Académique Documents
Professionnel Documents
Culture Documents
(54) METHOD FOR THE REGULATION OF (30) Foreign Application Priority Data
PROTEIN BIOSYNTHESIS
Jun. 4, 1992 (FR) .......................................... .. 92-06765
(76) Inventor: JOEL STERNHEIMER, RESIDENCE
(XP) Publication Classi?cation
Correspondence Address: (51) Int. Cl.7 ........................ .. C12P 21/06; A01N 37/18;
ALSTON & BIRD LLP A01N 43/04
BANK OF AMERICA PLAZA (52) US. Cl. .............................. .. 435/691; 514/2; 514/44
101 SOUTH TRYON STREET, SUITE 4000
CHARLOTTE, NC 28280-4000 (US) (57) ABSTRACT
There is provided a method for determining the musical
(*) Notice: This is a publication of a continued pros
notes associated With an amino acid sequence, the musical
ecution application (CPA) ?led under 37
periods of the sequence, the lengths of the notes, and the
CFR 1.53(d). tone quality of the notes through the retroaction of the Whole
set of amino acids and using that information to regulate the
(21) Appl. No.: 09/320,637
biosynthesis of the protein. The amino acids that build a
(22) Filed: May 26, 1999 protein emit a signal of quantum nature at a certain fre
quency. Following the properties of this signal, the fre
Related US. Application Data quency is transposed into a musical note. This discovery has
numerous applications since one can then deduce from the
(63) Continuation-in-part of application No. 08/347,353, amino acid sequence of a protein a sequence of notes
?led on Dec. 1, 1994, noW abandoned, ?led as 371 of composing the melody that Will act to stimulate or inhibit its
international application No. PCT/FR92/00524, ?led synthesis inside an organism, Wherefrom one can in addition
on Jun. 2, 1993. delimit its biological functions.
Patent Application Publication Nov. 28, 2002 Sheet 1 0f 3 US 2002/0177186 A1
Cytochrome oxidase
L95 Prmei" of hum Beginning of mltochondrial
respiratory chain subunit 3
MTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWW
RDVTRESTYQGHHTPPVQKG
GDVEKGKKIFIMKCSQCHTVEKGG
KHKTGPNL HGLFGRKTGQAPGYSYTAANKNKG
IIWGEDTLMEYLENPKKYIPGTKM
IFVGIKKKEERADLIAYLKKATNE
Figure 1
Patent Application Publication Nov. 28, 2002 Sheet 2 0f 3 US 2002/0177186 A1
C)
Q @g Symbolsused
O
OG@O 0$9O9$Q
O @413
O GFISF'LQHFRW
$ VII: Y
O
W TNE
CDM
Human cytochrome C
Amino end region
Elam
Historic IV Complete sequence
Protein 0| human chromatin
ah
SGRGKGG KGLGKGGAKRHRKVLRDNIQG
ITKPAIRRLARRGG VKRISGLIYEE'IRG
VLKVFLENVIRDAV 'IYTEHAK
RKTVTAMDVVYALKRQGRTLY____GFGG
Chalcone synthase
I'igrncntatIon cnzymc IN INHIBITION
of Petunia hybrldn [lowers IIcgInnIng
Patent Application Publication Nov. 28, 2002 Sheet 3 0f 3 US 2002/0177186 A1
M T E R R V P F S L L R G P S W
M A K A A A V G I D L G T T Y S
VKELGTVMRMLGQTPTKEELDAII BEVDEDGS
GTIDFEEFLVMMVRQMKEDAKGKS EEELAECF
ESLMKDGDKNNDGRIDFDEFLKMM EGVQ
Figu re 4
US 2002/0177186 A1 Nov. 28, 2002
METHOD FOR THE REGULATION OF PROTEIN a full order of magnitude. The scaling Wave Which then
BIOSYNTHESIS emits interferes, at the scale of the protein in formation, With
similar Waves previously emitted by the other amino acids.
CROSS-REFERENCE TO RELATED This interference draWs constraints of a musical type for the
APPLICATION temporal succession of the proper frequencies associated to
these Waves, so that the scaling Waves continue their itin
[0001] This application is a continuation-in-part of US. erary and insure coherence and communication betWeen
patent application, Ser. No. 08/347,353 ?led Dec. 1, 1994. different levels of the organism. For example, the succession
of these Waves minimiZes the dissonance (harmonic dis
BACKGROUND OF THE INVENTION tance) and the frequency gaps (represented by melodic
distance) betWeen successive amino acids. Additional prop
[0002] The present invention is directed to a method of erties imply the existence of periods of minimiZation of
regulating protein biosynthesis. More particularly, the harmonic distances shoWing punctuations in the temporal
invention is directed to a method for epigenetic regulation of succession of frequencies Which other levels Will complete
in situ protein biosynthesis and its use in agronomy and With correlations all the more rich and marked that they
health. themselves are more numerous to in?uence the protein
[0003] Demonstration of the musical properties of synthesis. The result is the prediction that proteins possess,
elementary particles suggests an important role for the scale in the very succession of the proper quantum frequencies
at Which the phenomena happen. (J. Sternheimer, C. R. associated to the sequence of their amino acids, musical
Acad. Sc. Paris 297, 829, 1983). For example, it is knoWn properties all the more clear and elaborate that their biosyn
that the physical existence of quantum Waves associated to thesis is more sensitive to epigenetic factors in general.
particles propagate themselves not only in space-time, but Conversely, it must be possible to act epigenetically, in a
also in that scale dimension, thus linking together successive speci?c Way for each protein onto that biosynthesis.
