
reprises et confirmes plus tard par Pie IX (Const. Apostolicae Sedis
de 1869 et le dcret de la S. Congregatio Inquisitionis du 4 dcembre
1872, ainsi que le dcret de la S. Congregatio de propaganda fide du 29
mars 1873). Ces svres dispositions concernaient tous les mis-
sionnaires prtres et religieux, partout dans le monde (Indes
orientales, ChLQH$PpULTXH HWODEVROXWLRQGHOH[FRPPXQLFDWLRQ
tait subordonne la restitution de tous les profits raliss, en les
consignant aux Ordinaires des lieux. Une rfrence indirecte ce
thme (sur le plan de la honesta vita clericalis) se retrouve dans OH[D-
men des dispositions des conciles plniers de Baltimore (p. 107).
Au sujet de la thse soutenue que le droit missionnaire, rser-
vant au Sige Apostolique toute responsabilit pour les missions, a
contribu la disparition du droit de patronat (qui a par ailleurs
t discut au Concile Vatican II et qui rsiste encore par exemple
en Suisse) ne peut tre que partiellement consentie. notre avis,
seule une ecclsiologie radicalement neuve peut dterminer un tel
changement  LO QHVW SDV pYLGHQW HQ HIfet que certaines disposi-
tions lgislatives aient une majeure ou mineure efficacit.
Le deuxime chapitre (p. 259-383) traite du rle jou par les
PLVVLRQVGDQVOHVGpFLVLRQVGXFRQFLOH2Q\GpFRXYUHGXQF{Wp
la participation des missions la prparation du concile (phase
avant prparatoire et prparatoire) HWGHODXWUHODUHSUpVHQWDWLRQ
des missions et des vques missionnaires dans les dbats conci-
OLDLUHV3DUPLOHVQRPEUHX[WKqPHVTXLRQWIDLWOREMHWGHVUpSRQ-
ses et des propositions des missions dans tous les domaines du
droit canonique, nous voudrions relever le droit matrimonial,
SURSUHPHQW SDUFH TXHQ FH GRPDLQH SUpFLV OH GURLW PLVVLRQQDLUH
du 16e sicle avait introduit certaines innovations importantes qui
ont t maintenues dans le CIC 1917. Au cours du 19e sicle, le
droit missionnaire avait fortement intress les mariages mixtes,
GRQWODFpOpEUDWLRQpWDLWGpFRQVHLOOpHHWVLOVYHQDLHQWjrWUHFpOp-
brs, ils taient soumis aux rudes dispositions protectrices du
conjoint catholique. En raison du principe de la forme canonique
ad validitatem, le mariage civil tait considr par les catholiques
FRPPH XQ FRQFXELQDJH HW OH GLYRUFH FLYLO QDYDLW DXFXQH YDOHXU
Aussi aprs la promulgation du CIC 1917, des innovations furent-
elles introduites propos des dispenses matrimoniales, rserves
au Sige Apostolique, mais concdes ventuellement aux mis-
sionnaires. Les vques missionnaires prsentaient des proposi-
tions sur les mariages mixtes, sur les empchements matrimo-
niaux, sur le privilge de la foi et sur la forme canonique. En ce
qui concerne les procs matrimoniaux, les principales propositions
concernent : le juge unique, les tribunaux interdiocsains, la
renonciation la double sentence conforme, le droit des conjoints
(mme le fautiI GLQLWLHUOHSURFqVGHGpFODUDWLRQGHQXOOLWp
Le troisime chapitre (p. 384-  VLQWpUHVVH DX GpYHORppe-
PHQWXOWpULHXUGHOLQIOXHQFHGXGURLWPLVVLRQQDLUHGDQVODOpJisla-
tion post-FRQFLOLDLUH GH OeJOLVH XQLYHUVHOOH DLQVL TXj OD SODFH GX
droit missionnaire dans le CIC 1983 et de la Constitution aposto-
lique de 1988 consacre la curie romaine. Ici encore, nous accor-
dons un intrt particulier au droit matrimonial (il faut noter
cepenGDQWTXHGDQVOHWUDYDLOFHVWFKDFXQGHVGLIIpUHQWVGRPDLQes
du droit canonique qui ont t examins) : en effet, des glises
missionnaires proviennent diffrentes observations sur la nouvelle
dfinition du mariage comme tant un consortium totius vitae, sur
OLGHQWLWpFRQILUPpHHQWUHFRQWUDWHWVDFUHPHQWVXUOD forme cano-
nique de la clbration ad validitatem, sur les empchements matri-
moniaux, ainsi que sur les mariages mixtes.
Dans le quatrime chapitre (p. 496-514), bref mais non moins
signiILFDWLIGDQVOHQVHPEOHGXWUDYDLOVRQWH[DPLQpHVOHVSURposi-
WLRQVQRUPDWLYHVIDLWHVSDUOHVDXWRULWpVPLVVLRQQDLUHVHWTXLQRQW
pas t accueillies dans le CIC/1983. En particulier, en ce qui
concerne le droit matrimonial, est soulign le fait que le pouvoir
de dispense super rato et non consummato ou aussi celui de la validit
GHODIRUPHFDQRQLTXH jOH[FHSWLRQGHVPDULDJHVPL[WHV UHVWHQW
UpVHUYpVDX6DLQW6LqJHWDQGLVTXHSRXUEHDXFRXSGDXWUHVFDVGH
dispense OHSULQFLSHGXQHHIIHFWLYHGpFHQWUDOLVDWLRQ a t appliqu.
Le principe de subsidiarit a en effHW pWp OXQ GHV SOXV VRXKDLWpV
par le droit missionnaire. Pour rester dans un cadre proche du
GURLW PDWULPRQLDO VXEVWDQWLHO FHVW--dire le droit processuel,
ODXWHXU UHJUHWWH ODEVHQFH GXQH XQLIRUPLWp DGpTXDWH GH OD MXULV-
prudence ecclsiastique, soulignant la possible discordance entre
jurisprudence rotale et jurisprudence locale, surtout en matire
PDWULPRQLDOH8QHREVHUYDWLRQSDVVHXOHPHQWWKpRULTXHSXLVTXLO
DUULYH UpHOOHPHQW TXLO \ Dit quelquefois une forte divergence
