Vous êtes sur la page 1sur 34

PUBLICATIONS DU DEPARTEMENT D'INDOLOGIE - 77

,..... ,...... ,......


~l <&~:I q ~J ~ t1 I
J:il~dl'""lletq(!~
'"" til
LE COMMENTAIRE DE HARIHARA
SUR LE MALATlMADHAVA DE BHAVABHUTI

premiere edition
Frarn;ois Grimal

INSTITUT FRANQAIS DE PONDICHERY


ECOLE FRANQAISE D'EXTR~ME-ORIENT
Ouvrage publie par l'Institut franc;ais de Pondichery
et l'Ecole franc;aise d'Extr~me-Orient clans le cadre
de leur association en indologie

Comite de lecture

Colette Caillat,
Membre de l'Institut de France
Franc;ois Gros,
Directeur d'etudes a l'Ecole pratique des Hautes Etudes, Paris
Michael Hahn,
Professeur a l'Universite de Marburg
Alexis Sanderson,
Spalding Professor of Eastern Religions and Ethics, All Souls' College, Oxford
Raffaele Tarella,
Professeur a l'Universite de Rome

Institut franc;ais de Pondichery, 1999 (ISSN 0073-8352)

Ouvrage compose en "Computer Modern" et Velthuis' DevanagarI par


Mme T. V. Kamalambal, a l'aide des programmes 'IEX, Tu\'IEX et EDMAC
(macros pour la realisation d'editions critiques, crees par John Lavagnino et
Dominik Wujastyk)

Couverture et impression : Sri Aurobindo Ashram Press, Pondicherry


AVANT-PROPOS

Le texte, dont nous proposons ici la premiere edition, fournit les expli-
cations dont "les ignorants de l'epoque" avaient besoin, vers le 12e siecle,
clans le Nord de l'Inde, pour comprendre le Miilatfmiidhava de Bhavabhuti,
une piece de thMtre vieille, deja, de 500 ans. Ceux pour qui Harihara
ecrivit ces notes avaient besoin d'une traduction des repliques qui sont en
pr.krit et d'explications pour les passages difficiles en sanskrit. Harihara
leur donna tout cela, en sanskrit. A ses traductions du pr.krit, il ajouta
m~me, le cas echeant, des explications complementaires, et, pour ce qui
est des parties de la piece en sanskrit, il les expliqua pratiquement toutes ,
m~me si c'est, parfois, de fac;on tres breve. Autrement dit, Harihara fournit
aux destinataires de ses notes beaucoup de ce dont nous avons besoin
aujourd'hui. 11 suffit d'essayer de traduire le texte de la piece sans cette
aide pour s'en convaincre.
Harihara n'etait pas le premier a expliquer cette piece de Bhavabhuti.
11 rapporte, en effet, par quatre fois, les explications, peut-~tre simple-
ment orales, d'un autre (ou d'autres) commentateur. Mais son com-
mentaire est le plus ancien qui nous soit parvenu. Un commentaire qui
aura du succes puisqu'un siecle au moins plus tard, le savant Jagaddhara,
a Mithila, le copiera abondamment. Apres celui de Jagaddhara, d'autres
commentaires virent certainement le jour. Pour les anciens, nous restent
aujourd'hui, edites, ceux de Tripurari et de Purr.iasarasvatI, et, encore en
manuscrit, ceux de Malanka et de Dharananda. 11 existe, enfin, des com-
mentaires modernes imprimes (posterieurs a l'editio princeps de la piece,
qui date de 1830), toujours en sanskrit, par Jivananda Vidyasagara (1880) ,
Haridasasiddhantavagifa Bhagacarya (1914), Kuiijavihari Tarkasiddhanta
Bhattacarya (1920), et, en sanskrit et en hindi, par Sriseeyaraja.Sarma SastrI
(1954). Aujourd'hui, c'est, en general, toujours a l'aide de !'explication
de Jagaddhara, done, a travers elle, de celle de Harihara, qu'on lit le
Miilatfmiidhava, ce gr.ce aux editions qu'en firent R. G. Bhandarkar en
ii Le commentaire de Harihara sur le Malatimadhava

1876, puis M. R. Telang en 1892, enfin M. R. Kale en 1913, editions toutes


plusieurs fois reeditees.
Pourquoi done avoir edite ce commentaire, si ce n'est pas seulement
pour la satisfaction, qui n'est pas mince, d'avoir empeche de disparaitre a
tout jamais un texte qui est la plus ancienne explication d'une piece aussi
celebre que le Malati:madhava? Pour deux raisons principalement.
La premiere est que cette edition fait partie d'un projet qui est de
parvenir a montrer, soit sous la forme d'une traduction suffisamment an-
notee, soit, plut6t, sous celle d'une etude, les divers aspects d'une analyse
indienne d'une telle piece. Or, l'une des manifestations les plus immedia-
tes de celle-ci - qui, bien st1r, complexe, est a recueillir aupres d'autres
sources aussi - consiste en ces commentaires. Certes, nous savons bien
que ce sont eux qui, deja, ont nourri la plupart des notes aux editions
et, surtout, aux traductions de la piece destinees aux etudiants indiens -
edition de R. G. Bhandarkar, editions-traductions de M. R. Kale, de R. D.
Karmarkar (1935), et de C.R. Devadhar et N. G. Suru (1935) - mais, outre
que les deux dernieres sont introuvables, leurs auteurs ont ete necessaire-
ment selectifs, tant clans le choix de leurs remarques que clans celui des
commentaires. Or, ces commentaires sont !'oeuvre de personnalites di-
verses oeuvrant a des epoques et clans des regions differentes et pour des
publics sans doute varies. 11 faut done les etudier, si possible tous, et, sys-
tematiquement, en extraire et en analyser tous les elements qui permettent
de saisir cet aspect de la comprehension indienne d'une oeuvre litteraire
sanskrite. Cette edition a ete conc;ue pour servir a cette analyse.
La deuxieme raison est que ce commentaire est important pour une
etude de l'histoire du genre de texte qu'il represente. 11 n'est, en effet,
guere eloigne clans le temps des plus anciens commentaires litteraires qui
nous sont parvenus et qui semblent ne pas remonter au-dela du 10e siecle.
Or, la longue histoire - elle couvre done tout un millenaire - de ces textes
reste a faire. Une histoire qui fait partie de celle de la transmission du
sanskrit clans l'Inde meme.
A ces deux raisons s'en ajoute une troisieme, plus personnelle. Editer
un texte pour la premiere fois a partir de ses manuscrits etait un souhait
ancien. C'etait aussi faire une experience necessaire pour l'exercice des
responsabilites philologiques qui sont les n6tres au sein de nos institutions
a Pondichery.

Ce travail represente une etape clans un long itineraire. Mes pensees


vont done d'abord a nos maitres en philologie, classique et sanskrite, a
Madame Colette Caillat, membre de l'Institut de France. Je dedie cet
ouvrage, malgre toutes ses imperfections, a la memoire du professeur Ar-
mand Minard. Je sais gre a ceux qui, depuis Paris, m'ont fait decouvrir
la necessite de l'Inde, de ses pandits - les descendants des auteurs de ces
Avant-propos iii

commentaires - et de ses manuscrits : aux professeurs Kamaleswar Bhat-


tacharya et Pierre-Sylvain Filliozat. Mais l'acces au terrain n'etait pas
chose aisee. Et c'est ici que je veux exprimer. toute ma gratitude au profes-
seur Franc;ois Gros qui m'a permis, en Incle meme, de faire que l'etude des
analyses indiennes des langues et des litteratures devienne un programme
de recherche de l'Ecole franc;aise d'Extreme-Orient et de l'Institut franc;ais
de Pondichery. C'est a lui encore que je dois la chance inestimable d'avoir
S. L. P. Anjaneya Sarma pour savant collegue et ami. Sans son savoir et
sans son amitie, cet ouvrage n'aurait jamais vu le jour. J'ai aussi beneficie
de l'erudition et de la generosite du professeur Alexis Sanderson. Qu'il
en soit sincerement remercie. Je n'oublie pas tous ceux qui ont contribue
a la realisation de cet ouvrage : le professeur P. P. Apte qui m'a permis
d'obtenir de Mademoiselle Shashikala Gore une copie de la transcription
du manuscrit C faite pour son pere, le Dr. N. A. Gore, en 1939 a Calcutta,
Sri S. Sambandan de l'lnstitut franc;ais de Pondichery, qui, lui aussi, m'aida
a lire ce manuscrit, les institutions enfin, le Bhandarkar Oriental Research
Institute qui m'a autorise a reproduire le texte du Malatfmiidhava edite
par R. G. Bhandarkar, et, pour leur aide conjuguee, l'Institut franc;ais de
Pondichery et l'Ecole franc;aise d'Extreme-Orient.
INTRODUCTION