levels of the organiZation of matter. (J. Sternheimer, Col [0007] The observation of protein sequences con?rms that
loque International Louis de Broglie, Physician et all proteins possess musical properties in the sequence of
Penseur, Ancienne Ecole Polytechnique, Paris, Nov. 5-6, their amino acids and these properties are all the more
1987). These Waves alloW an action of one scale onto the developed that those proteins are, in a general Way, more
other, betWeen phenomena that are similar enough to con epigenetically sensitive. (Data from M. O. Dayhoff, Atlas of
stitute, in a mathematically Well-de?ned sense, harmonics of protein sequence and structure, volume 5 and supplements,
a common fundamental tone. (See J. Sternheimer, Ondes
N.B.R.F. (Washington) 1972-78). In addition, the acoustic
dechelle [scaling Waves], I. Partie Physique; II. Partie transposition of the series of proper frequencies correspond
Biologique. Filed at Academie des Sciences (Paris) 1992 ing to the production of scaling Waves in phase With the
under seal no. 17064). elongation of a given protein,.shoWs a stimulating action
[0004] The theoretical reasons for the existence of scaling onto the biosynthesis of this protein in vivo, and in a
Waves makes them appear as a universal phenomenon Whose correlative Way it has an inhibiting action for scaling Waves
function is at ?rst to ensure coherence betWeen the different in phase opposition.
scales of a quantum system, and that especially takes shape [0008] In the case of animals having a nervous system the
and can be described in the process of protein biosynthesis. sound Wave is transformed into electromagnetic impulses of
The peptidic chain elongation effectively results from the the same shape and frequency right from the starting point
sequential addition of amino acids that have been brought of the auditory nerve. These impulses, by virtue of the scale
onto the ribosome by speci?c transfer RNAs (tRNAs). When invariance of scaling Wave equations applied to the photon
an amino acid, initially in a free state, comes to af?x itself
(Which generaliZe MaxWells equations), have a direct
to its tRNA, it is stabiliZed With respect to thermal agitation
action, by scale resonance, on their quantum transpositions.
While keeping a relative autonomy because it is linked to
Because the squared quantum amplitudes are proportional to
the tRNA by only one degree of freedomfor its de Broglie the number of proteins that are simultaneously synthesiZed,
Wavelength to reach the order of magnitude of its siZe. This
the resonance phenomenon results, in the case of scaling
stabiliZation gives the amino acid Wave properties. Waves in phase, in an increase of the rate of synthesis, as
[0005] Interference betWeen the scaling Wave associated Well as a regulation of its rhythm, and in the case of scaling
to the amino acid and those similarly produced by the other Waves in phase opposition, in a reduction of this rate. (cf. P.
amino acids, results in a synchroniZation, after a very short Buser and M. Imbert, Audition, Hermann editeur, Paris,
period of time (Which can be evaluated to be about 10_12'5 1987). Among plants, the sensitivity to sounds is visible
second), of the proper frequencies associated With these through interferometry and the scaling Waves behave theo
amino acids according to one and same musical scale, Which retically in a similar Way.
more precisely depends upon the transfer RNA population.
[0009] The solution to the scaling Wave equation, Which
HoWever, to Within the approximation of the chromatic
effectively shoWs the existence of scaling Waves having a
tempered scale, this scale appears universal due to the very
peculiar distribution of amino acid masses Which is already
range close to Avogadro number, anticipates similar prop
erties for the scaling Waves draWn from the spatial distri
very close to it.
bution of amino acids (Whose de Broglie Wavelength is then
[0006] The scaling Wave phenomenon appears in a more comparable to their siZe) inside the protein after it has been
explicit Way When the amino acid carried by its tRNA ?xes synthesiZed. The solution then provides a range approximat
itself onto the ribosome. It is at this moment that the ing the square root of that number. The observation of their
stabiliZation With respect to thermal agitation becomes such tertiary structures con?rms the existence of harmonies
that the Wavelength of the amino acid outgroWs its siZe by Within vibratory frequencies of amino acids spatially nearby
US 2002/0177186 A1 Nov. 28, 2002
inside proteins (and especially at their surface, as can be [0017] FIG. 1 shoWs the musical scale cytochrome oXi
expected from their Wavelength). An appreciable stabiliZa daZe and cytochrome C;
tion of the effects obtained With the use of the musical
transpositions is then observed using colored transpositions [0018] FIG. 2 shoWs the cytochrome C humain region for
amino-terminal and legends;
of these spatially distributed frequencies.
[0019] FIG. 3 shoWs Hystone IV and chalconesynthase;
[0010] The present invention is draWn from these obser
and
vations.
[0020] FIG. 4 shoWs heat shock HSP 27 Ethsp 70 and
SUMMARY OF THE INVENTION Troponinec.
[0011] The method of the invention comprises determin
ing the musical notes associated With an amino acid DETAILED DESCRIPTION OF THE
sequence, the musical periods of the sequence, the lengths of INVENTION
the notes, and the tone quality of the notes through the [0021] The present invention Will noW be described more
retroaction of the amino acids and using that information to fully hereinafter With reference to the accompanying draW
regulate the biosynthesis of the protein. ings, in Which preferred embodiments of the invention are
[0012] Stated in another Way, the amino acids Which build shoWn. This invention may, hoWever, be embodied in many
a protein emit a signal of quantum nature at a certain different forms and should not be construed as limited to the
frequency. FolloWing the properties of this signal the fre embodiments set forth herein; rather, these embodiments are
quency is transposed into a musical note in such Way that provided so that this disclosure Will be thorough and com
playing back the melody of a protein Will stimulate or inhibit plete, and Will convey the scope of the invention to those
its synthesis. This discovery has numerous applications skilled in the art.