GLQWHUprtation entre la jurisprudence rotale et celle des tribunaux
des glises locales (on pensera par exemple la trs large appli-
cation GHVK\SRWKqVHVSUpYXHVSDUOHFDQ /DXWHXUHQVXLWH
PHW HQ pYLGHQFH TXHOTXHV DXWUHV SRLQWV TXRQ SHXW UDSSHOHU ,O
regrette en fait ODEVHQFHGXQVRXKDLWDEOHFRGHGXGURLWPLVVLRQ-
naire qui pouvait unifier toutes les particularits inhrentes ce
GURLW SRVH OD TXHVWLRQ VXU XQH IXWXUH SRVVLELOLWp GDXWRULVHU OHV
GLDFUHV j DGPLQLVWUHU OH VDFUHPHQW GH ORQFWLRQ GHV PDODGHV HW
souhaite, toujours de iure condendo, la renonciation la distinction
entre peines latae et ferendae sententiae, soit en accueillant la disci-
pline du CCEO, soit en se conformant aux lois pnales tatiques.
Le cinquime chapitre (p. 515-573) prend en considration les
impulsions drivant du droit missionnaire un droit canonique
SDUWLFXOLHU FHOXL UHODWLI j ODLUH JHUPDQLTXH 3DU DLOOHXUV LO HVW
amplement tenu compte de la pratique et de la doctrine canonisti-
que nord-amricaine, dont les perspectives et les impulsions sont
adoptes aussi de manire comparative. GDXWUHVpJOLVHVORFDOHV
et autres doctrines canonistiques (italienne, espagnole, franaise,
SRORQDLVH  LO QHVW SUDWLTXHPHQW MDPDLV IDLW DOOXVLRQ ,FL VRQW
affrontes des questions importantes que les pJOLVHVORFDOHVGDLUH
germanique sont appeles rsoudre, en particulier le rle jou
SDU OHV ODwFV HQ GLYHUV GRPDLQHV GH ODGPLQLVWUDWLRQ GHV VDFUH-
ments ou sacramentaux la cure pastorale. Si en effet il est incon-
testable que dans des vastes territoires de mission il existe une
relle carence du clerg, le mme discours peut tre tenu mais de
faon relative, notre humble avis, en ce qui concerne les glises
ORFDOHVGDQVODLUHJHUPDQLTXH
propos du droit matrimonial, la possibilit concde aux
ODwFV GH UHSUpVHQWHU Oglise en qualit de tmoins qualifis est
GXQHJUDQGHLPSRUWDQFHGDQVFHFRQWH[WHSDUWLFXOLHU ; concession
fortement souhaite par certaines glises missionnaires, comme
FHOOHVGHO$PpULTXHODWLQH6RQDSSOLFDWLRQUHVWHFHSHQGDnt assez
OLPLWpH TXDWUHSD\VGX6XGGHO$PpULTXHHWOH&DQDGD ,OQDSDV
t cependant concd aux lacs, mme dans les glises mission-
QDLUHVODXWRULVDWLRQjGLVSHQVHUGHVHPSrFKHPHQWVPDWULPRQLDX[
PrPHVXUGpOpJDWLRQGXIDLWTXXQHWHOOHIDFXOWp contrairement
ODVVLVWDQFHDX[PDULDJHVDXUDLWH[LJpODFRQFHVVLRQGXSRXYRLUGH
gouYHUQHPHQWTXLQHUHYLHQWTXDX[PLQLVWUHVRUGRQQpV
(Q SOXV VXU OH SODQ WKpRORJLTXH ODXWRULVDWLRQ DX[ GLDFUHV HW
plus encore aux lacs assister et bnir les noces pourrait ouvrir le
dbat, mme pour des raisons FXPpQLTXHV HQ UDSSRUW DYHF OHV
JOLVHV RULHQWDOHV DX VXMHW GH OD IRQFWLRQ GX SUrWUH GDQV ODGPL-
QLVWUDWLRQGXVDFUHPHQWGHPDULDJHGRQWOHVPLQLVWUHVVRQWGDSUqV
ODWUDGLWLRQGXUHVWHFRQVROLGpHGDQVOpglise latine, les poux eux-
PrPHV ,O HVW YUDL SDU DLOOHXUV TX LO QH[LVWH DXFXQH GpILQLWLRQ
dogmatique sur le ministre du sacrement de mariage. Pour des
UDLVRQVGHGLDORJXHFXPpQLTXHVXUWRXWDYHFOHVpJOLVHVRUWKRdo-
xes, des thologiens catholiques et mme certains canonistes
metWHQWTXHOTXHIRLVOHYXTXHVRLWUHFRQVLGpUpOHU{OHGXSUrWUH
GDQV ODGPLQLVWUDWLRQ GX VDFUHPHQW GH PDULDJH 'DQV FHWWH
perspective, le prtre ne serait plus seulement considr comme
VLPSOH UHSUpVHQWDQW GH Oglise o comme tmoin qualifi. Serait
DORUV PLVH HQ TXHVWLRQ OD SRVVLELOLWp GHV GLDFUHV GDVVLVWHU DX[
PDULDJHV SUpYXH SDU OH &,& FRPPH GDLOOHXUV OpYHQWXDOLWp
de consentir aux lacs de jouer ce rle, mme de faon limite et
exceptionnelle.
Dans cette relecture du travail, nous nous sommes limit uni-
quement aux nombreux exemples lis au droit matrimonial ORQ
peut cependant clairement voir comment le droit missionnaire,
GURLWGH[FHSWLRQSDUUDSSRUWjODQRUPHJpQpUDOHDSXVHUYLUGH
stimulant une interprpWDWLRQ SOXV IOH[LEOH GLQVWLWXWV MXULGLTXHV
SURSUHV GX GURLW JpQpUDO HW j OLQQRYDWLRQ RX OH FKDQJHPHQW HQ
GDXWUHV GRPDLQHV GX GURLW FRQVWLWXWLRQQHO GH Oglise au droit
processuel, des normes sur le statut clrical et religieux au droit
pnal canonique, du droit administratif au droit sacramentel (et de
tous ces domaines sont fournis des exemples significatifs).
Le lien entre droit missionnaire et certains aspects innovateurs
du droit canonique universel et particulier est soutenu avec vigueur
et abondaQFH GDUJXPHQWV SDU ODXWHXU ,O VDJLW GH VD WKqVH HW OHV
arguments pour la soutenir ne font certes pas dfaut. Si tel est
vraiment le cas, la question reste ouverte. Il serait peut-tre plus
raliste plutt de soutenir un certain inter-change entre droit
missionnaire et droit canonique universel et particulier. Le lecteur
instruit par ce travail correct et toff de nombreuses rfrences
aux documents juridiques et de rflexions pertinentes pourra la
fin formuler son propre jugement. En ce qui nous concerne, notre
apprciation gnrale reste, en dpit de petites rserves et obser-
vations que nous avons avanc, positive.
Pier V. Aimone