.A propos de J'auteur

Nous ne savons de l'auteur que le peu que nous livre ce texte,


objet de cette edition. Son nom : Harihara, celui de son pere :
Amoghadeva, et son gotra : celui de Parasara. Encore ces ren-
seignements ne sont-ils donnes que par les colophons de nos deux
manuscrits. Dans son introduction, elle- meme fort breve, Harihara
ne <lit rien, ni de lui ni de sa famille. Il n'y dit meme pas son nom.
Il ne cite non plus, ni la, ni au cours de son explication, aucune
autre oeuvre qu'il aurait composee. Nous n'avons, d'autre part,
rencontre jusqu'ici aucune mention de lui ou d'un ouvrage de lui,
a l'exception, vraisemblable, de cette allusion a une flka que fait
Jagaddhara dans le deuxieme vers de l'introduction a son propre
commentaire du Malat1madhava:
Natva guriin gm;iaguriin avalokya t1kam ...
sr1man. Jagaddharakrtl vitanoti t1kam / /
(S'etant incline devant ses maitres (ou, son maitre) tout pleins de
qualites, a pres avoir vu un commentaire... le fortune et savant
Jagaddhara compose [ce] commentaire.) Cette t1ka qu'il a vue doit
etre celle de Harihara que nous editons 1 .
1
.A propos de la date de Jagaddhara. Nous pensons, en effet, que c'est
Jagaddhara qui a emprunte a Harihara, et non !'inverse. En cela, nous sommes
de l'avis de N. A. Gore et de P. K. Gode. Voir, du premier, !'article intitule
"Jagaddhara's indebtedness to Harihara, an ancient commentator of the Malatf-
madhava". P. K. Gode, de son c6te (1953a et 1953d), s'est appuye sur cette vue
Vl Le commentaire de Harihara sur le Malatimadhava

pour definir les dates de Jagaddhara. 11 situe, en effet, ce dernier entre 1275 et
1450, 1275 qui est, selon lui, la date la plus basse de Harihara, et 1450 parce que
le plus ancien manuscrit d'une des oeuvres de Jagaddhara, en l'occurrence de sa
Vasavadattatfka, manuscrit du Nepal, est date de 355 de !'ere de Lak~mai:iasena,
c'est-a-dire de 1473 de notre ere. Mais si l'on n'accepte pas ce terminus a quo,
peut-on imaginer que Jagaddhara ait precede Harihara? Pour R. G. Bhandarkar
(p. xxxv de !'introduction a son edition du MaJ.atfmadhava) - qui ne connais-
sait pas !'existence du commentaire de Harihara -, la date la plus haute pour
Jagaddhara etait celle du Medinfkosa, cite nommement par celui-ci, qu'il pla<;ait
entre 1375 et 1431. Mais depuis, P. K. Gode (1953c : 281-289) a situe ce lexique
entre 1200 et 1275. On en revient done au XIII siecle, mais avec un laps de temps
theorique, au tout debut, de 16 ans (16 ans, parce que le plus ancien manuscrit du
commentaire de Harihara porte une date equivalant a 1216 de notre ere) pendant
lequel le Medinfko8a aurait ete compose, puis le commentaire de J agaddhara, puis
celui de Harihara. Ce qui parait bien improbable. En fait, il nous semble que
!'on peut arriver a une date plausible, nettement posterieure a celle de Harihara,
si, a la lumiere de ce qu'on sait des dates du roi Ramasirha de la dynastie des
Kari:iata de Mithila, l'on reprend la piste de la mention de Srikara, commentateur
de l'Amarakosa, par Jagaddhara dans son explication du vers 8 de l'acte I du
Ve~fsarhara, et, en mi!me temps, l'hypothese selon laquelle Ratnesvara, le com-
mentateur des trois premiers chapitres du Sarasvatfka~thabhara~a - le traite
de poetique - de Bhoja, serait le pere de Jagaddhara. 11 existe, en effet, un
manuscrit de ce commentaire de Srikara, appele Vyakhyamrta, dont le colophon
fait de cet auteur unimportant personnage (sadasya) de la cour de Ramasirha
(voir H.P. Sastri, 1905 : 23). R. M. Chakra..varti Bahadur (1915 : 414) situait ce
roi aux alentours de 1390. Depuis, il a ete montre (R. K. Choudhary 1954 : 111)
qu'il y avait confusion entre deux rois du mi!me nom et que le Ramasirha du
colophon du manuscrit de l'ouvrage de Srikara etait bien le grand Ramasirha
de la dynastie des Kar1,1.ata, mais qu'il devait avoir regne entre 1227 et 1285 .
L. Petech (1958 : 194) fait toujours de ce roi le quatrieme de cette dynastie,
mais le situe un peu plus t6t, entre c. 1205 et 1245. On sait, d'autre part, que les
trois premiers chapitres du Sarasvatfka~thabhara~a ont ete commentes par un
certain Ratnesvara a la demande du roi Ramasirha (voir le colophon final de ce
commentaire) , que cette explication a ete continuee pour le quatrieme chapitre
par J agaddhara dont le pere, Ratnadhara, etait un grand savant et un officiel
de la cour de Mithila. V. Raghavan suggere (P. K. Gode, 1953a : 365, note 5),
sur la base de l'echange -dhara/ -fsvara dans la liste des anci!tres de Jagaddhara,
que Ratnesvara et Ratnadhara pourraient i!tre la mi!me personne. S'il en est
ainsi, Jagaddhara ne pourrait done pas avoir precede Harihara et aurait vecu
dans la seconde moitie du XIII siecle ou au debut du siecle suivant. Soit un
siecle plus t6t que ce que l'on avance generalement (ainsi M. Coulson, p. xliv
de !'introduction a son edition du MaJ.atfmadhava), mais sans preuve decisive
a notre connaissance. Voir, par exemple, U. Thakur (1956 : 330) qui affirme
que Jagaddhara fut le dharmadhikara~ka ("Chief Justice") de Dhlrasirha de
la dynastie des Oinavara (la dynastie qui fit suite aux Kari:iata), dont il situe
!'accession vers 1460. Voir aussi P. N. Misra (1993 : 207). II faudrait evidem-
ment examiner tous !es colophons de tous les manuscrits de toutes les oeuvres
Introduction Vll

Nous pouvons, en revanche, situer la date du commentaire de


Harihara avec une precision suffisante. Avec la plus grande precision
en fait, si l'on admet que la date donnee a la fin de notre plus ancien
manuscrit, et qui correspond au vendredi 1er janvier 1216, est celle
de la composition de ce texte. Si on ne l'admet pas, 1216 n'est plus
que le terminus ante quem et il faut determiner un terminus a quo.
Pour celui-ci nous proposons 1150, qui est une date moyenne pour
la carriere litteraire de Srihar~a. Des citations que fait Harihara et
que nous avons pu identifier, les deux du Nai~adhacarita sont, en
effet, celles qui nous rapprochent le plus de 1216 2 .
D'ou etait Harihara? Ou, plutot, a quelle region de l'Inde son
commentaire parait-il lie? Id encore, si l'on accepte que l"'apres-
colophon" de notre plus ancien manuscrit traite de la composition
du commentaire, la reponse est claire : celle-ci s'acheva en 336 de
l'ere nepalaise quand le royaume appartenait au roi Arimalla. Done,
dans le royaume du Nepal dont la capitale etait alors Patan3 . Et, en
faveur d'une Origine nepalaise, OU d'une region proche, milite le fait
que les manuscrits de ce commentaire, les deux que nous avons pu
utiliser, comme les trois autres dont nous avons entendu parler, ont
un lien avec ce royaume. Pour nos deux manuscrits, voir ci-dessous.
Les autres sont, d'une part, celui que Roderick Sinclair, le reviseur
de !'edition du Malatfmadhava de M. Coulson, decrit page xlv de
de Jagaddhara, mais il peut y avoir ici aussi quelque confusion. Cette fonction
etait, en tout cas, celle de son pere a en juger par le colophon du commentaire du
MaJ.atrmadhava : Iti srfmanmahopadhyayapa~t;litarajamahakavirajadharmadhi
kariratnadharapa~t;litatmaja8rfjagaddharaviracitayarp. MaJ.atrmadhavatfkayarp.
da8amo 'ri.kah .
2
SelonA'. N. Jani (1957 : 129), la carriere litteraire de SrThar~a se situerait
entre environ 1125 et 1180. Le mi!me (ibid., note 27) rapporte !'opinion de S. P.
Bhattacharya pour qui le Nai$adhacarita serait a placer avant le milieu du 12
siecle, au moins une decennie avant . Si l'on n'acceptait pas cette date pour le
Nai$adhacarita, il ne faudrait pas remonter bien loin pour trouver notre terminus
a quo : jusqu'a 1111/ 1112 seulement, date, celle-ci sftre, de la composition du
Visvaprakasa (voir Claus Vogel, 1979 : 329), que Harihara cite deux fois (sans
le nommer) : p. 39, 1. 760 et p. 266, 1. 716.
P. K. Gode (1953a : 371) propose les mi!mes dates pour Harihara, mais 1150 a
cause de la citation que celui-ci fait (p. 9, 11. 160-162) du Kavyaprakasa que P. K.
Gode situe en 1100.
3
Voir L. Petech, 1958 : 82-85 et 171-173. L"'apres-colophon" de notre
manuscrit C est l'un des 11 documents - les 10 autres etant aussi des colo-
phons -, qui fournissent des dates precises pour le regne de ce roi, soit de 1200
a 1216.
Vlll Le commentaire de Harihara sur le Malatimadhava