since deduction of the amino acid sequence of a protein [0022] There is provided a method of regulating protein
provides a sequence of notes composing the melody Which synthesis in situ, using a musical sequence corresponding to
Will act on its synthesis inside an organism. Thus, by the amino acid sequence of a protein through the decoding
diffusing to a plant the music of a protein Which plays an and transposition into sound of a temporal series of quantum
important role in ?oWering, more ?oWers are produced. vibrations associated With the elongation of the amino acid
[0013] Stated more scienti?cally, the method of this inven chain of the protein. The method of regulating protein
tion uses the regulating action on the biosynthesis of pro synthesis in situ requires at least the folloWing steps: the
teins by scale resonance of transpositions into sound of sequence of musical notes is determined; the period appear
temporal sequences of quantum vibrations associated With ing in the molecule is determined; the period is recti?ed, if
their elongation. This action may be an increase of the rate necessary; the rhythmic style is checked through the distri
of synthesis or a reduction of this rate, depending upon bution of the bases of DNA; and the tone quality is deter
Whether the modulation of the vibration frequencies used is mined.
in phase With, or in phase opposition to the elongation. This [0023] Determining The Sequence Of Musical Notes. The
is true for the quantum vibrations as Well as for their sequent of music notes associated With the amino acid chain
transposition into sound. The result is further stabiliZed by of a protein is determined by associating a musical note With
the actions, again through scale resonance, of colored light each amino acid. More speci?cally, Within the approxima
transpositions of grouped quantum vibrations arising from tion of the tempered scale a universal code for the stimula
the spatial conformation of proteins issued from this elon tion of protein synthesis is obtained. That code is:
gation.
[0014] This method applies in a speci?c Way to every
[0024] Gly=loW A; Ala=C; Ser=E; Pro Val, Thr, Cys=
protein of knoWn structure. Its use is all the more appropriate F; Leu, Ile, Asn, Asp=G; Gln, Lys, Glu, Met=A;
His=B ?at; Phe, as Well as SeC=B; Arg, Tyr=sharp C;
When the synthesis of this protein is even more dependent
Trp=sharp D
upon epigenetic factors, that is to say eXternal to the DNA
of the system to Which it belongs, and especially in the [0025] Which are deduced from the notes of the code by
present case, upon acoustic and electromagnetic factors. In taking the notes of the chromatic tempered scale Which are
addition, the method uses the determination of metabolic symmetrical to those of said keynotes With respect to central
agonisms and antagonisms of these proteins due to scale G.
resonance phenomena naturally associated With their bio
synthesis. The characteriZation of these proteins in their [0026] There is another code for inhibition, Which is
associated metabolic subsets is another feature of the present deduced from the preceding code by symmetriZation of the
invention. logarithms of the frequencies around their central value:
[0015] The identi?cation of proteins designed to be regu [0027] Trp=C; Arg, Tyr=D; Phe, SeC=E ?at; His=E;
lated as part of a given application includes other criteria a Gln Lys, Glu Met=F; Leu, Ile, Asn, Asp=G; Pro, Val,
correspondence betWeen acoustic and electromagnetic phe Thr, Cys=A; Ser=B ?at; Ala=sharp D; Gly=sharp F
nomena or Which effects can be observed on living beings
[0028] that are deduced from the notes of the code by
and the transposed proteic sequences. taking the notes of the chromatic tempered scale Which are
BRIEF DESCRIPTION OF THE INVENTION symmetrical to those of said keynotes With respect to central
G.
[0016] Certain features and advantages Will be evidence
from the draWings When considered in conjunction With the [0029] The application of the universal code results in
accompanying draWing in Which: scaling Waves respectively in phase With and in phase
US 2002/0177186 A1 Nov. 28, 2002
opposition to those taking place during the synthesis pro Which minimiZes the average on the protein of step by step
cess. The term universal code means that this code is melodic distances variations, to Within an integer number of
identical for all proteins to Within the approximation of the intervals apart. The repetition of the melodic contours are
tempered scale; the loW A, for a central frequency located 76 processed by a calculation of autocorrelations of pairs, or
octaves beloW the centre of gravity of the initial frequencies even better, of triplets of signatures.
of leucine, isoleucine, and asparagine, is at 220 HZ. The
expression of harmonic distance given above extends the [0035] A third method of determining the period of the
de?nition suggested by Y. Hellegouarch in C. R. Math. Rep. musical notes is by the logic of the harmonic movement that
reproduces the notes or the melodic movement to the nearest
Acad. Sci. Canada, Volume 4, Page 227, 1982. The exact
values of the frequencies depend on the proportions of the simple harmonic transposition. The period is then given by
groups of the above-mentioned amino acids among the the number that minimiZes the average on the protein of
transfer RNA population surrounding the protein biosynthe harmonic distances betWeen notes located an integer number
s1s.
of intervals apart.