Massimo FAGGIOLI & Alberto MELLONI (d.), Religious


Studies in the 20th Century. A Survey on Disciplines, Cultures and
Questions, Berlin, Lit Verlag, 2006, 341 p. (ISBN 3-8258-
8205-5).
Les sciences religieuses en franais, il vaut mieux dire scien-
ces des religions ont beaucoup volu au cours du sicle cou-
Op GHSXLV OD FULVH PRGHUQLVWH MXVTXj OD JOREDOLVDWLRQ Dctuelle, en
SDVVDQWFRPPHOHUDSSHOOHOLQWURGXFWLRQG$OEHUWR0HOORQLSDUOD
Shoa. Un colloque international tenu Assise en dcembre 2003,
dont ce livre prsente les actes, a cherch explorer cette histoire.
Selon Giovanni Filoramo, on peut distinguer trois phases : la
SUHPLqUHTXLGXUDMXVTXjODSUHPLqUHJXHUUHPRQGLDOHYLWVHGpYH-
ORSSHUODQDO\VHGHVFRPSRUWHPHQWVUHOLJLHX[LQGLYLGXHOVHWFROOHFWLIV
au moyen des sciences humaines. La seconde, entre les deux
guerres, fut domine par la phnomnologie. La troisime enfin,
partir des annes 1960, vit une multiplication des approches pluri-
GLVFLSOLQDLUHVHWXQHGpFRQVWUXFWLRQGHOREMHWGptudes (la religion),
qui apparat de plus en plus comme complexe et insaisissable.
Les contributions abordent une grande varit de thmes : Har-
nack et le rapport entre thologie et sciences religieuses (Th. Ho-
ward) ; Loisy et Blondel (R. Ciappa)  OH[pJqVH ELEOLTXH GRPLne
par la mthode historico-critique allemande (G. Ghiberti) ; les outils
informatiTXHV 3 7RPEHXU  8QH VpULH GDUticles prsente les
sciences des religions dans divers pays : France (C. Langlois, E.
Fouilloux), tats-unis (F. Kilcoyne), Espagne (F. Montero), Allema-
gne (C. Arnold), Italie (M. Lupi) et Grande-Bretagne (N. Tanner).
Deux articles sont consacrs au droit canonique. C. Fantappi
distingue quatre priodes au cours du 20e sicle :
entre 1904 et 1917, le processus de codification a dissoci le
GURLW FDQRQLTXH SRVLWLI HW OKLVWRLUH GX GURLW FDQRQLTXH ;
cette dernire devint une discipline part entire avec des
auteurs comme Stutz, Gillmann, Weigand, Le Bras, Van
Hove, Jemolo, Kuttner, etc. ; mais en mme temps, le droit
canonique perdait ses rfrences historiques ;
ODVHFRQGHSpULRGHGHjDpWpFRQVDFUpHjOex-
JqVHGX&RGHDYHFFHSHQGDQWXQHGLYHUJHQFHGLQWHUSUpta-
WLRQ HQWUH OpFROH HFFOpVLDVWLTXH GHV IDFXOWpV SRQWLILFDOHV HW
OpFROHODwTXHLWDOLHQQHGHVIDFXOWpVGHGURLW '$YDFN)HGH-
OH -HPROR *LDFFKL  /H GURLW FDQRnique devint une
matire dominante dans le champ de la thologie, influen-
ant aussi bien la pastorale, la liturgie, la thologie sacra-
mentaire, que la thologie morale. Les facults de droit
canonique se multiplirent un peu partout dans le monde ;
la troisime priode fut celle de la rdaction des deux codes
actuels, entre 1965 et 1990 ; elle vit se dvelopper les dbats
WKpRULTXHVVXUODSODFHHWODIRQFWLRQGXGURLWGDQVOeJOLVH
DYHF OD FRQVWLWXWLRQ G coles telles celles de Navarre
(Lombarda), de Munich (Mrsdorf), ou de la revue Conci-
lium (Huizing). Les rapports entre droit, thologie et droit
FDQRQLTXH ILUHQW OREMHW GH PXOWLSOHV K\SRthses, dont
C. Fantappi donne une synthse clairante ;
lD GHUQLqUH SpULRGH HVW ODFWXHOOH GRPLQpH SDU OHV TXHVWLRQV
GLQWHUSUpWDWLRQ HW FDUDFWpULVpH SDU OLQWHUQDtionalisation des
pWXGHVFDQRQLTXHV,OUHVWHVHORQODXWHXUjFRPEOHUOHIRVVp
TXLVHVWFUHXVpGHSXLV9DWLFDQ,,HQWUHOHVWKpRORgiens, avec
leur mentalit souvent anti-juridique, et les canonistes.
Le second article qui traite du droit canonique et du droit des
religions est celui de Richard Puza sur Thologie, histoire et
droit dans les facults de thologie en Allemagne . R. Puza donne
la liste des facults et instituts allemand o est enseign le Kirchen-
recht qui englobe le droit tatique des religions, le droit canoni-
TXH FDWKROLTXH OH GURLW LQWHUQH SURWHVWDQW HW OKLVWRLUH GX GURLW
canonique , en prcisant le nom du professeur titulaire de la
chaire, ainsi que la liste des instituts de recherche sur les mmes
questions. Quelques indications bio-bibliographiques sont four-
nies sur trois grands canonistes allemands : Friedberg (1837-1910),
Sohm (1841-1917) et Hinschius (1835-1898). Sont ensuite analy-
VpHVOHVPpWKRGHVGLQWHUSUpWDWLRQGXStaatskirchenrecht, cHVW--dire
du droit tatique des cultes : mthodes historique, juridique, socio-
logique, comparative, etc. En conclusion, R. Puza regrette que les
concordats actuels, dans les nouveaux Lnder, soient signs du
F{Wp GH OeJOLVH SDU 5RPH HW QRQ SDU OHV pYrques concerns. Il
indique deux volutions possibles du droit des religions, tenant
FRPSWH WRXWHVGHX[ GX SOXUDOLVPH UHOLJLHX[ TXL FDUDFWpULVH O$OOH-
magne actuelle : adapter le droit ce pluralisme (par exemple en
supprimant le mariage civil obligatoire), ou mme passer un
systme de droit personnel, o les groupes religieux et sociologi-
TXHVGLVSRVHUDLHQWGXQV\VWqPHOpJDOSDUWLFXOLHUFRPPHHQ,VUDsO
ou au Liban. Est-ce vraiment un avenir souhaitable en Europe ?
Richard Puza ne se prononce pas. Les dclarations rcentes, le 7
fvrier 2008, GHODUFKHvque de Cantorbry, Mgr Rowan Williams,
VXUOLQWURduction invitable de la charia au Royaume-Uni, vont
en tout cas dans ce sens.
Jean WERCKMEISTER
Marcel METZGER, La coutume comme modle pour le nouveau droit
liturgique, RDC 55/2, 2005, p. 251-270.
Les pratiques lgislatives ne semblent pas adaptes aux questions de
rception des textes liturgiques. La rception de la Prire eucharistique
qui peut tre employe dans les messes pour des circonstances particu-
lires , promulgue en 1991, est un exemple qui le montre. Le verbe
abroger qui a t employ, illustre une tendance qui consiste trans-
poser dans la pastorale de la prire liturgique des fonctionnements de
W\SH OpJLVODWLI 3RXUWDQW OHV SULqUHV OLWXUJLTXHV UHOqYHQW GXQ DXWUH JHQUH
littraire que les textes lgislatifs. La tradition antique estimait que ce
GRPDLQHUHOHYDLWGHODFRXWXPH&HVWGHIDLWFHUWDLnement le modle de
la coutume qui convient le mieux aux missions actuelles des confrences
piscopales, de rgulation de la prire liturgique et de son expression
dans les diffrentes langues. En ce domaine, en effet, les communauts
chrtiennes sont tributaires des usages locaux et de leurs volutions
parfois imprvisibles.