!'introduction a cette edition. Il s'agit d'un manuscrit en ecriture


bangala, que M. Coulson avait trouve a Kathmandu, qu'il avait pho-
tographie et qui est aujourd 'hui perdu. D'apres les citations qui en
sont faites il parait extremement proche de notre manuscrit B et,
comme ce dernier, semble avoir eu un predecesseur en ecriture nevarf
(ou apparentee). Il existerait, d'autre part, deux autres manuscrits,
en ecriture maithilf cette fois , dans la collection de manuscrits du
Nepal microfilmes dans le cadre du "Nepal-German Manuscript Pre-
servation Project" 4 . On le voit, tous ces manuscrits ont un lien avec
le Nepal et ses environs.
D'un autre cote, on pourrait aussi penser au Cachemire dans
la mesure ou le texte qu'explique Harihara est, compare a tous
les textes du Malatfmadhava collationnes par R. G. Bhandarkar et
M. Coulson, plus proche de celui que donnent les manuscrits de cette
region, c'est-a-dire les Kl et K2 du premier - qui sont les G et H de
M. Coulson - , et les I et J , plus particulierement I, de ce dernier. Ceci
etant, nous n'avons pas trouve trace, jusqu'a present, de manuscrits
de ce commentaire au Cachemire. Quant au fait que Harihara cite
quatre fois l'opinion de quelqu'un du Cachemire 5 , d'une personne
(ou de personnes, mais son pluriel est probablement de politesse)
qui avait commente le Malatfmadhava, cela ne prouve rien. Au
contraire. On peut se demander, en effet, puisque la formulation
iti Kasmfra}:l ( ou iti Kasmfra}:l) est utilisee a chaque fois pour re-
jeter une interpretation differente de la sienne, si Harihara se serait
exprime ainsi s'il avait ete lui-meme du Cachemire.
Un argument de plus de poids pour preciser l'environnement
linguistique du commentaire ou, peut-etre meme, la langue de son
auteur, serait de savoir a quel parler appartiennent les 13 mots que
cite Harihara a propos d'autant de mots sanskrits en disant que ces
mots sanskrits sont bien connus (prasiddha ou khyata) sous la forme
de ces mots-la. Il doit s'agir d'une langue vernaculaire, peut-etre de
la langue maternelle de Harihara. Notons que Jagaddhara, apropos
de certains de ces memes mots sanskrits, a recours au meme type
4
Quand nous avions demande s'il existait un manuscrit de ce commentaire
dans cette collection, il nous avait ete repondu par la negative. ll semblerait,
en fait, qu'il y en ait deux, mais mal catalogues. Cette information, que nous
devons au Dr. Dominic Goodall, nous est parvenue malheureusement trop tard.
5
Une fois au singulier : p. 177, 1. 383, et trois fois au pluriel : p. 197, 1. 14;
p. 310, 1. 222; p . 341, 1. 83.
Introduction lX

d'explication, formule de la meme fac;on, et que les mots qu'il cite


doivent etre de l'ancienne maithilf. Il existe quelque ressemblance
entre les deux listes. Voir l'index I, p. 459. Mais la forme de ces
mots est trop peu sllre dans nos deux manuscrits pour qu'on puisse
s'avancer bien loin.

Les sources

Cette premiere edition a ete realisee a partir des deux seuls


manuscrits auxquels nous avons pu avoir acces.

Le manuscrit C. Le plus ancien manuscrit, auquel nous at-


tribuons le sigle C, est conserve a l' Asiatic Society de Calcutta ou il
porte le n 5299 du catalogue des manuscrits de cette institution.
Ce manuscrit sur feuilles de palme, en ecriture bhujirpmol, a ete
decrit par Haraprasada ShastrI7 . Il comporte a present 82 olles, par
endroits tres endommagees (ces deteriorations, dans la mesure ou
elles affectent le texte, sont indiquees dans notre apparat critique
par une etoile). Dix portions de texte manquent, qui doivent corres-
pondre a autant de feuilles. Ainsi, dans notre numerotation - une
numerotation, qui ne semble pas toujours ancienne, ayant souvent
disparu avec les extremites des feuilles - , les passages manquants se
situent entre les feuilles 16b et 17a, 19b et 20a, 21b et 22a, 34b et
35a, 40b et 41a, 42b et 43a, 44b et 45a, 49b et 50a, 77b et 78a, 80b
et 8la. Deux olles d'un autre manuscrit, dans la meme ecriture mais
d'une forme un peu plus ancienne, sont intercalees dans la liasse 8 .
Nous avons ete aide dans la lecture de ce manuscrit par deux
transcrits en ecriture devanagarf. L'un a ete fait a Calcutta en 1939
par Kalipada Kavyavyakaranatirtha a la demande de P. K. Gode
pour le Dr. N. A. Gore. Nous remercions ici sa fille, M11 e Shashikala
Gore, qui a bien voulu nous en donner une photocopie. Le second
6
Voir Umesha Mishra, 1928, qui donne une liste de ces mots .
7
H. Shastri, 1934 : 242, mais qui qualifie l'ecriture de nevari alors qu'il s'agit
bien de bhuji:rp.mol contemporaine de la date que porte ce manuscrit, comme
nous le fait remarquer M. Somdev Vasudeva que nous tenons a remercier pour
!'aide qu'il nous a apportee dans la verification d 'un certain nombre de lectures.
8
11 s'agit de deux passages du Subhfi-$itaratnakosa correspondant, pour la
premiere olle, aux n 184-190 et 191-197 (pp. 36-37 et 37-38) , pour la seconde,
aux n 559-566 et 566-572 (pp. 102-103 et 103-104) de !'edition de D. D. Kosambi
et V. V. Gokhale.
x Le commentaire de Harihara sur le Malatimadhava

a ete fait par Shri S. Sanbandan, attache de recherche a l'Institut


franc;ais de Pondichery.
Ce manuscrit est l'oeuvre d'un copiste bouddhiste. Le prouve
!'invocation liminaire Orp. nama.Q Sarvajiiaya. Sarvajiia est, on le
sait, un nom du Buddha9 . Le colophon proprement <lit est Iti
misrasrfmadamoghadevatmajamisrasrfhariharaviracitayarp. Malatf-
madhavaprakara1.iatfkayarp. da.Samo 'nka.Q. Vient ensuite ce qu'il est
convenu d'appeler en anglais un "post colophon" (et tel est le terme
employe par Haraprasada Shastri clans le cas present) qui comprend
les elements suivants : un dessin, puis un vers clans le metre arya,
puis le meme dessin, puis deux vers clans le metre anu$tubh. Soit,
d'abord, entre les deux dessins :
Srfman Hariharamisro Vi$ame granthe'tra bodham adhatum I
vyadhita Parasaragotra[$] tfkarp. sarp.k$epato ruciram / /
(Le fortune et respectable Harihara, du gotra de Parasara, pour
faire comprendre cet ouvrage difficile, a compose [ce] commentaire
plaisant, sous une forme breve.) Puis :
$ac;lvahniramage var$e pau$a8uklesavasare /
Bhrguje camrte yoge rajye 'rimalladevape [0 vfyeJ I I
Anena pul)yabharel)a prajiiopayasamanvita.Q /
Loka bhavantu sarp.sara.Q sarp.sara[0 reJ)a] vivarjita.Q / /
(L'an 336, le onzieme jour de la quinzaine claire du mois de Pau~a,
le jour du fils de Bh:rgu, pendant le yoga amrta, le royaume apparte-
nant au roi Arimalla, puissent par cette grande quantite de merites,
les gens pourvus de ce moyen qu'est !'intelligence, etre forts et libres
d'entraves) 10 .
La question qui se pose est evidemment de savoir s'il faut lier le
vers en arya et les deux anu$tubh. Si on les lie, !'ensemble donne la
date de composition du commentaire. Sinon, les anu$tubh doivent
donner une date de copie, probablement de ce manuscrit. Cette
incertitude se refl.ete clans les opinions differentes de Haraprasada
Shastri pour qui il s'agit de la "date du manuscrit" et de P. K.
Gode et N. A. Gore pour qui c'est celle de la composition du texte 11 .
Aucun de ces auteurs ne donne les raisons de son opinion, mais il
nous semble que les arguments que l'on peut avancer en faveur de
9
Amarako5a I, 1, 13.
10
Nous prenons saipsiiral;i pour un bahuvrihi : samyak saral;i ye$iilp te.
11
P. K. Gode, 1953b : 242 et 1953a : 371; A. N. Gore, dans son article cite
ci-dessus note 1, p. 1.
Introduction Xl

l'une ou l'autre vue, sont a peu pres d'egale force. Bref, pour nous,
!'incertitude demeure 12 .
Cette date correspond au vendredi 1er janvier 1216 13 . Et par
amrte yoge, il est indique que le moment etait faste 14 .