[0030] Determination of Frequency. The next step is to [0036] Sometimes When an alignment of similar
derive the frequency of each of the notes. The folloWing sequences is present, the period appears in the additions or
code is derived in the folloWing manner, Which also option in the deletions of certain of the sequences. The result gives
ally enables to give a more precise frequency value to each a melodically and harmonically coherent progression. To do
note. The frequency of the musical notes is calculated from that, account is taken of the fact that the last notes of each
the frequencies of amino acids in their free state (propor period or member of phraseusually the second half, and
tional to their masses) by minimiZing the global harmonic more particularly the last noteas Well as those situated on
distance Zij Pi PJ- logsup (pi, calculated for all possible the strong beat are the most important for this progression.
pairs of notes, (pi/qj) being the harmonic intervals globally The ?nal result is the most signi?cant respecting the Whole
the closest to the corresponding proper frequency ratios. of these criteria. These different elements are balanced
Their respective proportions Pi, P]- in the environing popu according to their relative importance in the protein, and
lation of transfer RNAs are taken into account. While especially the harmonic and melodic distance by the square
respecting the condition 6f<Af/2 where of is the displace of the ratio of their normaliZed standard deviations. There is
ment of the initial frequency toWards its synchroniZed value usually one that is distinctly more signi?cant than the others.
and Af is the interval betWeen the tWo successive synchro [0037] Cases similar to allosteria nevertheless exist, and
niZed frequencies of the obtained scale, Which encompass have a biological meaning (stimulation or inhibition by such
this initial frequency. The resulting frequency is then trans molecule or such other one during the metabolism), but
posed into the ?eld of audible frequencies. See, method in?uence more frequently the position of the measure bars
described in the French patent number 8302122. than the period. It is noted that metabolic function is
[0031] Determination Of The Musical Period. Once the different according to the context, for instance, CG rich or
frequency of each musical note is determined, the musical AT rich; the measure bars depending upon the composition
period is determined by identifying similar series of musical of the DNA, as the Christmas trees that can be seen during
notes. The existence of musical periods results directly from certain syntheses clearly displayed (cf. B. Alberts and al.,
that of scaling Waves. Molecular biology of the cell, 2nd edition, Garland Publ. Co.
1989, page 539).
[0032] An indication is given by the presence of obvious
cadences producing punctuations in the musical develop [0038] Determining The Lengths Of Musical Notes. If
ment. Obvious cadences include such cadences as GG, F-S. necessary, the period is recti?ed so that the melodic passages
That is to say, F closely folloWed by S, as Well as the cadence that repeat or folloW one another can be found in the same
ending the signal peptide When it is present, for stimulation; place inside the measure. From this recti?cation the indi
series of R or Y, for inhibition; exceptionally, relative pauses vidual lengths of the musical notes are deduced. This
induced by harmonic variations Which Would otherWise be operation of adjusting the phrasing to the measure is com
too straight; and in all cases, cadences expressing the return parable to the Well knoWn phenomenon of lengthening the
to the tonic note. voWels of a sung text.
[0033] The similar passages are then determined. One [0039] In practice, the operations described above can be
method of determination is by the direct repetition of notes. performed most easily With a keyboard, such as a CasioTM
When this method is used the period is given by a simple equipped With a one key play device, or With a computer
calculation of autocorrelations of notes. More speci?cally, programmed especially for that purpose With stored
by minimiZing the frequency differences betWeen notes by sequence of musical notes and Where the sequence of notes
the number that minimiZes the average on the protein of can be played. HoWever, some precautions are required.
melodic distances betWeen notes located an integer number Prudence implies, among other things, to decode the same
of intervals apart. molecule or a musically similar molecule, in the direction of
inhibition (or in any case in the direction opposite from the
[0034] A second method is to determine the melodic initial one), taking into account the fact that molecules very
movements of the musical notes. The period is calculated by often have a preferential decoding direction. It is often the
autocorrelations of signaturesor frequency variation case that pairs of molecules that sensibly exert the same
signsfrom one note to the next. More speci?cally, the function ?nd one pair being more musical in inhibition and
period is determined by calculating autocorrelations of the the other one in stimulation.
melodic distances from one note to the other, the distances
being counted With their sign, i.e., multiplied by the corre [0040] Checking Rhythmic Style Through The Distribu
sponding signatures; or even more ?nely, by the number tion Of The Bases of DNA. When the molecule is musical
US 2002/0177186 A1 Nov. 28, 2002
enough, the period of autocorrelations corresponds to that of deduced as in section 1 by symmetriZation of the logarithms
the protein. The autocorrelations determine in principle the of frequencies With respect to the central lemon yelloW):
measure bars, the ranks of base tripletsor more precisely
of bases in third position in these tripletsfor Which the [0045] Gly=dark red: Ala=bright red: Ser=orange;
peaks of autocorrelation are the highest, corresponding to Pro, Val. Thr, Cys=ochre; Leu, Ile, Asn, Asp=lemon
the most accentuated notes. By referring to codon sage, in yelloW; Gln, Glu, Lys, Met=green; His=emerald:
comparison With knoWn molecules (already decoded, or Phe=blue; Arg, Tyr=indigo; Trp=purple,
more regular and thus raising less dif?culties) having the [0046] these frequencies then being moved toWards red or
same supposed rhythmic style; the style of musical rhythm purple according to the global repartition of the molecule
(Which by constraining the accentuation of notes, in?uences frequencies in a Way similar to the description for tone
the choice of bases in third position) determining the codon quality as above. The spatial position of colors is the same
usage. Molecules of the same style must therefore have the as those of the amino acids in the tridimensional spatial
same codon usage. If necessary, the decoding of some representation of the molecules.
passages is corrected.