Edoardo DIENI, /HWUDJLTXHGHOLQWHUSUpWDWLRQGDQVOHGURLWFDQRQL-


que, RDC 55/2, 2005, p. 271-297.
3RXU H[HUFHU VD WkFKH GLQWHUSUpWDWLRQ OH MXULVWH GLVSRVH GXQH VpULH
GDUJXPHQWV,OVHPEOHTXHOLQWHUSUpWDWLRQUHOqYHSOXVGHODUWGUDPDWLTXH
TXH GXQH VFLHQFH 3RXUWDQW OH GURLW QH SHXW SDV VH SDVVHU GH
OLQWHUSUpWDWLRQ /D WKpRULH GpFRQVWUXFtionniste du philosophe Jacques
Derrida offre des perspectives intressanWHVSRXUOLQWHUprtation en droit
canonique. Par ailleurs, des tudes thoriques, entre thologie et droit,
plaident pour une vision crative GHOLQWHUSUpWDWLRQRWRXVOHVVXMHWV
concerns seraient habilits participer la dtermination de la rgle.
Dans cette optique, OLQWHUprtation serait la recherche en commun,
dialectique et jamais acheve, un moment donn, de la meilleure solu-
tion possible un problme.

Emmanuel TAWIL, /LQWHUSUpWDWLRQ GX GURLW FDQRQLTXH SDU OHV


autorits sculires, RDC 55/2, 2005, p. 299-324.
/HVRUJDQHVGHOeWDWSHXYHQW rWUHFRQGXLWVjSUHQGUHHQFRPSWH OH
droit interne des religions. Pour comprendre le droit canonique, il est
QpFHVVDLUHGHOHUHSODFHUGDQVVRQFRQWH[WH,OVDJLWSRXUOHVMXJHVVpFX-
OLHUVGDYRLUXQDSHUoXJpQpUDOSHUmettant de ne pas dnaturer le droit de
OeJOLVH /HV DXWRULWpV VpFXOLqUHV RQW LQWHUSUpWp OH GURLW FDQRQLTXH GDQV
plusieurs domaines (nature et fondement du droit canonique, constitu-
WLRQKLpUDUFKLTXHGHOeJOLVHGURLWPDWULPRQLDOHWSURcdure canonique).
Si le 19e sicle a connu des juristes particulirement comptents pour
OLQWHUSUpWDWLRQGXGURLWFDQRQLTXHLOVHPEOH\DYRLUDXMRXUGKXLGDYDQ-
tage de difficults de comprhension.

Rmy LEBRUN, /HPSrFKHPHQWGXFDQ : empchePHQWGHYX


ou de profession religieuse ?, RDC 55/2, 2005, p. 325-339.
En droit canonique, mariage et vie consacre par la profession des
conseils vangliques sont deux tats mutuellement exclusifs. Selon le
canon 1088, le mariage des personnes lies pDUOHYXSXEOLF perptuel
de chastet mis GDQV XQ LQVWLWXW UHOLJLHX[ HVW LQYDOLGH &HVW FH TXH OH
droit matrimonial appelle OHPSrFKHPHQW GH YX  /KLVWRLUH PRQWUH
cepenGDQWTXDXGpSDUWOHPSrFKHPHQWGpULYDLWQRQGXYXOXL-mme,
mais de la profession religieuse. De faon plus prcise, il faudrait dire
TXHFHVWOHPDULDJHGXUHOLJLHX[SURIqVSHUSpWXHOTXLHVWLQYDOLGH

Henri HNAFF, /HVFRQVHUYDWHXUVDSRVWROLTXHVGDSUqVOHFRQFLOHGH


Vienne (1311-1312), RDC 55/2, 2005, p. 341-353.
Pour les conservateurs apostoliques, le concile de Vienne (1311-
1312) constitue une date capitale. Le pape Boniface VIII avait accord en
1301 des pouvoirs exceptionnels trois conservateurs nomms pour
dfendre les intrts de Papinien, vque de Parme. Le concile de Vienne
prend, quelques annes plus tard, des dispositions encore plus larges
SRXUOHQVHPEOHGHVFRQVHUYDWHXUV,OOHXUSHUPHWGLQWHUYHQLUpYHQWXHO-
OHPHQWHQTXDOLWpGHMXJHVHWVXUWRXWGXWLOLVHUGXQHPDQLqUHKDELWXHOOHOD
SURFpGXUH VRPPDLUH GRQW OHV UqJOHV QpWDLHQt pas encore clairement
pWDEOLHVPDLVOHVHURQWELHQW{W&HVWDLQVLTXHQDvWXQHIRUPHGHQRPLQD-
WLRQGHVFRQVHUYDWHXUVTXHORQDSSHOOHforma concilii Viennensis. Elle restera
en usage durant des dcennies pour les concessions de conservateurs.

Jeanne-Marie TUFFRY-ANDRIEU, Un aspect du pouvoir lgislatif


GH OpYrTXH : le synode diocsain, du concile de Trente au Code de
1917, RDC 55/2, 2005, p. 355-376.
LHV V\QRGHV GLRFpVDLQV RQW SULV GH OLPSRUWDQFH DX e sicle. Du
Concile de Trente au Code de 1917, les canons conciliaires et les
prcisions pontificales sont devenus les fondements, souvent discuts, de
la pratique synodale. Ils dfinissaient la nature juridique du synode
diocsain et faisaient de lui une vritable source de droit.

Aram MARDIROSSIAN, LHVSUpPLFHVGXQH distinction entre ordre et


MXULGLFWLRQ GDQV OeJOLVH DUPpQLHQQH DX e sicle : une thorie sans
lendemain, RDC 55/2, 2005, p. 377-391.
(Q2FFLGHQWFHVWGDQVODVHFRQGHPRLti du 12e VLqFOHTXDSSDUDvWOD
distinction entre ordre et juridicWLRQ/XQHGHVFDXVHVGHOpPHUJHQFHGH
cette thorie rsidait dans la volont des docteurs latins de rsoudre la
4XHUHOOHGHVLQYHVWLWXUHV&HVW mutatis mutandis pour des motifs sembla-
bles, que dans la seconde moiti du 5e sicle apparaissent au sein de
OeJOLVHDUPpQLHQQHOHVSUpPLFHVGXQHGLVWLQFWLRQHQWUHRUGUHHWMXULGLF-
tion. Les autorits ecclsiastiques souhaitaient mieux matriser le recru-
tement du clerg, TXL MXVTXDORUV OHXU pFKDSSDLW ODUJHment. Plus prci-
sment, cette thorie tait destine contrer le principe hrditaire qui
UpJLVVDLW DORUV PDMRULWDLUHPHQW ODFFHVVLRQ DX[ RUGUHV PDMHXUV 0DLV OD
UpIRUPHQDJXqUHFRQQXGHVXFFqV(OOHFRQWHVWDLWHQHIIHWGHVVWUXFWXUHV
politiques et sociales qui taient trop profondment ancres dans le pays.

Claire SENON-DUPLESSIS, /eJOLVHFDWholique et les fidles divorcs


remaris : les huit thses du cardinal Ratzinger (1re partie), RDC
55/2, 2005, p. 393-421.
En 1999, la congrgation pour la doctrine de la foi a publi un recueil
intitul La Pastorale des divorcs remaris . Dans son introduction, le
cardinal Ratzinger rsume en huit thses le contenu de la doctrine catho-
OLTXHVXUODVLWXDWLRQGHVILGqOHVGLYRUFpVUHPDULpVGDQVOeJOLVH&HVKXLW
thses abordent successivement quatre thmes : la situation ecclsiale des
fidles divorcs remaris (thses 1 et 2), la proposition de participation
DFWLYHjODYLHGHOeJOLVH WKqses 3 5), les voies de rgularisation possible
de leur situation (thses 6 et 7), et enfin la question de lDYHQLU WKqVH 
Cet article, publi en deux parties, se propose de prsenter ces thses et
GH OHV FRPPHQWHU HQ GpJDJHDQW OHV LQWHUURJDWLRQV TXHOOHV VRXOqYHQW HQ
droit, thologie et pastorale. Dans cette premire partie sont examines
les thses 1 4.