Le manuscrit B. Notre second manuscrit, auquel nous at-


tribuons le sigle B, est conserve au Sarasvati Bhavan de Benares.
11 porte le n 42782 clans le catalogue des manuscrits de cette bi-
bliotheque15.
La description qui en est faite correspond a la realite presente :
82 feuilles de papier en bon etat, de 25,5 cm sur 8,5 cm en moyenne,
numerotees sur le recto, d'abord de 1 a 11, deux fois : clans la
marge de gauche en haut et au milieu de la marge de droite, puis
12
Ainsi , s'il est vrai que ces trois vers forment bien ce qu'il est
convenu d'appeler un "post colophon" et qu'en general, si le colophon pro-
prement dit est de l'auteur, l" 'apres-colophon" est d 'un copiste, les exem-
ples ne manquent pas ou, apres le colophon proprement dit, vient un
vers qui est de l'auteur. Par exemple, a la fin de la Tarkabhii-$ii de
Mok~akara Gupta : SrTmadrajajagaddalavibarTyamabayatibhik$umok$iikara-
guptaviracitiiyiizp Tarkabhli.$ii,yiizp pariirthanumiinaparicchedaJ:i samaptal;i I
Tarkabhii-$iim imiizp krtvii pu.(lyam asadi yan maya /
tena pu.(lyena loko'yazp buddhatvam adhigacchatu / /
Mais si cet "apres-colophon" est de l'auteur, il devrait se retrouver clans tous
les manuscrits. Or, ce n'est pas le cas. Ces trois vers ne se retrouvent pas dans
notre autre manuscrit B. Maintenant, si l'on veut voir la une date de copie,
on est force de constater qu'a la difference de ce qu'on observe a la fin de la
majorite des manuscrits contemporains et de m~m e provenance (voir ceux que
cite L. Petech) ou l'"apres-colophon" indique clairement qu'il s'agit de la date
de copie du manuscrit, ici ce n'est pas le cas. Il nous paraJt, dans l'etat actuel
de nos connaissances, impossible de trancher, m~me si - autre argument - une
certaine coherence syntaxique pousse a prendre les trois vers ensemble, sans tenir
compte de leur presentation. Le Dr. K. V. Sarma emet l'hypothese que ces trois
vers ne seraient pas de !'auteur mais d'un contemporain, peut-~tre le copiste de
ce manuscrit, qui aurait rapporte la date de composition.
13
L. Petech, op. cit., p . 83.
14
Le yoga (conjonction) dont il s'agit ici, designe la conjonction d'une cons-
tellation de l'ecliptique (nak$atra) et d'un jour solaire (vara). Ce jour etant
un vendredi, le nak$atra devait ~tre UttaraphalgunI (determinee par l'etoile 8
du Lion). Voir le Sabdiirthacintiima.(li sous amrtayogaJ:i. Nous remercions le
Dr. K. V. Sarma pour cette reference. Ce yoga, comme son nom le suggere, est
une periode faste .
15
A Descriptive Catalogue of The Sanskrit Manuscripts acquired for and de-
posited in the Sanskrit University Library (Sarasvati Bhavana), Varanasi, during
the years 1791-1950. Volume XI. Varanasi. 1964. Pages 218-219.
Xll Le commentaire de Harihara sur le Malatimadhava

de 1 a 71 mais une seule fois : dans l'angle inferieur de la marge de


droite; le nombre de lignes par page est de 10, celui de syllabes par
ligne, de 50 environ. 11 est complet, ne porte pas d'annotations, mais
seulement des corrections dans les marges, manifestement de la main
du copiste; des lacunes - que nous enregistrons dans notre apparat
critique - sont indiquees par le copiste par des tirets successifs ou
par des blancs; il est ecrit dans une devanagar1 tres lisible.
L'invocation initiale est Srfnrsirphaya nama.ti. Le colophon
(final) est Iti misrasr1madamoghadevatmajamisrasr1hariharaviraci-
tayarp Malat1madhavat1kayarp dasamo'rpka.ti samapta.ti 1111 subham
astu I I I I L' "apres-colophon" est Sr1naipalasamvat 885 vai8a$a-
[kha]sudi 2 candravara. tasmin dine. V1radevatmajena Dhanarp-
jayena likhitva. Sr1gal}.esabhattatmajaya Sr1bhavan1sarpkarabhatta-
yadadat I I I I yadrSi pustakarp dr$tva tadrSi likhitarp maya I yadi
suddham asuddharp va sodhan1yarp vicak$al}.ai.ti I I I I subham I I
Le copiste Dhanarjaya, fils de Viradeva, finit done sa copie lundi,
deuxieme jour de la quinzaine claire du mois de Vaisakha de l'annee
885 de l'ere nepalaise, c'est-a-dire lundi 20 mai 1765 16 , et la remit
au fortune Bhavanisarkarabhatta, fils du fortune Gal).esabhatta.
Le manuscrit C a ete utilise comme le montrent quelques annota-
tions de mains differentes de celle de son copiste, et, pour certaines,
bien plus tardives. B ne comporte pas ces traces.
Ces deux manuscrits sont, heureusement, independants l'un de
l'autre.
Le commentaire de Jagaddhara, tel qu'edite par R. G. Bhan-
darkar avec le Malatlmadhava, nous a fourni, plusieurs fois , un fond
pour imaginer le texte de Harihara quand celui-ci n'apparaissait pas
clairement. Jagaddhara a, en effet, abondamment copie le com-
mentaire de son predecesseur. Nous dirions meme, dans un autre
contexte, qu'il l'a pille 17 . En cela son explication nous a ete mainte
fois utile, notamment pour proposer des conjectures 18 .
Les apparats des deux editions critiques, des deux seules
qui existent, celle de R. G. Bhandarkar et celle de M. Coulson, nous
16
D'apres L. D. Swamikannu Pillai, An Indian Ephemeris, vol. VI.
17
Nous avons mentionne ci-dessus (note 1, p. 1) !'article de N. A. Gore. 11
faudrait elaborer cette comparaison. Ce qui permettrait, incidemment, de pro-
poser quelques amendements au texte edite de Jagaddhara.
18
Pour un exemple entre bien d'autres, voir la note 98 a l'acte I.
Introduction Xlll

ont aussi ete d'une grande utilite. D'abord en confirmant des le<;ons
du Malatlmadhava, le<;ons non adoptees dans les editions, mais que
connait Harihara, qu'il les cite directement ou qu'on puisse les in-
ferer a partir de ses explications 19 . C'est grace a ces deux ap-
parats critiques que l'on peut, jusqu'a un certain point, situer le
texte du Malatlmadhava qu'explique Harihara dans !'ensemble des
manuscrits de la piece qui ont ete decrits. Comme nous l'avons
<lit ci-dessus, ce texte apparait plus proche des manuscrits du Ca-
chemire utilises pour ces deux editions. Ces deux apparats critiques
nous ont aussi aide a restituer, ou a proposer de corriger, les mots
prakrits cites dans le commentaire. Ils nous ont aussi servi - plus
particulierement, en ce cas, celui de M. Coulson - a comprendre la
structure des dialogues qui, pour les personnages parlant sanskrit,
n'est pas indiquee dans le commentaire 20 .

Sur la transmission du texte dans Jes deux manuscrits


et son edition
Vue d'ensemble
Etant donne que nos sources se reduisent a deux manuscrits
seulement - le plus ancien d'une lecture pour nous difficile 21 et tous
les deux abondamment fautifs : aucun, pris separement, ne permet
de comprendre le texte contim1ment -, etant donne qu'il s'agit d'une
premiere edition, nous avons voulu que l'apparat critique refiete le
plus fidelement possible cette transmission du texte telle que nous
la dechiffrons.
19
Un exemple : p. 316, 1. 351, Harihara lit sa bhavii.n au lieu de vicaran.
Sa bhavii.n est releve par R. G. Bhandarkar comme la lec;on de son manuscrit
0 (proche des manuscrits du Cachemire de M. Coulson), et par M. Coulson
comme la lec;on de son manuscrit du Cachemire I. Un exemple de lec;on inferee :
p. 159, 1. 49, avacchaditam est presque certainement la glose de pihitam, lec;on
qui n'existe que dans le seul manuscrit I de M. Coulson.
20
Un exemple : p. 35, 11. 688-689, la remarque Ma.Jatfdarsanotthamanma-
thavyathavighnitagate~ svii.vasthii.ip. suhrdo nihnotukii.masya tasya vaco Jalatarp.-
tapa iti ne se comprend aisement que si le personnage qui dit que "le soleil brfile
le front" est Madhava et non Makaranda. Or, toutes les editions attribuent
ces propos a ce dernier. Mais l'apparat critique de M. Coulson appuie notre
interpretation.
21
Elle l'est effectivement comme en temoignent les nombreuses differences
entre la transcription de Calcutta et celle de Pondichery. A l'origine de celles-ci
est, pour une part, un manque de familiarite avec l'ecriture bhujiip.mol.
XIV Le commentaire de Harihara sur le Malatimadhava