[0047] Several eXamples are set forth beloW to illustrate
[0041] Determining The Tone Quality. Tone quality is, in the invention and the manner in Which it is carried out. In
principle, different for every molecule and for every distri these examples as Well as in the ?gures, the one-letter
bution of musical notes. In theory, tone quality mainly notation for amino acids: Gly=G; Ala=A; Ser=S; Pro, Val,
depends upon the molecule itself but it also depends upon all Thr, Cys=P, V, T, C respectively; Leu, Ile, Asn, Asp=L, I, N,
the levels of the organism Which retroact on the harmonic D; Gln, Glu, Lys, Met=Q, E, K, M; His=H; Phe=F; Arg,
structure of amino acid vibrations. The tone quality of the Tyr=R, Y; Trp=W is used.
musical sequence is determined by comparing the repartition
of the music sequence of the amino acid chain to the average EXAMPLE 1
repartition of those notes of the Whole of the protein to
[0048] This eXample illustrates decoding a protein that is
determine Which harmonics must be raised or loWered. The
regular from beginning to end. Cytochrome C provides a
term tone quality or timbre is characteriZed by the har
monic structure of a note and more precisely by the variation
constant deletion of eight amino acids (sometimes seven)
among animal proteins When compared to plants. Observing
of harmonic structure over a given note.
the autocorrelations of musical notes and melodic contours
[0042] A ?rst approach is given by adjusting the distribu con?rmed the value of the musical period.
tion of molecule notes to the theoretical graph of that [0049] The occurrences of the same note Was counted and
distribution. The distribution is deduced from the scaling the same direction of pitch variation occurred three times in
Wave equation. The distribution also corresponds to What a roW (the same triplet of signatures), Which Was distant
can be observed in average, on the Whole of proteins. This from an integer number k of musical notes. The folloWing
adjustment to the tone quality requires determination of result Was obtained:
Which harmonics are ampli?ed and Which are softened in the
Wanted tone. See, French Patent No. 8302122. The closest [0050] Valuesofk123456789101112
tone quality is then selected in a palette of given ones. For
[0051] Note autocorrelations 19 15 15 20 19 15 17 21
eXample, a voice memory or as one can already ?nd
14 17 18 13
included in many eXpanders and musical softWares. To
distinguish more precisely betWeen three situations: (1) [0052] Melodic contour autocorr. 1 7 4 6 5 10 8 13 5 4
distribution of notes constant along the molecule to provide 44
a relatively ?Xed harmonic structure; (2) straight distribution
changes to provide different successive tones of instrument, [0053] Total 20 22 19 26 24 25 25 34 9 21 22 17
for instance cytochrome C With several organ registers; and [0054] the peak at k=8 being Worth about 2.5 standard
(3) progressive distribution change Which then reproduces deviations (as compared to its expectation value 22314.7
the time evolution of the harmonic structure of one note, for determined from the repartition of notes of the molecule).
eXample, myosin, Where this evolution indicates a timbre of The signi?cance of this peak Was reinforced When using
trumpet. melodic distances.
[0043] Apart from this, determining the tempo gives no [0055] The peak outgreW distinctly 3 standard deviations
real problem to the technician because it normally folloWs When the autocorrelations of melodic intervals Were
from the rhythmic style. It is generally all the faster that included by taking as a de?nition of the melodic distance
there are important redundancies in the proteic sequence, as betWeen tWo notes, the absolute value of the difference of
it is the case for ?brous proteins. the ordinal ranks of their tempered frequencies arranged in
ascending order. This de?nition is derived from the usual
[0044] Determining The Colors. Optionally, the colors are
nomenclature: second, third, etc., for the notes of a musical
determined by applying the universal code. The color is
mode. The secondary peak at k=7 then became slightly
deduced from vibration frequencies of individual amino
signi?cant, corresponding to the relative stretching of the
acids through the formula (draWn from scaling Wave
seventh note Which tended to precede the return to the tonic;
theory): v~v0 Argch (e (f/fo) Logch 1), Where (f, f0 Whereas, the one at k=4 Was reinforced When harmonic
represent the proper quantum frequencies associated With distances Were used to spatial foldings of the molecule.
aminoacids as previously, and v, v0 those of colors, the indeX
0 shoWing central values. This gives the folloWing code [0056] The observation of the cadences also con?rmed
relating to the stabiliZation of proteins synthesiZed in situ this value, as Well as that of the internal similarities. The last
(the code related to the stabiliZation of their inhibition is ?ve notes of the ?rst, second and third group of eight
US 2002/0177186 A1 Nov. 28, 2002
produced together an exact harmonic superposition. In other translated not into the musical period but in the spatial
Words, a canon for three voices. More precisely, these last folding of the molecule. The spatial folding must eventually
tWo investigations shoWed a greater relative importance of be subtracted to determine the musical periods. It Was found
the seventh note (F-S cadence on the second period) and the that Where a secondary peak of these autocorrelations, k=4,
eighth note (back to the A minor tonic) for each period. The due to the ot-heliX of the beginning Which can be seen in
latter once more prevailing over the former. That is, the FIG. 2, corresponded to these foldings. Conversely, the
perfect S-Q cadence on the siXteenth note prevailed over the musical decoding gave indications about the spatial structure
preceding F-S cadence With the recovering of the initial of a protein.
tonality. The division of the period resulted in siX semiqua
vers, one quaver, one crotchet (Which meant relative lengths EXAMPLE 2
1-1-1-1-1-1-2-4 With a 6:8 rhythm as shoWn in FIG. 1). The
coherence of the melodic progression (Wherefrom the [0063] This eXample illustrates control of the decoding of
observed regularity mainly proceeds) as Well as the richness a protein shoWing rhythmical variations. The decoding Was
of the harmonic progression, the A minor tonality being controlled at different levels including the decoding of
accompanied With modulations in E minor (second bar), G molecules knoWn to be metabolically agonist and the coher
minor (eighth bar), and F major (third and ninth bar) Was ence of the conclusions that Were draWn from the musical
apparent. similarities observed.