Marcel METZGER, Custom as a Model for the New Liturgical


Law, RDC 55/2, 2005, p. 251-270.
Legislative practice does not seem adapted to the question of the way
liturgical texts are received. A telling example is the reception given to
WKH (XFKDULVWLF 3UD\HU IRU 3DUWLFXODU &LUFXPVWDQFHV SURPXOJDWHG LQ
 7KH XVH RI WKH ZRUG DEURJDWHG LOOXVWUDWHV D WHQGHQF\ WR WUDQV-
pose legislative processes into the pastoral domain of liturgical prayer.
But liturgical prayers are not the same literary genre as legislative texts.
Ancient tradition considered this domain to be a matter of custom. It is
LQGHHG WKH PRGHO RI FXVWRP ZKLFK FRUUHVSRQGV EHVW WR WKH ELVKRSV
conferences current mission of regulating liturgical prayer and its expres-
sion in different languages. For in this area Christian communities rely
on local usages and their sometimes unpredictable evolution.
Edoardo DIENI, Tragedy in the Interpretation of Canon Law,
RDC 55/2, 2005, p. 271-297.
In exercising their task of interpretation, lawyers have a series of
arguments at their disposal. It would seem that interpretation is more a
question of dramatic art than of science. And yet law cannot do without
LQWHUSUHWDWLRQ 7KH SKLORVRSKHU -DFTXHV 'HUULGDV GHFRQVWUXFWLRQLVW
theory offers interesting perspectives for the interpretation of canon law.
0RUHRYHUWKHRUHWLFDOVWXGLHVEHWZHHQWKHRORJ\DQGODZIDYRXUDFUHD-
WLYHYLVLRQRILQWHUSUHWDWLRQZKHUHDOOWKRVHFRQFHUQHGZRXOGKDYHWKH
capacity to participate in determining the rules. From this point of view,
interpretation would be a dialectical and never fully completed search in
common for the best possible solution of a problem at a given moment.

Emmanuel TAWIL, The Interpretation of Canon Law by Secular


Authorities, RDC 55/2, 2005, p. 299-324.
State organs can find themselves in the situation of having to take
into account the internal law of religions. In order to understand canon
law, it is necessary to put it into its context. For secular judges, it is a
question of having a general overview which will permit them not to
distort the law of the Church. Secular authorities have interpreted canon
law in several areas (the nature and foundation of canon law, the hierar-
chical structure of the Church, marriage law and canonical procedure). If
in the nineteenth century, there were lawyers particularly competent in
the interpretation of canon law, today there seems to be greater difficulty
in understanding.

Rmy LEBRUN, The impediment of canon 1088 : an impediment due


to vow or religious profession ?, RDC 55/2, 2005, p. 325-339.
In canon law, marriage and the vows, consecrated by profession, are
two mutually exclusive states. Canon 1088 declares that the marriage of
individuals bound by the perpetual vow of chastity pronounced inside a
religious institute would be invalid. This is what matrimonial law refers
to as the impediment due to vow . However, history reveals that ini-
tially the impediment did not derive from the vow itself but from reli-
gious profession. Therefore, to be more precise, it should be said that it
is the marriage of those of perpetual profession which is invalid.

Henri HNAFF, Apostolic Curators according to the Council of


Vienne (1311-1312), RDC 55/2, 2005, p. 341-353.
The Council of Vienne (1311-1312) is a date of paramount impor-
tance for apostolic curators. Pope Boniface VIII had given exceptional
powers to three curators named in order to defend the interests of Pap-
inianus, bishop of Parma. A few years later, the Council of Vienne took
even broader measures for all curators. In some cases, they are permitted
to act as judges and, most especially, to use summary procedure habitu-
ally, the rules of which had not yet been clearly established, but which
soon would be. Thus came into being a method of naming curators
called forma concilii Viennensis. This means of attributing the post of cura-
tor remained in place for decades.

Jeanne-Marie TUFFRY-ANDRIEU, An Aspect of the Legislative


Power of the Bishop: the Diocesan Synod from the Council of Trent
to the Code of 1917, RDC 55/2, 2005, p. 355-376.
With the Gregorian reform, diocesan synods took on importance in
the 12th century. From the Council of Trent to the Code of 1917, con-
ciliar canons and papal explanations became the (often debated) founda-
tion of synod practice. They defined the juridical nature of the diocesan
synod and made it a true source of law.

Aram MARDIROSSIAN, The distinction between order and jurisdic-


tion in the 5th century Armenian church : a theory without a
future, RDC 55/2, 2005, p. 377-391.
In the west, it was only in the second half of the 12th century that
the distinction between order and jurisdiction appeared. One of the
causes of the emergence of this theory resided in the desire of Latin doc-
tors to resolve the quarrel of investitures. It was mutatis mutandis for
similar reasons, that in the 5th century Armenian church the premises of
a distinction between order and jurisdiction appeared. This distinction
revealed the wish of ecclesiastical authorities to control the recruitment
of clergymen which, up to then, had largely been out of their hands.
More precisely, this theory was intended to go against the hereditary
principle that determined at the time the taking up of orders while
allowing the ecclesiastic authorities just a slight control over the recruit-
ment of its senior members. Yet the reform was widely unsuccessful. It
brought into question those political and social structures that were too
profoundly part of the nation.

Claire SENON-DUPLESSIS, The Catholic Church and Divorced and


RePDUULHG 3HUVRQV &DUGLQDO 5DW]LQJHUV (LJKW 7KHVHV, RDC
55/2, 2005, p. 393-421.
In 1999 the Congregation for the Doctrine of the Faith published a
ERRNHQWLWOHG7KH3DVWRUDO&DUHRI'LYRUFHGDQG5HPDUULHG3HUVRQV
In his introduction, Cardinal Ratzinger sums up in eight theses the
Catholic doctrine on the situation in the Church of divorced and remar-
ried persons. These theses take up four themes in turn: the ecclesial
situation of divorced and remarried faithful (theses 1 and 2), the pro-
posal for active participation in the life of the Church (theses 3 to 5),
possible means of regularization of their situation (theses 6 and 7), and
lastly the question of the future (thesis 8). This article proposes to pre-
sent these theses and comment on them, bringing out the questions they
raise in law, theology and pastoral care. The author examines here theses
1 to 4.
Marcel METZGER, Das Gewohnheitsrecht als Vorbild fr das neue
liturgische Recht, RDC 55/2, S. 251-270.
Es scheint, dass die juristische Praxis den Fragen der liturgischen
7H[WUH]HSWLRQ QLFKW DQJHSDVVW LVW 'LH $XIQDKPH GHV HXFKDULVWLVFKHQ
+RFKJHEHWVIU*RWWHVGLHQVWHEHLEHVRQGHUHQ$QOlVVHQGDVHUODV-
sen wurde, ist ein Beispiel dafr. Die Verwendung des Ausdrucks
DXVVHU.UDIW VHW]HQ DEURJHU GUFNWGLH7HQGHQ]DXVLQ GLH3DVWRUDO
des liturgischen Gebets legislative Denkweisen zu transponieren. Jedoch
gehren die liturgischen Gebete zu einer anderen literarischen Gattung
als die legislativen Texte. Die antike Tradition hat diesen Bereich dem
Gewohnheitsrecht zugeordnet. Das Modell des Gewohnheitsrechts
eignet sich tatschlich am besten fr die heutigen Aufgaben der
Bischofskonferenzen, fr die Regelung des liturgischen Gebets und
dessen Ausdruck in den verschiedenen Sprachen. Auf diesem Gebiet
sind die christlichen Gemeinden nmlich abhngig von den lokalen
Gebruchen und deren manchmal unvorhersehbaren Entwicklungen.