Ainsi, quand rien n'y apparait, c'est que les deux manuscrits
donnent une meme lec;on que nous considerons comme satisfaisante.
Quand ils different et que nous acceptons la lec;on de l'un d'eux,
nous mentionnons celle que nous rejetons. Lorsque nous n'acceptons
aucune des deux lec;ons telles quelles, nous donnons, apres la cor-
rection que nous proposons, ces lec;ons que nous n'acceptons pas.
Il en va de meme, aux cas de selection pres, lorsque nous n'avons
plus qu'un seul manuscrit, ainsi lorsqu'une feuille de C manque. Cet
apparat critique enregistre done chaque intervention de l'editeur -
celles-ci sous la forme de ces trois operations : selection, correction
et constatation de l'impossibilite d'etablir le texte 22 - et donne pour
chacune l'etat du texte dans chaque manuscrit, c'est-a-dire tout ce
que nous considerons comme des fautes, fussent-elles mineures ou
evidentes, et tout dommage. Il fournit de ce fait, sous ces deux
angles (du cote des alterations et du cote des interventions), toutes
les donnees a analyser pour parvenir a une vue d'ensemble de l'etat
23
du texte dans ces deux sources et, simultanement, de son edition .
Du cfite des alterations. Ce que nous considerons comme de-
fectueux dans le texte est done represente par les secondes parties
des plus de 4. 700 unites critiques de l'apparat 24 . Leur analyse con-

22 Dans ce dernier cas , deux t t encadrent le passage en question et ii est fait


mention d'un locus desperatus dans l'apparat .
23 Nous avons fait cette analyse cas par cas, une fois cette edition achevee, afin

justement de tenter de prendre cette vue d'ensemble de l'etat du texte dans ces
deux manuscrits et de refiechir sur ce travail d 'edition. Nous ne pouvons, dans
le cadre de cette introduction, nous etendre ni sur !'analyse elle-meme ni sur ses
enseignements. Mais ii faut prevenir le lecteur avant de le mettre en face d'une
synthese par necessite trop simple. Ainsi, la principale difficulte rencontree au
cours de cet exercice, dans la mesure meme ou ii vise a un classement des lec;ons
ecartees, est !'evaluation de leur alteration. La question se pose souvent de savoir
jusqu'ou on a le droit d'identifier sous une forme que l'on estime corrompue ce
que !'on imagine etre la lec;on originale. Le processus de corruption est, en effet,
loin d'etre toujours intelligible, et , correlativement, celui qui permet de retrouver
la bonne lec;on (ou une possible bonne lec;on) est aussi complexe, !'intuition, ou
meme la chance, jouant parfois le premier r6le. Ce qui fait que, dans le cas
present, si, pour une synthese rapide, quelques types d'alterations semblent bien
s'imposer - les trois que nous allons passer en revue - ii existe bien des cas
ambigus qui peuvent appartenir a plus d'un.
24 4.730 quand nous avons procede a cette analyse. Les nombres que nous

citons, sauf les plus petits, sont arrondis, puisqu'apres cette analyse, quelques
rares modifications de presentation, ayant une incidence sur le nombre (et non
sur le contenu) des unites critiques, ont ete apportees.
Introduction xv

duit a distinguer finalement trois sortes d'alterations qui sont les


suivantes, dans un ordre de frequence decroissante.
1. La lec;on rejetee est une forme alteree, identifiable comme
telle, de la lec;on supposee originale 25 . Par cette premiere categorie
sont concernes 683 des unites critiques, dont 653 entierement 26 .
Cette sorte de lec;on se rencontre selon les modalites suivantes, par
ordre d'importance numerique decroissante.
1.1. Pour pres de 783, clans l'un des deux manuscrits, en face de
la bonne lec;on clans l'autre. Cette situation est, heureusement, de
toutes la plus frequemment rencontree par l'editeur (elle represente a
elle seule pres de 533 de !'ensemble des unites). La repartition entre
les deux manuscrits est ici notable en ce qu'elle montre clairement la
meilleure qualite de C, qui est choisi presque deux fois plus souvent
que B 27 .
1.2. Pour plus de 93, dans les deux manuscrits a la fois. lei,
de deux fac;ons : ou cette bonne lec;on est alteree differemment (212
fois), ou elle l'est semblablement dans les deux manuscrits (93 fois).
Cette derniere categorie pourrait retenir l'interet puisque nous avons
ici des fautes identiques clans deux manuscrits tres eloignes l'un de
l'autre. En fait, celles-ci sont, dans !'ensemble, banales, et, pour
certaines, plusieurs fois repetees 28 .

La quasi-totalite des unites concernent ces trois operations dont nous venons
de parler. Ces unites se composent de deux parties. La premiere est formee de
la lec;on adoptee - ou lemme - telle qu'elle appara.it dans le texte edite, suivie de
!'indication de sa source, la seconde, de la (ou des) lec;on rejetee ou de !'indication
de !'alteration (par exemple, omission ou dommage).
25
Compte-tenu des difficultes auxquelles nous venons de faire allusion dans
la note 23 ci-dessus. Identifiable comme telle, grace d'abord, bien entendu, a la
comparaison avec la lec;on de l'autre manuscrit, que celle-ci soit d 'emblee correcte
ou qu'elle soit elle-meme, jusqu'a un certain point , alteree.
26
Pres de 33 des unites critiques appartiennent a la fois a cette categorie et
a la troisieme. Plus precisement, ces 33 sont representes par les cas classes ici
sous 1.4. et par ceux classes sous 3.2. plus bas.
27
Plus de 1.620 fois, C est choisi avec une bonne lec;on immediatement correcte
en face de B qui a la meme, mais corrompue; plus de 870 fois, c'est !'inverse.
28
Exemples : (a) incoherences, ainsi dans le nom propre SaudamanI alias
Saudamiru parfois en C, de meme dans les echanges b/ v et s/s; (b) ce que nous
considerons comme des fautes d'orthographe, ainsi 10 fois un seul t pour deux at-
tendus dans sattva, siittvika, tattva, pattra, chittvii, une faute de sandhi comme
J.i pour /?, contre A VIII, 3, 41, six fois dans des formes ou les particules ini-
tiales iiviJ.i et niJ.i sont suivies d'une gutturale ou d'une labiale sourde; ( c) fau-
xvi Le commentaire de Harihara sur le Malatimadhava

1.3. Pour pres de 9%, dans l'un des deux manuscrits devenu le
seul, l'autre faisant defaut. En fait, pour l'essentiel, en B pour les
parties correspondant aux 10 feuilles manquantes de C.
1.4. Enfin, pour plus de 4%, dans l'un des deux manuscrits, en
face d'une lec;on meconnaissable dans l'autre. Nous retrouvons ce
cas de figure en 3.2. ci-dessous.
C'est avec ce type d'alteration que nous rencontrons la plus large
gamme de fautes, des plus legeres aux plus lourdes 29 .
2. La lec;on rejetee est une variante. Les deux manuscrits presen-
tent des lec;ons differentes mais egalement acceptables, qu'elles soi-
ent immediatement correctes ou qu'elles requierent une correction
evidente 30 . Cette situation represente pres de 19% des unites cri-
tiques. Cela signifie que plus de 890 fois, entre deux lec;ons toutes
tes mineures et bien connues, ainsi a bref pour a et inversement, 1 pour n, etc.;
(d) fautes de grammaire, ainsi des fautes de voix, dont 7 sur 15 pour !'ensemble
du texte sont communes aux deux manuscrits : p. 72, 1. 105 : aparadhyase pour
aparadhyasi; p. 88, 1. 410 : vandami pour vande; p . 92, 1. 481 : prasfdatam pour
prasfdatu; p. 139, 1.10 : paritrahi pour paritrayasva; p. 274, 11. 75-li'6 : dur-
manayantl pour durmanayamana; p. 276 , 11. 111-112 : anubhavi$ye pour anu-
bhavi$yiimi; p . 283, 11. 252-253 : sthasye pour sthasyami; tous ces exemples se
trouvent dans des chaya.
29
Une etude systematique des fautes etant hors de question dans cette in-
troduction, nous nous contentons de quelques exemples. Ainsi, absence ou
presence d'un anusvara (p . 46, 1. 921 : apahrta C pour apahrtarp. B; p . 30, 1. 590 :
sarp. B pour sa C) , consonne simple au lieu de consonne double (p . 19, 1. 366 :
citasya B pour cittasya C) , erreur portant sur une consonne (p. 47, 1. 939 :
abhil~an1ya B pour abhil~a.{lfya C), sur une voyelle (p. 28, 1. 542 : asanni
0 0