[0057] The ?rst and seventh notes of each period fostered, [0064] Recovering full sections of the metabolism facili
respectively, adenine and thymine in third position; Whereas, tates the decoding. In Example 1, the rhythmic formula of
the third and eighth notes fostered in the same Way cytosine cytochrome C Was transcribed as folloWs:
and guanine. This con?rmed the above division for the
period and the relative lengths of notes. In other Words, the
|6/8 GDVEKGK:K:::|IFIMKCS:Q:::|CHTVEKG:G:::|, etc.
seventh and eighth notes had lengths that Were respectively ++++++ ++++++ ++++++
tWice and four times the ?rst. This also shoWed that in an
AT-rich environment strong beats Were on the ?rst and [0065] Where the +underline the strong beats, the | indicate
seventh notes, and therefore the measure bars Were on the the place of measure bars and the: indicate the lengthening
?rst. HoWever, in a CG-rich environment the musical of notes.
sequence started on an anacrouse (strong beat on the third
and eighth notes, measure bar on the third). [0066] In subunit III of cytochrome oXidase, Which is
musically chained to cytochrome C, the beginning is a
[0058] The conclusion Was that the protein had distinct four-time formula as shoWn by the internal similarities. The
metabolic roles, depending on its environment. notes 7 to 22, Which remind in their contours the manner of
[0059] Actually, the range of its metabolic action Was ?rst Bach, Were split into groups of four notes, each one being
demonstrated by the degree of its musical evolution. In superposable to the neXt. At the tenth measure, another
comparison With the sequence of Euglena gracilis, in the measure Which Was not only superposable Was found onto
three ?rst measures an improvement of 56% of the melodic the ?rst measure of cytochrome C, but Was in fact, even
[regularity] level and of 16% of the harmonic [regularity] practically identical to the third measure of the same cyto
level Was observed as de?ned from the minimiZation of the chrome. This implied a lengthening of the eighth measure
respectively melodic and harmonic distances betWeen suc (as the cadence seen at the end of this measure already
cessive notes. indicated in itself), in a siX-time measure (FIG. 1):
outset of the molecule. The repetition of G Within a tWo sitions. The biochemical analysis of these epigenetic coop
amino acid interval indicates a binary rhythm, and the GG erations is a valuable help for decoding.
cadences that end the tWo ?rst periods specify right aWay a
[0076] Another Way to stimulate epigenetically the mus
four-time rhythm: cular decontraction is heat, Whose healing action for rheu
matism, for example, is Well knoWn. The action of heat is
ISGRGKGG: IKGLGKGG: |; conveyed by a group of proteins called heat shock, generally
+ + + + + + + + synthesiZed together. This suggests that the proteins should
shoW harmonic superpositions. In fact, the hsp 27 protein,
[0071] this pattern continued until the end of the sequence, Which appeared to be the most musical, superposed itself
With the only exception being the last measure Which Was onto the beginning of the hsp 70 protein, the most abundant,
syncopated to recover the rhythm of the ?rst tWo measures. Which sort of played here the role of a bass line. These tWo
See FIG. 3. The global repartition of the notes shoWed a molecules Were again superposable together With the begin
harmonic structure corresponding to the tone of a ?ute. The ning of troponin C, Which regulates calcium in muscular
skip of notes repeated from the beginning, Which sug contraction. The conclusion Was that it plays a role as an
gested a sound With an attack and a timbre similar to that of anti-rheumatic and that its musical level is high (FIG. 4).
Pans pipes. Other molecules, also of a high musical level and epige
netically sensitive, Were implicated in this type of ailment,
[0072] Histone 4 is one of the most conserved proteins from the stimulation of prolactin and beta-lipotropin (pre
among the animal and plant kingdoms. This does not mean cursor of beta-endorphin) to the inhibition of estrogen
that its metabolic action doesnt sometimes need to be receptor, including the inhibition of IgE and interleukin 1
tempered. The theme of histone 4s ?rst tWo measures Was beta.
found in inhibition and transposed to the fourth, in the
conserved part of the beginning of chalcone synthase, Which [0077] These examples clearly shoW hoW large sections of
is the pigmentation enZyme of many ?oWering plants. See the metabolism can be reconstituted step by step, With many
FIG. 3. This may be compared to the supposed role of Ways to check or control the coherence of the results
chromatin, Which histone 4 is part of, in the process of obtained, and thereby to precise the musical decoding of the
magnesium ?xation. During spring, plants need a lot of concerned proteins.
magnesium for photosynthesis and the plants ?xation needs
to be stimulated. Chalcone synthase is then inhibited; EXAMPLE 5
Whereas, during the fall, the Weaker stimulation of histone
desinhibits chalcone synthase and alloWs the replacement of [0078] This example shoWs a practical application of the
method of this invention using the transcriptions in the form
the green of the leaves by brighter colors of that season, the
of either musical scores, or of recordings of the obtained
diversity of Which, so much praised by the poets, becomes
musical sequences.
thus more understandable through their epigenetic compo
nent. [0079] The recordings of musical sequences may be real
[0073] When listening to the musical transposition of iZed from musical scores described earlier, by using one of
histone 4, several auditors reported an urge to eat choco the methods evaluated in B. H. Repp, J. Acoust. Soc. Am.
late Which contains magnesium. Some auditors found that 88, p.622 (1990). The most precise of these methods Was
it produces the same effect as that of granulated magne used in the examples hereby given.