Edoardo DIENI, Die Tragik der Interpretation im Kirchenrecht,


RDC 55/2, 2005, S. 271-297.
Um der Kunst der Interpretation gerecht zu werden, verfgt der
Jurist ber eine Reihe von Argumenten. Es scheint, als wre die Inter-
pretation eher eine Sache der Theaterkunst als der Wissenschaft. Den-
noch kann das Recht nicht ohne die Interpretation auskommen. Das
Konzept der Dekonstruktion des Philosophen Jacques Derrida bietet
der Interpretation im Kirchenrecht interessante Perspektiven. brigens
sprechen theoretische Studien, zwischen Theologie und Recht, fr eine
NUHDWLYH $XIIDVVXQJ GHU ,QWHUSUHWDWLRQ EHL GHU DOOH %HWURIIenen ber
das Recht verfgen wrden, an der Bestimmung der Regel mitzuwirken.
Aus dieser Sicht wre die Interpretation zu einem bestimmten Zeitpunkt
das dialektische, nie beendete gemeinsame Suchen nach der besten
Lsung eines Problems.

Emmanuel TAWIL, Die Interpretation des Kirchenrechts durch die


weltliche Obrigkeit, RDC 55/2, S. 299-324.
Es kann vorkommen, dass die staatlichen Organe , das interne Recht
der Religionen bercksichtigen mssen. Um das Kirchenrecht zu verste-
hen, muss man sich in dessen ursprnglichen Kontext versetzen. Es geht
fr die weltlichen Richter darum, einen Gesamtberblick zu bekommen,
damit sie das Kirchenrecht nicht entstellen. Die weltliche Obrigkeit hat
das Kirchenrecht in verschiedenen Gebieten interpretiert (Natur und
Grundlage des Kirchenrechts, hierarchischer Aufbau der Kirche, Ehe-
recht und kirchliches Gerichtsverfahren). Whrend im 19. Jahrhundert
besonders kompetente Juristen bei der Interpretation des Kirchenrechts
mitgewirkt haben, gibt es heute anscheinend mehr Verstndnisschwie-
rigkeiten.

Rmy LEBRUN, das Hindernis vom Canon 1088 : Gelbdehindernis


oder Professhindernis ?, RDC 55/2, 2005, S. 325-339.
Im Kirchenrecht gelten Ehe und durch Gelbde zu den Evangeli-
schen Rten geweihtes Leben als zwei sich gegenseitig ausschlieenden
Stnde. Der Canon 1088 erklrt die Ehe der Personen, die im Rahmen
eines Ordensinstituts das ewige Keuschheitsgelbde abgelegt haben, fr
ungltig. Das wird im Eherecht das *HOEGHKLQGHUQLV JHQDQQW 'LH
Geschichte zeigt jedoch, dass das Hindernis ursprnglich nicht vom
Gelbde selbst abgeleitet wurde, sondern von der Zugehrigkeit zu
einem Orden. Genauer gesagt sollte man formulieren, dass die Ehe eines
durch Ordensgelbde gebundenen Geistlichen ungltig ist.

Henri HNAFF, 'LH DSRVWROLVFKHQ .RQVHUYDWRUHQ JHPlVV GHP


Konzil von Vienne (1311-1312), RDC 55/2, S. 341-353.
Das Konzil von Vienne (1311-1312) ist fr die apostolischen Kon-
servatoren ein hochwichtiges Datum. Im Jahre 1301 hatte Papst Bonifaz
VIII. drei apostolischen Konservatoren ausserordentliche Vollmachten
zur Verteidigung der Interessen des Bischofs von Parma, Papinius, zuge-
billigt. Einige Jahre spter erlsst das Konzil von Vienne noch grosszgi-
gere Bestimmungen zugunsten der Gesamtheit aller Konservatoren. Es
erlaubt ihnen, eventuell als Richter einzugreifen und vor allem das sum-
marische Gerichtsverfahren laufend anzuwenden, dessen Regeln noch
nicht klar festgesetzt worden waren , es aber bald wurden. Auf diese
Weise entsteht eine Ernennungsform der Konservatoren, die forma concilii
Viennensis genannt wird. Sie wird fr die Ernennung der Konservatoren
jahrzehntelang in Gebrauch bleiben.

Jeanne-Marie TUFFRY-ANDRIEU, Ein Aspekt der legislativen


Macht des Bischofs: die Dizesansynode, vom Konzil von Trient bis
zum Codex von 1917, RDC 55/2, S. 355-376.
Mit der gregorianischen Reform haben die Dizesansynoden im 12.
Jahrhundert an Bedeutung gewonnen. Vom Konzil von Trient bis zum
Codex von 1917 sind die die Konzilien betreffenden Canones und die
ppstlichen Przisierungen zur oft umstrittenen Basis der synodalen
Praxis geworden. Sie definierten die juristische Natur der Dizesansy-
node und machten sie zu einer echten Rechtsquelle.
Aram MARDIROSSIAN, Die Unterscheidung zwischen Weihe und
Jurisdiktion in der armenischen Kirche im 5. Jahrhundert : eine
Theorie ohne Zukunft, RDC 55/2, 2005, S. 377-391.
Erst in der zweiten Hlfte des 12. Jahrhunderts erscheint in den
westlichen Lndern die Unterscheidung zwischen Weihe und Jurisdik-
tion. Eine der Ursachen fr die Entstehung dieser Theorie lag in dem
Willen der lateinischen Doktoren, dem Investiturstreit ein Ende zu set-
zen. Mutatis mutandis erscheinen aus hnlichen Motiven innerhalb der
armenischen Kirche in der zweiten Hlfte des 5. Jahrhunderts die
Anfnge einer Unterscheidung zwischen Priesterweihe und Jurisdiktion.
Diese Unterscheidung spiegelte den Wunsch der Kirchenbehrden
wider, die Rekrutierung des Klerus in den Griff zu bekommen, die sie bis
dahin bei weitem nicht steuern konnten. Genauer gesagt bezweckte diese
Theorie, dem berlieferten Prinzip entgegenzuwirken, das damals den
Zugang zu den hheren Weihen mehrheitlich beherrschte, indem es den
kirchlichen Behrden einen nur schwachen Einfluss ber die Auswahl
ihres leitenden Klerus zugestand. Dieser Reform war aber kaum Erfolg
beschieden. Sie stand nmlich im Gegensatz zu den politischen und
sozialen Strukturen, die in dem Land zutiefst verankert waren.