0
B pour asanna C), disparition d'une OU de plusieurs syllabes (p. 52, 11.1037-
1038 : carp.drasevanayatta B pour 0 candradisevanayatta C; p. 19, 1. 364 : cit-
tamadanena C pour cittasya sthatum adanena B), fautes de grammaire (p . 43,
1. 851 : bhavati B pour bhavanti C; p. 52, 1. 1032 : tat B pour tarp. C), etc.
Ces fautes simples en engendrent d'autres. On peut parfois imaginer com-
ment. Ainsi, p . 188, 1. 615 , comme explication de pa.{liiyita, B donne parikreta en
face de vikreta (vendeur) en C. Vikreta a dfi etre lu rikreta, l'echange entre
v et r etant frequent, et ri refait en pari. Mais parikreta signifie le con-
traire de vikreta. Fautes lourdes, enfin, qui sont le resultat d'un processus
qu'on ne peut pas completement expliquer et ou la bonne lei;on est a peine
reconnaissable (p. 47, 1. 938 : sudvarp.dvarp. B pour svadutvam C; meme page,
1. 940 : sarp.gocavaidagdhyariipapaya B pour sarp.kocavaimukhyariipaya C). On
remarque la transformation de la lei;on originale, dans sa totalite ou en partie, en
un autre mot, hors de propos. Nous touchons ici a la troisieme sorte d'alteration.
30
Ainsi, pour s'en tenir au seul B, plus de 70 fois une lei;on de ce manuscrit est
acceptable comme variante apres une legere correction. Un exemple, p . 28, 1. 547 :
dhatta iti C : varayati B. 11 s'agit de !'explication grammaticale de mu.{lc;iadharI
Introduction XVll

deux satisfaisantes il a fallu choisir. Ce que nous avons fait en optant


systematiquement pour la lec;on de C. En !'absence d'autre critere
de choix, seul, en effet, reste la necessite d'etre coherent, et notre
choix s'est porte sur C puisque, comme nous venons de le voir, il est
le meilleur manuscrit 31 .
Pour ce qui est de leur nature, ces variantes, quelle que soit
la partie du texte qu'elles concernent (le commentaire proprement
<lit ou le texte commente), se reduisent, dans leur grande majorite,
a des variantes de forme, non de sens, et, toujours, de tres peu
d'etendue 32 . Ce qui fait, qu'au lieu d'imaginer qu'elles soient de
l'auteur lui-meme - ce qu'il serait, de toute fac;on, imprudent de
faire en !'absence d'autres manuscrits - , il est plus raisonnable de
penser qu'elles sont simplement le produit de !'inevitable interven-

B est peut-etre pour dharayati, l'echange de v pour dh est connu (voir p. 8,


1. 142 : vairasya C : dhairasya B; p . 25, 1. 469 : vatayanam C : dhatayanarp. B,
etc.).
31
Cette attitude tres rigide, mais inevitable en !'absence d'autres manuscrits,
nous a certainement fait choisir parfois une mauvaise lei;on. Mais une etude
attentive de toutes les variantes montre que le texte en B est, de ce point de vue
aussi , plus corrompu qu'en C.
32
Exemples. Variantes lexicales : p. 21, 1. 401 : purarp. C : nagararp. B; p. 33,
1. 637 : nirmalayati C : nirdifati B. Variantes morphologiques : p. 30, 1. 589 :
0
vinirmii.{J.e C : 0 nirma.{J.e B (presence ou absence de preverbe sans changement
de sens) ; p. 159, 1. 35 : aisvarya C : fsvaratva 0 B (suffixes differents); p.158,
1. 19 : sarfre C : sarfre B (substantif en face d'un adjectif derive de ce substantif).
Variantes syntaxiques : p. 19, 1. 349 : paraspararp. C : paraspara0 B (probable-
ment a cause de la disparition de l'anusvara); p . 165, 1.157 : snehenardral;i C :
sneharddral;i B. Formulation differente : p. 37, 1. 725 : vivekavara.{J.enajiianena
C : avivekakara.{J.enajiianena B. Nous comptons parmi ces dernieres des omis-
sions (182) et des additions (58) acceptables. Dans le cas de celles-ci , !'absence
ou la presence de la lei;on en question ne nuisent evidemment pas au sens, comme
sont censees le faire les omissions et additions au vrai sens de ces termes, qui,
elles, sont rangees dans le troisieme type d 'alteration ci-dessous. Cela dit, il
arrive aussi qu 'on hesite parfois a ranger telle ou telle d'entre elles dans cette
categorie (celle des variantes) ou dans la suivante ( celle des alterations plus rad-
icales). Ainsi, dans le seul acte I, dix fois pour des mots qui ne figurent pas en B
(p . 10, 1. 175 : va; p. 13, 1. 216: 0 adhikaritva0 ; pp. 18-19, 11. 347-348 : Madfyarp. -
arthal;i; p. 28, 1. 551 : ca; p. 32, 1. 632 : 0 jana0 ; p. 34, 1. 671 : eva; p. 41, 1. 821 :
vyati$ajatlti; p. 47, 1. 945 : yat; p. 48, 1. 952 : tu; p. 60, 1. 1193 : bhavail;i), et
une fois pour un mot ajoute par ce meme manuscrit (p . 23, 1. 446 : api). Dans
tous ces cas, le texte fourni par B est acceptable mais nous avons le sentiment
qu'il s'agit d'omissions vraies, et, une fois, d'addition vraie, en B et que, prob-
ablement, l'absence de la phrase Madfyarp. - arthal;i et de vyati$ajatlti sont des
lacunes dont le copiste de ce meme manuscrit est responsable.
XVlll Le commentaire de Harihara sur le Malatimadhava

tion des copistes, consciente ou non, et, parfois, des utilisateurs des
manuscrits.
Maintenant, la repartition de ces variantes entre les deux parties
dont se compose le texte, est un peu moins des trois quarts pour
le commentaire proprement <lit et un peu plus d'un quart pour ce
qui apparait de !'oeuvre de Bhavabhuti. Les premieres n'appellent
pas de remarque supplementaire. Pour les secondes, nous avons
le temoignage des apparats des editions critiques de la piece. Il
est done legitime de chercher a savoir ce qui, parmi nos variantes,
se retrouve des lec;ons du MM qui y sont recensees, et ce qu'il en
advient dans la preserite edition, etant donne ce choix systematique
que nous avons fait des lec;ons de C.
Mais repondre a ces questions implique d'abord que l'on Sache
comment le texte de la piece transparait dans le commentaire. Il
s'y montre sous deux formes : pour les parties prakrites, sous celle
de chaya, qui sont !'oeuvre de H. (H. ne cite que 87 fois des mots
prakrits, voir ci-dessous p. xxiii), et, pour les parties sanskrites, le
plus souvent sous celle de citations. Mais, d'une part, les chaya sont
loin de toujours permettre d'imaginer clairement le texte prakrit ori-
ginal, d'autant plus qu'il arrive au commentateur de ne pas fournir
!'equivalent grammatical sanskrit de cet original, meme s'il existe
bien et si son sens est acceptable. D'autre part, quand il en ex-
plique les parties sanskrites, H., souvent, ne reprend pas le texte
de la piece, mais lui substitue directement son explication. Comme
dans le cas des chaya, !'original se cache alors sous sa glose. Il faut
done etre prudent. Une lec;on qui concerne le texte commente n'est
pas necessairement une lec;on de ce texte sous sa forme originale. Ce
peut etre une glose. Et il en va de meme d'une variante 33 .
Cette precision apportee, 228 fois nous nous sommes trouve
33
Une consequence de cette distance plus ou moins grande entre ces lec;ons
touchant le texte commente et celui-ci, est qu'une lec;on concurrente est recevable,
meme si elle apparait comme une glose, plus eloignee du texte commente que ne
!'est, eventuellement, l'autre lec;on. Parmi Jes exemples pour Jes chaya, on peut
citer ceux ou Jes deux lec;ons concurrentes ne peuvent representer qu'un seul et
meme original pkt, ainsi, p. 21, I. 407, Madhavaya de B en face de Madhavasya
de C, le datif etant ici une glose du genitif, qui, seul, existe en pkt. Parmi Jes
exemples pour Jes parties sanskrites, ceux ou sont en concurrence une lec;on du
MM deja connue et une lec;on qui ne peut etre qu'une glose parce qu'elle ne
convient pas au metre, ainsi, p. 25, I. 476 : aigair de Ben face d 'arigakair de C;
p. 64, I. 1277 : saisprsa de B en face de spr8a de C, etc.
Introduction XIX

devant deux lec;ons egalement acceptables, 195 fois dans une cl1aya,
33 fois dans !'explication d'une partie sanskrite. La repartition entre
les deux manuscrits, de ces lec;ons en variantes connues (par les edi-
tions critiques) et en variantes qui ne le sont pas, est comme suit.
(a) C et B offrent concurremment deux variantes connues : 137
fois; (b) C offre une variante connue en face d'une variante inconnue
en B : 64 fois; (c) B offre une variante connue en face d'une vari-
ante inconnue en C : 18 fois; (d) les deux manuscrits offrent deux
variantes toutes deux inconnues des apparats critiques : 9 fois seule-
ment34. Rappelons que dans tous ces cas, C a ete choisi par souci
de coherence 35 .
Un examen de ces variantes montre, comme nous l'avons <lit,
qu'elles ne sont pas differentes des autres concernant le commentaire
proprement dit 36 . Il doit done s'agir de fautes. De simples fautes
pour beaucoup, mais qui aboutissent a un sens acceptable37 . D'aut-
res doivent etre le produit de substitutions, de substitutions reussies,
un phenomene prouve justement par ses echecs : substitutions mal
executees, que nous rangeons dans la categorie d'alterations suivante.
S'il en est bien ainsi, et une comparaison avec les apparats critiques
des deux pieces, en particulier celui de M. C., le montre, nous ret-
rouvons ici ces inevitables legeres modifications du texte, qui sont
le fait de la transmission manuscrite.
3. Dans la troisieme categorie, ce que nous considerons comme
la bonne lec;on n'est pas identifiable dans ce qu'offre le (ou les)
manuscrit (et que nous rejetons). Nous regroupons ici (a) des formes
lisibles, meconnaissables ou reconnaissables en elles-memes mais, en
ce dernier cas, hors de propos, (b) des lec;ons illisibles ou mutilees par
34
Ce sont : 0 saisayam me C : saisayam eva B (p. 152, I. 266); uccaladbhi~1
C : uchaladbhi~ B (pour ucchaladbl1iM (p . 173, 11. 310-311); 0 nirmita0 om. B
(p. 211, I. 303); etayor C : tayor B (p. 245, I. 307); kii mamaitavad asaisata
ego : kiimamaetavadasaisat C kimatfyanmatramasvasayatamai B (pour kim
itlyan ... ?) (p. 265, I. 687); 0 vikasi C : vika8ita B (p. 289, I. 364); navadarsana-
gu~anuragabhyam ego : navadarsarambha~anuragabhyam C om. B (p. 291,
I. 418); vijiiapayami C : kathayami B (p. 292, I. 420); vibhavitani C : niriipitani
B (p. 296, I. 505).
35
Ces derniers chiffres tendent a montrer, encore une fois, que C est meilleur
que B. C offre, on le voit, 201 lec;ons connues et 27 lec;ons inconnues, alors que
B offre, Jui, 155 lec;ons connues et 73 lec;ons inconnues.
36
Elles portent sur un seul mot, a !'exception de 9 d'entre elles, et, a de rares
exceptions pres, sont de meme sens.
37
Voir Jes exemples que nous donnons a la fin de la note 32 ci-dessus.
xx Le commentaire de Harihara sur le Malatimadhava