sium, except that this effect is immediate in this case. This [0080] In the ?elds of agronomy and textile industries this
presents some inconvenience for people having a slightly invention provides methods to stimulate certain speci?c
too high rate of cholesterol. Actually, the musical decoding protein synthesis, for example, bovine lactation, fermenting
of chalcone isomerasethe metabolically agonist of chal of bakers yeast, the sWeet taste of some fruits, animal or
cone synthase, but Which Works better musically in stimu plant ?bres (keratine of sheeps Wool, ?broin of silkWorm,
lationincluded a series of themes and variations Whose etc.), as Well as the proteins speci?c to certain medicinal
succession reproduced, in ?oWering plants, themes of the plants. In the ?eld of environment the method of this
full metabolic chain regulating cholesterol in man. In addi invention is used, for example, in the assimilation of indus
tion, the frequency of the ascending fourths in chalcone trial ef?uents through plants by stimulating the biosynthesis
isomerase tended to approximate that observed in the alcali of the corresponding proteins.
light chain of mammalian myosin, Which stimulated mus
[0081] The method of this invention Was used on a coW
cular contraction (While magnesium acted as a muscular
decontractant). Listening to the musical transposition of Who regularly, during 15 days and at the time of milking,
histone 4 encouraged physical exercise Which is another Way listened to recordings of musical transcriptions of the amino
to loWer cholesterol. acid sequences of bovine prolactin, lactoglobulin, and lac
talbumin. Areduction, by a ratio of 3, of the relative quantity
[0074] In fact, this example underlines the importance of of Whey Was observed, resulting in a milk highly enriched in
a quasi-general phenomenon, that is, the epigenetic co proteins, and in a particularly savory cheese.
operation of different factors in the stimulation of protein
synthesis, Which accounts for the aspect meaningful in itself [0082] In another experiment groWing tomato plants Were
of the musical sequences. In this Way for example, listening given a cocktail of musical transpositions of different
to myosin Will generally suggest a military march. proteins including: speci?c virus inhibitors, various exten
sions, then a ?oWering enZyme (LAT 52), an antibacterial
EXAMPLE 4 protein having musical similarity to thaumatin, an improve
[0075] This example illustrates the biochemical analysis ment of sugar percentage (P 23), and inhibitors of fruit
of an epigenetic cooperation involving harmonic superpo softening enZymes (pectinesterase and polygalacturonase).
US 2002/0177186 A1 Nov. 28, 2002
A distinct increase in size and number of fruits (summing up [0089] The musicality of a molecule implies in itself that
to a ratio of about 3.5) Was observed, as Well as, a sensitive its epigenetic stimulation is preferable for a therapeutic use,
increase of the sWeet taste in a signi?cant proportion of the (because of the range of its metabolic interactions), to its
fruits that had particularly received P 23. direct absorption. The most musical molecules are gener
[0083] These noteWorthy results go along With a certain ally those for Which either the production by genetic engi
amount of precautions, namely, there eXist some counter neering, or the therapeutic use Which derives from it, Will
meet some problems, such as of transportation to the site of
indications to an eXcess of stimulation, especially of pro
lactin, Which must be cautiously taken into consideration by action, or of stability, or more speci?cally of secondary
effects related to doses that should be much more important
breeders that carry out these methods, as Well as for the
animals themselves Who may be fragiliZed. In the experi than What they are in the body to obtain comparable effects,
ments carried out on coWs With MoZart musicbovine
because then, the scaling Waves naturally associated to their
prolactin has in fact, apart from a musical level particu production are not present any more. This is particularly true
larly high Which can here de?ne in a mathematically simple for the inhibition of proteins, When the natural inhibitor is
Way some musical turns that can be quali?ed as typically much heavier, or simply When the production needs to be
MoZartianthe rate of mammites could seem Worrying. In reduced at a given time or in a systematic Way.
such a case one ought to complete the hearing of prolactin [0090] Eventually, concerning the use of transcriptions of
With that of alpha-1 antitrypsin, Whose musicality is also proteic sequences, the very quickness of their action may
very elaborate and Whose metabolism is complementary. alloW, by differential comparison, especially bipolar, of their
Similarly for tomatoes receiving outside stimulations, one positive and negative effects to precisely Which one is the
must be cautious not to interrupt the cycle too suddenly. most appropriate in a given situation. This identi?cation is
[0084] These results give an indication of the order of facilitated by the comparison With transcriptions of knoWn
magnitude of results obtainable in such conditions. proteic sequences of acoustic or electromagnetic phenomena
exhibiting distinct series of frequencies, and for Which some
EXAMPLE 6 effects have been observed in a similar situation.
[0085] In the therapeutic and preventive ?elds, many [0091] As Will be appreciated from the above, the inven
ailments are characteriZed by a speci?c metabolic Weakness
tion is in no Way limited to those methods of putting it into
and can therefore be ef?ciently prevented or treated With the
effect, of construction and of application Which have been
help of the present invention. This eXample illustrates such
described above in detail; on the contrary, it covers all
prevention or treatment.
versions Which may be conceived of by Workers skilled in
[0086] Because the minimal length of a musically active the art, Without exceeding, either the frameWork or the scope
sequence is of the order of that of a signal peptide, i.e., from of the present invention.
several amino acids to a feW tens, this action may be very
fast and appear after a feW seconds or a feW minutes.