Claire SENON-DUPLESSIS, Die katholische Kirche und die wieder-


verheirateten geschiedenen Glubigen : Die acht Thesen von Kardi-
nal Ratzinger (1.Teil), RDC 55/2, S. 387-421.
Im Jahre 1999 hat die Kongregation fr die Glaubenslehre einen
6DPPHOEDQG PLW GHP 7LWHO  'LH 3DVWRUDO GHU ZLHGHUYHUKHLUDWHWHQ
*HVFKLHGHQHQYHU|IIHQWOLFKW,QVHLQHU(LQOHLWXQJIDVVW.DUGLQDO5DW]LQ-
ger in acht Thesen den Inhalt der katholischen Doktrin ber die Lage der
wiederverheirateten geschiedenen Glubigen innerhalb der Kirche
zusammen. Diese acht Thesen behandeln nacheinander vier Themen:
die kirchliche Situation der wiederverheirateten geschiedenen Glubigen
(Thesen 1 und 2), den Vorschlag zur aktiven Beteiligung am Leben der
Kirche (Thesen 3 bis 5), die mglichen Wege zu einer Regelung ihrer
Situation (Thesen 6 und 7), und schliesslich die Frage der Zukunft
(These 8). Der vorliegende Beitrag wird in zwei Teilen diese Thesen
vorstellen und kommentieren und dabei die Fragen herausarbeiten, die
sie auf den Gebieten des Rechts, der Theologie und der Pastoral aufwer-
fen. In diesem ersten Teil werden die Thesen 1 bis 4 untersucht.
Ad tuendam fidem 175-177
Afrique 447
AGAMBEN Giorgio 151-163
AIMONE P. V. 458-467
ALBERIGO G. 447
Allemagne 185-192 ; 468-469
Alsace-Moselle 193-203
ANDRS GUTIERREZ Domingo 458-461
Angleterre 452-453
AOUN Marc 193-198 ;211-214 ; 443-456
Appel comme dabus 308-310
ARULSAMY S. 446-447
BEATUS RHENANUS 95-132
Belgique 72-73 ; 451-452
BERNARDINI P. 445
BERNHARD Jean 225-240
BIRMEL A. 444
Boniface VIII 341-353
Boniface 185-192
CADOR Vincent 37-57
Canon 1088 325-340
CARTER D. 447
Code de 1917 167-168 ; 329-331
Code des canons des glises orientales 211-214
Codification 440-442
Communion hirarchique 304-308
Concile de Jrusalem 445
Concile de Latran II 326-329
Concile de Moscou 445
Concile de Vienne 341-353
Conciles africains 447
Conciliation 59-93
Conseil pontifical pour la famille 209-211
Conservateurs apostoliques 341-353
Coutume 249-268
Cur 310-312 ; 319-323
DANEELS Frans 208-209
DE MEY P. 447
Dcret de Gratien 95-132
DELSOL Xavier 454-456
DERRIDA Jacques 271-298
DESTIVELLE Hyacinthe 438 ; 445
DIENI Edoardo 241-247; 271-297
Diocse 355-376
Divorcs remaris 393-421
DOLE Georges 440-442
Donum Veritatis 173-175
Droit franais des religions 193-203 ; 299-324 ; 448-456
Droit international priv franais 7-57
Droit local 59-93
Droit missionnaire 462-467
Droit oriental 211-214
Droit pnal 206-209
Droit romain 456-458
Droits subjectifs 206-209
DRYE Bernard 235-240
Due Process 73-80
DUGAN Patricia M. 206-209
glise armnienne 377-391
glises orientales 435-440
Empchement de vu 325-340
tats-Unis 73-80
thique 151-163 ; 209-211
Eucharistie 204-205 ; 408-421
vque 355-376 ; 380-387
FAGGIOLI M. 446 ; 467-469
Famille 209-211
FANTAPPI C. 468-469
FATTORI M.T. 445
Femmes 431-440
FERRARI Silvio 7-35
FILORAMO Giovanni 468
FLANAGAN B. 444
FLAUSS-DIEM Jacqueline 448-454
FOUCAULT Michel 151-163
France 193-203 ; 299-324 ; 423-430
FRATEANTONIO Crista 456-458
GARAY Alain 454-456
Genve 133-149
GLATTHAAR Michael 185-192
GRASSET Ren 200-203
GROTAERS J. 446
HAENNI Dominique 133-149
HNAFF Henri 341-353
HEYER Ren 200-203 ; 431-434
HIEBEL Jean-Luc 456-458
Histoire 5e sicle 377-391
Histoire 12ee sicle 325-340
Histoire 13e sicle 341-354
Histoire 16 -20e sicles 355-376
Histoire Antiquit 434-435
Histoire du droit canonique 95-132
Histoire Rvolution franaise 440-442
Inde 446-447
INDELICATO A. 446
Infaillibilit 166-167
Instituts sculiers 205-206
Interprtation 271-324
Islam 7-35
Italie 423-430 ; 452
JEMOLO Arturo-Carlo 5
JENSEN Anne 434-435
Judasme 7-35
Juridiction 377-391
KONDRATUK Laurent 241-247
LALOUETTE Jacqueline 200
LANGERON Pierre 205-206
LEBRUN Rmy 325-340
LONARD B.J. 447
Libert religieuse 199
Liturgie 203-205 ; 251-270
LO CASTRO Gaetano 207
Loi de 1905 193-203 ; 309-310
Magistre 165-183
MARDIROSSIAN Aram 377-391
Mariage civil et canonique 312-318
Mariage interreligieux 7-57
Mariage juif 7-35
Mariage musulman 7-35
Mariage : dissolution et nullit 25-35
mariage : droit missionnaire 464-467
Mariage : empchement de vu 325-340
Mariage : forme extraordinaire 312-318
Mariage : indissolubilit 315-318 ; 395-396
Mariage : sociologie 423-430
MARTENS Kurt 59-93
MELLONI Alberto 443-448 ; 467-469
MENTZER R. A. 445
MESSNER Francis 193-198
METZGER Marcel 203-206 ; 251-270 ; 434-440
MINAUD Philippe 249-250
MORLOT Franois 249-250
MUNIER Charles 95-132 ;185-192
NDONGALA I. 447
cumnisme 443-448
Officialits 319-324
ONORIO (d) Jol-Benot 440-442
Ordinatio sacerdotalis 177-179
Ordre 377-391
RSY L. 444
PARMENTIER E. 448
Patriarcat 380-387
Pays-Bas 70-72
PENNINGTON Kenneth 207-208
POCQUET du HAUT-JUSS Laurent-Marie 165-183
PODMORE C. 445
Portalis 440-442
Pouvoir dordre et de juridiction 377-391
PRLOT Pierre-Henri 193-198
Procdure administrative 59-93
Procdure 319-324
Procs pnal 206-209
Profession de foi 173-175
Profession religieuse 325-340
Protestantisme 133-149
PULTE Matthias 462-467
Puret 438-440
PUZA Richard 448 ; 468-469
RATZINGER Joseph 393-421
Recours pour abus 308-310
ROUTHIER Gilles 444 ; 446
Sacrilge 185-192
SCATENA Silvia 443-448
SCHULZ G. 445
Science des religions 467-469
Secret 448-454
SENON-DUPLESSIS Claire 393-421
SERRANO BLANCO L. 447
SMYTH Matthieu 204-205
Souverainet 151-163
STUBENRAUCH Thomas 203-204
SUBLON Roland 151-163 ; 431-434
Sude 423-430
Suisse 133-149
SYNEK Eva 435-440
Synodalit 443-448
Synode diocsain 355-376
TAWIL Emmanuel 299-324 ; 454-456
TAYLOR J. 445
TILLARD J.M.R. 444
Tribunaux administratifs 59-93
TUFFRY-ANDRIEU Jeanne-Marie 355-376
Vatican 303
Vatican I 166-167
Vatican II 168-172 ;181-183 ; 203-204
Vie consacre 325-340 ; 458-461
VISCHER L. 447
Vu 325-340
WERCKMEISTER Jean 199-200 ; 206-211 ;
225-234 ; 423-429 ; 467-469
WIJLENS M. 444
WOEHRLING Jean-Marie 193-198
ditorial .......................................................................................................................... 5