suite de deteriorations des manuscrits, (c) des omissions et des addi-


tions au sens strict, c'est-a-dire inacceptables 38 . Dans les omissions
nous incluons les lacunes, qu'elles soient indiquees par le copiste ou
supposees par nous-meme 39 . Cette troisieme categorie represente
un peu moins de 16% des unites critiques 40 .
Ce type d'alteration se rencontre selon les modalites suivantes,
par ordre d'importance numerique decroissante.
3.1. Pour plus de 75%, clans l'un des deux manuscrits, en face de
la bonne lec;on clans l'autre. Comme ci-dessus en 1.1. , la repartition
entre les deux manuscrits montre clairement la meilleure qualite de
c41.

3.2. Pour plus de 183, clans l'un des deux manuscrits, en face,
clans l'autre, de la bonne lec;on alteree mais reconnaissable. Il s'agit
de la situation 1.4. ci-dessus.
38
Exemples. (a) p . 10, 1. 179 : kaip.kati B pour kathakalapam iti C; p. 14, 1. 251 :
saip.bhavana:rp.nacatmana:rp.natmanam C pour 0 saip.bhaviid atmanam B; p. 63,
0
1. 1263 : akulita:rp.raktaip. C pour 0 abjanibha:rp. vaktra:rp. B . Par "hors de propos"
nous entendons essentiellement des variantes dans les citations du MM, variantes
identifiables grace aux editions critiques de la piece mais qui ne conviennent
pas au vu du commentaire (ainsi p. 19 , 1. 361 : la le~on de C, cittiivakfiepal}. ,
est confirmee par le commentaire; la le~on de B, cittavikf?epal}., est , elle, une
variante bien connue et, d'ailleurs, citee comme telle par H. lui-meme) . Nous
avons identifie un total de 29 de ces variantes dans !'ensemble du texte. Leur
repartition entre les deux manuscrits est de 25 en B et de 4 en C, ce qui montre
encore une fois la moindre qualite de B. Remarquons, d'autre part , que ces
variantes ne portent que sur un mot , et que, dans tous ces cas, leur substitution
a ete parfaitement realisee. Un cas OU elle ne l'a pas ete - et il s'agit de plus d 'un
mot - est, sans doute, p. 84, 1. 342, ou, en face de C : ef?a bhagavatl Kamandaki,
B presente : ef?ii bhagavatT e$ii idanf:rp. bhagavatf Kiimandakl (les deux le~ons
connues par les apparats critiques etant ef?ii bhagavatl K. et e$ii idam:rp. bhagavatf
K. (b) difficulte de lecture : p. 9, 1.155 : ?sva?svar?ga?IJa?k$ii?nam C pour
0
sa:rp.valganam B. C, d 'autre part, n 'est pas en hon etat. Nombre de feuilles sont
abimees. Ces dommages sont representes dans l'apparat par le signe * (un seul,
quel que soit le nombre de syllabes concernees) . Pour le seul acte I, les parties
endommagees sont au nombre de 39. Elles vont d'une syllabe a 17, autant qu'on
puisse en juger par le texte conserve en B. (c) 242 omissions et 46 additions.
39
Les lacunes indiquees par les copistes - en fait, par celui de B seulement -
sont au nombre de 30. Mais, sur ces 30, pres de la moitie (14) sont d'une ou de
deux syllabes. Voir la note 67 ci-dessous.
40
Y compris les cas classes ci-dessous sous 3.2., et qui sont communs a la lre
categorie (modalite 1.4.). Voir la note 26 ci-dessus. Y compris aussi les 12 locj
desperati.
41
C est choisi en face de B 338 fois et B 219 fois en face de C.
Introduction xxi

3.3. Pour pres de 5%, clans l'un des deux manuscrits devenu le
seul, l'autre faisant defaut 42 .
3.4. Pour pres de 2%, clans les deux manuscrits a la fois 43 .
Telles sont trois sortes d'alterations et leur distribution. Pour
completer cette vue d'ensemble, plac;ons-nous brievement du point
de vue des interventions de l'editeur.
Du c6te des interventions : selections, corrections, loci
desperati. Les decisions de l'editeur se resument a ces trois opera-
tions, elles, immediatement visibles, qui sont, toujours par ordre
de frequence decroissante, la selection d'une lec;on acceptable telle
quelle en face d'une forme alteree, la correction du texte quand une
selection n'est pas possible, enfin la constatation de l'impossibilite
d'etablir le texte (deux t t encadrent alors le passage en question et
il est fait mention d'un locus desperatus clans l'apparat) . .
Les cas de selection, au nombre de plus de 3.890, constituent plus
de 82% des unites critiques. Leur repartition, en face des trois sortes
d'alterations qui viennent d'etre evoquees, est de 64% (modalite
1.1.), 22% et 14% (modalite 3.1.), respectivement.
Les corrections, avec plus de 820 cas, representent un peu plus de
17% des unites critiques. Trois sortes de lec;ons, .correspondant aux
trois sortes d'alterations, sont objets de correction. (a) Ce que nous
supposons etre la bonne lec;on, alteree mais encore identifiable. Pres
de 88% des corrections portent sur cette premiere sorte de lec;on.
Cette categorie, correspondant a la premiere sorte d'alteration, est
constituee des modalites definies ci-dessus : 1.2., pour plus de 37%
(avec ses subdivisions: 1.2.1., pour pres de 26%, et 1.2.2., pour plus
de 11%),1.3., pour plus de 34%, et 1.4., pour plus de 16%44 . (b) Une
bonne lec;on possible, alteree mais encore identifiable, est corrigee.
42
Soit quelques 36 cas. Nous n'avons plus qu'un manuscrit, parce que, comme
en 1.3. ci-dessus, c'est une feuille de C qui manque, ou, quatre fois, parce que
B fait defaut du fait d'une lacune. Les alterations sont, elles, des deformations
(26 cas), des omissions (7 cas), des deteriorations (2 cas) et une "variante hors
de propos" (sandharyate de C, p . 110, 1. 181).
43
Soit 12 cas. Pour sept d'entre eux, nous nous trouvons, comme precedem-
ment en 1.3., devant une alteration identique, ou quasiment identique, dans les
deux manuscrits . Pour des exemples appartenant a cette modalite, voir la note
46 ci-dessous.
44
Rappelons qu'en 1.3. nous n'avons plus qu'un seul manuscrit et que celui-ci
est le tres souvent fautif B. Le nombre des corrections est eleve pour l'etendue
de texte concerne (!'equivalent de 10 feuilles de C, sur un total probable de 92
xxu Le commentaire de Harihara sur le Malatimadhava