That Which is claimed is:
Nevertheless, the complete integration of the produced
effect can take slightly more time, or even require, in case of
1. A method of regulating protein synthesis in situ com
a strong cultural conditioning, i.e., a certain initial training. prising:
But usually, this initial training is accomplished rather (a) determining the sequence of musical notes associated
rapidly for the obvious bene?t of the persons concerned. With the amino acid chain of a protein by associating
[0087] For a responsible use of the described method, it is With each amino acid a musical note Whose frequency
important to knoW the metabolic role of the molecules is transposed from the proper frequency of the amino
involved. And it is of course one of the interests of the acid;
musical decoding of proteins (associated to the correspond (b) determining the musical periods of said sequence of
ing colors) to alloW, by systematically spotting the similari musical notes by identifying similar series of musical
ties and counter-similarities of melodies (and colors) from notes;
the protein sequences that are knoWn and available in data
banks, to select proteins that are metabolically agonist and (c) comparing the repartition of said musical sequence of
antagonist of a given protein, for Which the degree of said amino acid chain to the average repartition of said
musical elaboration also gives an indication of the impor musical notes of the Whole of proteins so as to deter
tance of its metabolic role. The described method therefore mine the tone quality; and
alloWs determinations of precise particular indications for
some proteic sequences.
(d) regulating the biosynthesis of said protein by playing
said sequence of musical notes, including the musical
[0088] As earlier noted, in animal or plant proteins, espe period of said notes and the tone quality of said musical
cially among the most musical ones, successive melodic notes.
fragments of human metabolic chains Were observed. There 2. The method of regulating protein synthesis according to
fore, the transpositions Which Were found to be active on claim 1 further comprising:
man Were not limited to human molecules. On the other
hand, the metabolism of those species seems in some Way determining the lengths of said musical notes by rectify
more specialized for the production of certain molecules, ing collectively, and then rectifying individually said
and it is indeed the most musical proteins that Will be the musical periods by adjusting the phrasing to the mea
most important for the applications. Of course, these corre sure of said musical sequence.
spondences betWeen different species facilitate the delimi 3. The method of regulating protein synthesis according to
tation of the metabolic role, and the decoding of proteic claim 1 further comprising determining the frequency of
sequences. said musical note according to a code comprising:
US 2002/0177186 A1 Nov. 28, 2002
(a) taking the frequency of each amino acid in its free transposition of quantum vibrations associated to the mature
state, proportional to its mass, protein after it is spatially folded back over itself, according
to a code speci?c to the stabiliZation of that protein or to the
(b) minimizing the global harmonic distance betWeen the inhibition of its biosynthesis obtained through the musical
frequencies of each pair of amino acids in said protein
sequence realiZed according to claim 1, Which code is
While taking into account the proportion of each amino
deduced from the code obtained from claim 1, by application
acid in the population of transfer RNAs Within a cell
Where synthesis of said protein takes place, and of the formula vsvo Argch (ef/fo)Logch 1, Where f, f0 are the
Wherein the displacement of the note frequency musical frequencies and v, v0 the frequencies of colors, With
the indeX 0 shoWing the central values.
toWards its synchroniZed value is inferior to half the
8. The method according to claim 6, Wherein the stabili
interval betWeen the tWo synchroniZed frequencies
Zation of proteins stimulated by the musical sequences
Which surround said keynote frequency, then
obtained according to claim 1 consists in the association to
(c) transposing the frequencies thus obtained into the the different amino acids of the folloWing colors:
auditive range, said code being relative to the biosyn Gly=dark red; Ala=bright red; Ser=orange; Pro, Val, Thr,
thetic stimulation of said protein; and Cys=ochre; Leu, Ile, Asn, Asp=lemon yelloW; Gln,
(d) obtaining said code relative to its inhibition by sym Glu, Lys, Met=green; His=emerald; Phe=blue; Arg,
metriZation of the logarithms of heretofore obtained Tyr=indigo; Trp=purple
frequencies With respect to their central value consid 9. Transcriptions of a musical sequence according to
ered as the origin. claim 1 selected from the group consisting of musical scores
4. The method of claim 3, Wherein said code comprises of said musical sequence and audio recordings of music
the folloWing notes of the chromatic tempered scale in according to said musical sequence.
ascending order: 10. The method according to claim 9 for the character
iZation of proteic sequences ?t to be regulated by using any
Gly=loW A; Ala=C; Ser=E; Pro, Val, Thr, Cys=F; Leu, Ile, of the transcriptions characteriZed in that one delimits their
Asn, Asp=G; Gln, Lys, Glu, Met=A; His=B ?at; Phe as metabolic role by decoding With the method according to
Well as SeC=B; Arg, tyr=sharp C; Trp=sharp D. claim 3, thereby shoWing the musical similarities and anti
5. The method of claim 3, Wherein said code comprises similarities that they present With other proteins, the har
the folloWing notes of a chromatic tempered scale, in monic superpositions With other proteic melodies, or a
ascending order: combination of these factors, from Which the agonisms and
Trp=C; Arg, Tyr=D; Phe as Well as SeC=E ?at; His=E; antagonisms can be deduced.
Gln, Lys, Glu, Met=F; Leu, Ile, Asn, Asp=G; Pro, Val, 11. The method according to claim 9, in Which the
Thr, Cys=A; Ser=B ?at; Ala=Sharp D; Gly=sharp F, characteriZation for a given application is re?ned by bipolar
differential comparisons With the positive or negative effects
Which are deduced from the notes of the code by taking obtained by using said transcriptions.
the notes of the chromatic tempered scale Which are 12. The method according to claim 10, in Which the
symmetrical to those of said keynotes With respect to characteriZation for a given application is re?ned by iden
central G. ti?cation, through musical similarity or anti-similarity of the
6. The method according to claim 3 Wherein said synthe proteins involved during positive or negative effects due or
sis stimulates synthesis of a protein in a plant. associated to acoustic or electromagnetic phenomena eXhib
7. The method according to claim 1, Wherein each sound iting distinct series of frequencies.
transposition of quantum vibrations associated With the
biosynthesis of a given protein is completed by the color * * * * *