Jean WERCKMEISTER, In memoriam Jean Bernhard .................. 225


Laurent KONDRATUK, La lgret, le jazz et le droit
canonique : Hommage Edoardo Dieni ................................. 241
Philippe MINAUD, Franois Morlot, un canoniste
nous a quitts 249

Marcel METZGER, La coutume comme modle pour le


nouveau droit liturgique .................................................................... 251
Edoardo DIENI, Le tragique de linterprtation
dans le droit canonique ..................................................................... 271
Emmanuel TAWIL, Linterprtation du droit canonique
par les autorits sculires ............................................................... 299

Charles MUNIER, Les annotations de Beatus Rhenanus


son exemplaire du Dcret de Gratien ....................................... 95
Dominique HAENI, Les protestants de Genve et la
question des vchs ............................................................................. 133
Charles MUNIER, Note de lecture : Boniface et
lvanglisation de la Germanie .................................................. 185
Rmy LEBRUN, Lempchement du canon 1088 .......................... 325
Henri HNAFF, Les conservateurs apostoliques
daprs le concile de Vienne ........................................................... 341
Jeanne-Marie Tuffry-Andrieu, Un aspect du pouvoir
lgislatif de lvque : le synode diocsain du concile
de Trente au code de 1917 ............................................................ 355
Aram MARDIROSSIAN, Les prmices dune distinction
entre ordre et juridiction dans lglise armnienne
au 5e sicle : une thorie sans lendemain ................................ 377

Silvio FERRARI, Le mariage des autres. Le mariage entre


personnes relevant des systmes hbraque, islamique
et canonique ................................................................................................... 7
Vincent CADOR, Les mariages interreligieux et le droit
international priv franais ................................................................. 37
Claire SENON-DUPLESSIS, Lglise catholique et les fidles
divorcs remaris : les huit thses du cardinal
Ratzinger ..................................................................................................... 393
Jean WERCKMEISTER, La grande diversit des
comportements matrimoniaux en Europe ............................... 423

Kurt MARTENS, Les procdures administratives dans


lglise catholique .................................................................................... 59
Roland SUBLON, Biopolitique et souverainet face
la question de lthique ...................................................................... 151
Laurent-Marie POCQUET du HAUT-JUSS, Quelques
rflexions propos du magistre ................................................... 165

Michael GLATTHAAR, Bonifatius und das Sakrileg. Zur


politischen Dimension eines Rechtsbegriffs (C. Munier) ....... 185
Francis MESSNER, Pierre-Henri PRLOT, Jean-Marie
WOEHRLING (d.), Trait de droit franais des
religions (M. Aoun) .............................................................................. 193
Libert religieuse et rgimes des cultes en droit franais.
Textes, pratique administrative, jurisprudence
(J. Werckmeister) .............................................................................. 199
Jacqueline LALOUETTE, Ltat et les cultes. 1789-1905-
2005 (J. Werckmeister) ................................................................... 200
Ren GRASSET, Le Partage du laque et du religieux.
tudes sur la communication des valeurs (R. Heyer) .......... 200
Thomas STUBENRAUCH, Wer ist Trger der Liturgie ? Zur
Rezeption des II. Vatikanischen Konzils im Codex
Iuris Canonici von 1983 (M. Metzger) ...................................... 203
Matthieu SMYTH, La Liturgie oublie. La prire eucharistique
en Gaule antique et dans lOccident non romain
(M. Metzger) ........................................................................................... 204
Pierre LANGERON, Les Instituts sculiers. Une vocation pour
le nouveau millnaire (M. Metzger) .............................................. 205
Patricia M. DUGAN (ed.), The Penal Process and the
Protection of Rights in Canon Law (J. Werckmeister) ...... 206
Conseil pontifical pour la famille, Lexique des termes
ambigus et controverss sur la famille, la vie et
les questions thiques (J. Werckmeister) ................................... 209
Congregazione per le Chiese orientali, Ius Ecclesiarum,
Vehiculum Caritatis (M. Aoun) ................................................... 211
Ren HEYER, La Condition sexue (R. Sublon) ................................ 431
Anne JENSEN, Femmes des premiers sicles chrtiens
(M. Metzger) ........................................................................................... 434
Kanon XVII (2005), Frauenrollen & Frauenrechte in der
Europischen Orthodoxie (M. Metzger) .................................... 435
Eva M. SYNEK, Wer aber nicht vllig rein ist an Seele
und Leib . Reinheitstabus im Orthodoxen
Kirchenrecht (Marcel Metzger) ...................................................... 438
Jol-Benot dONORIO, Portalis. LEsprit des sicles (G. Dole) . 440
Alberto MELLONI, Silvia SCATENA (dir.), Synod and
Synodality : Theology, History, Canon Law and
Ecumenism in new contact (M. Aoun) ...................................... 443
Jacqueline FLAUSS-DIEM (dir.), Secret, Religion, Normes
tatiques (M. Aoun) ............................................................................... 448
Xavier DELSOL, Alain GARAY, Emmanuel TAWIL, Droit
des Cultes. Personnes, activits, biens et structures
(M. Aoun) ................................................................................................. 454
Christa FRATEANTONIO, Religise Autonomie der Stadt
im Imperium Romanum. ffentliche Religionen im
Kontext rmischer Rechts - und Verwaltungspraxis
(J.-L. Hiebel) ............................................................................................ 456
Domingo ANDRS GUTTIREZ, Le forme di vita consacrata.
Commentario teologico-giuridico al codice di diritto
canonico (Pier V. Aimone) .............................................................. 458
Matthias PULTE, Das Missionsrecht ein Vorreiter des
universalen Kirchenrechts (Pier V. Aimone) .......................... 462
Massimo FAGGIOLI & Alberto MELLONI (d.), Religious
Studies in the 20th Century. A Survey on Disciplines,
Cultures and Questions (J. Werckmeister) ............................. 467

*
Rsums, Summaries, Summarien .............................................................. 215
Rsums, Summaries, Summarien .............................................................. 471
Index du tome 55 .............................................................................................. 479