Nous sommes ici dans la categorie des variantes. Plus de 63 des


corrections appartiennent a cette categorie. Il s'agit des cas ou la
ler:;on de C a ete choisie apres une correction allant de soi, devant
une ler:;on de B egalement acceptable. (c) La troisieme sorte de ler:;on
corrigee est celle ou la bonne ler:;on n'est pas identifiable. C'est la
troisieme categorie d 'alterations qui est ici concernee. Pres de 63
des corrections en font partie avec les modalites definies ci-dessus :
3.3., pour plus de 43, et 3.4., pour moins de 23, respectivement .
L'apparat critique enregistre toutes les corrections, des plus lege-
res45 aux plus lourdes, des plus evidentes aux plus incertaines 46. Ces
dernieres n'y sont pas nommees pour ce qu'elles sont, c'est-a-dire
des conjectures. Nous n 'utilisons, en effet, que la mention ego pour
designer une correction quelle qu'elle soit. Mais nous donnons une
note pour les conjectures qui nous ont paru meriter une explication.
Les loci desperati sont, en definitive, bien moins nombreux que
l'etat de nos sources pouvait le faire craindre. Ils ne sont finalement
que 12 (0,253 des unites critiques) et tous de faible etendue47. Huit
sont lies a la disparition d'une feuille de C. Le cas extreme ou C
pour ce dernier), parce qu 'il inclut tous les cas ou C aurait ete choisi en face
d 'une faute de B.
45
Parmi celles-ci, les corrections de ces incoherences , fautes d 'orthographe,
fautes de sandhi que nous avons mentionnees plus haut . 11 est probable que
certaines d 'entre elles, aujourd'hui considerees comme des fautes , ne l'ont pas
toujours ete. Mais, dans !'incertitude ou nous nous trouvons , il nous semble que
nous devons proposer ces corrections.
46
Ainsi , pour prendre des exemples appartenant a la derniere categorie men-
tionnee (3.4 .), p . 144, I. 96, madha de C et madhaval;i de B sont a corriger evidem-
ment en miilatT, de meme, p. 258, I. 557, vadhyamana de C et de B est a corriger
0
en sazdanyamana comme l'exige le commentaire qui suit. Dans ces deux cas ,
la bonne le<;on n'est pas identifiable, mais la correction est obvie. A elite de cela,
dans cette meme categorie, figurent quelques conjectures. Ainsi, p . 108, 11. 148-
149 : caii.carTkanikaraI_Jam en face de * raI_Jaz de C et de ca de B, ou encore,
0
p. 307, I. 154 : pravartibhis ca vyathaya en face de pravrttibhis ca de C et de
parivarttibhiryatha de B. Au titre, enfin , des corrections incertaines. Toujours
dans cette meme categorie, ne valait-il pas mieux laisser tel quel, par deux fois,
ce que nous avons corrige? Page 245 , 1. 304, contre les deux manuscrits, nous
ajoutons Kiz ca dans la chaya parce que cette locution fait certainement partie
du texte prAkrit, done de la chaya, puisque le commentateur vient de l'expliquer
par anticipation. Mais justement, le fait de l'avoir deja expliquee l'a peut-etre
amene a ne pas la reprendre. Un autre exemple, p . 311, I. 241 , ou nous com-
pletons la citation. L'auteur peut tres bien n'en avoir donne que le debut meme
s'il faut qu'elle soit complete pour illustrer ce qu'il veut dire.
47
Dans l'ordre du texte, p . 44, II. 875-876 : 21 syllabes; p. 46, 11. 907-908 : 37
Introduction xxm

manque et en meme temps existe en B une lacune (indiquee par le


copiste) , se presente deux fois 48 . Dans les quatre autres cas ou les
deux manuscrits existent bien, le texte nous est incomprehensible 49 .
Telle est une vue d'ensemble des situations devant lesquelles nous
nous sommes trouve en editant ce texte a partir de ces deux sources.
Rapide et prise de haut, elle laisse necessairement dans l'ombre bien
des problemes particuliers rencontres au cours de ce travail. Nous
terminerons ces remarques en evoquant l'un d'eux, qui est celui de
la citation des mots prakrits.
Les citations de mots prAkrits
Harihara cite 87 fois des mots prakrits 50 . Tous appartiennent a
la piece. Ces citations, sauf cinq qui comptent entre deux et cinq
termes, se reduisent a un seul mot 51 . Ce sont, pour une part, 19
variantes que le commentateur releve et qu'il cite comme il le fait des
variantes sanskrites. Ce sont, ensuite et pour l'essentiel, des mots
sur la forme ou, bien plus souvent, sur le sens desquels il souhaite
attirer !'attention. Onze d'entre eux sont presentes comme etant
desf> 2 . Les autres ne sont pas autrement qualifies (meme s'il s'y
trouve des mots def selon les grammairiens et les lexicographes).
Les differentes categories grammaticales sont representees : formes
invariables ou flechies, celles-ci verbales ou nominales.
Harihara introduit ces mots dans son texte de deux far:;ons. Soit
directement , sans interposition de iti, soit en les faisant suivre de
syllabes; p. 47, 11. 942-943 : 20 syllabes; p . 54, 11.1084-1085 : plus de 28 syllabes;
p. 121, I. 400 : 4 syllabes; p . 171 , 11. 264-265 : 17 syllabes; p . 176, I. 372 : 3
syllabes; p . 178, II. 401-402 : 8 syllabes; p. 221, I. 503 : 4 syllabes; p . 351, I. 292 :
un nombre de syllabes indetermine; p. 352, I. 296 : 7 syllabes; p. 356, 11. 378-379 :
16 syllabes.
48
p. 54, 11. 1084-1085 et p . 351, I. 292 . En revanche, p . 55 , 1.1091, la lacune
indiquee en B, qui seul existe en cet endroit, semble pouvoir etre comblee. Voir
la note 88 a l'acte I.
49
Mais pour deux d 'entre eux, p . 121, I. 400 et p. 178, 11. 401-402 , on peut
proposer des conjectures. Voir les notes donnees a ce propos.
5
Ces citations sont rassemblees dans !'index I, pp. 453-459. Nous y renvoyons
pour les references des mots prAkrits que nous citons dans le texte et Jes notes
de cette partie. Six fois , un meme mot est cite a deux reprises : ammaka- ,
uvvaranta-, kandotta- , parakkaa-, balamo{li- .
51
Qui peut etre un tres long compose, ainsi paaI_J<Ja0 0 I_Jivaho, p. 133, 11. 656-
658.
52
Ce sont : ammaka-, uralli-, oaggia-, orampa-, kumilayanta-, galluraI_Ja-,
cama<Jhia-, theva-, parakkaa-, balamo<Ji-, sazdabbha-.
xxiv Le commentaire de Harihara sur le Malatimadhava

cette particule. Ceci, ou bien clans une unite syntaxique indepen-


dante, souvent minimale, c'est-a-dire reduite au mot prakrit suivi de
sa traduction-explication. En general, clans une unite de ce genre,
le mot est pose au nominatif singulier, et au neutre s'il s'agit d'un
3
adjectif5 . Ou bien le mot prakrit est integre, normalement suivi
de sa glose, au sein d'une unite syntaxique plus grande et plus com-
plexe, par exemple, clans !'analyse d'un long compose 54 . Il doit alors
prendre le cas voulu par sa fonction clans cet ensemble dont il n'est
qu'un element. lei, le commentateur n'utilise jamais iti, alors qu'il
le fait, ou non, clans la situation precedente, c'est-a-dire clans ces
unites independantes, souvent minimales.
Cela pose, on observe que tous ces mots prakrits, proportion-
nellement plus souvent que les mots sanskrits, ont subi des defor-
mations importantes, et clans les deux manuscrits. Ainsi, deja clans
C, il est visible que le copiste, pourtant professionnel, a eu du mal
avec ces mots. A plusieurs reprises il efface ce qu'il vient d'ecrire
et reecrit autre chose qui doit lui sembler meilleur. Mais qui peut
etre tout de meme aberrant 55 . Comme on s'y attend, la situation
est semblable, sinon pire, en B56 . Nous avons corrige ces fautes .
Certaines de ces corrections sont expliquees en note.
Mais la question de savoir sous quelle forme exacte ces mots ont
ete cites a l'origine continue de se poser et c'est la raison meme de
ces remarques ici. Plus troublantes, en effet, que les deformations
que nous venons d'evoquer, sont des transformations de finales: des
finales prakrites attendues peuvent apparaitre comme sanskrites.
Cette question nous a arrete plus longtemps et son examen nous
a finalement conduit a adopter une attitude prudente. Certes, sous
un certain angle, on peut voir la quelques-unes de ces "sanskriti-
sations" qui sont a prendre comme les autres alterations, done,
comme des fautes, et a mettre au compte de scribes qui, ne recon-
naissant pas les mots qu'ils copiaient, ont essaye de leur donner une
apparence sanskrite. Ces "sanskritisations" touchent, en effet, une
partie du mot, n'importe laquelle, ou sa totalite, et s'accompagnent
53
Exemples : pour des substantifs : / itthT : strT/ , / ummaccham itTr[jya/;
pour des adjectifs : / aliddhaip : iiSlifitam/; parfois, le contexte fait sentir son
influence : cas des adjectifs J,lijjhavida, dumavida et, sans doute, viat;lo.
54
Ainsi uvvarantau, oalla, parakkaaip, vit;lurillaip, etc.
55
Asveslti pour akkhesTti, a?sri?taip ou agnibhaip pour oaggiaip , etc.
56
Kheta pour theva, ?miiJ,liip ?kha pour maJ,liaip, etc.
Introduction xxv

parfois d'autres deformations 57 . Les transformations de finales sur


lesquelles nous attirons !'attention ne sont peut-etre qu'un aspect
de ce phenomene. Mais une apparente rationalite clans leur mani-
festation et, en meme temps, !'existence de facteurs qui limitent,
ou meme empechent, une vue claire de la forme originale de ces
citations, incitent a la prudence.
Ces obstacles sont d'abord !'absence de regles, OU meme de re-
marques, chez les grammairiens prakrits. Ceux-ci ne se preoccupent
pas de la fac;on de citer des mots prakrits clans un contexte sanskrit.
Le sandhi dont ils traitent ne concerne que les mots prakrits, a
l'interieur d'eux-memes ou entre eux. A partir de ce sandhi, s'il
est permis d'extrapoler, on peut supposer un usage qui serait de
laisser toute voyelle finale prakrite en hiatus devant toute voyelle
initiale sanskrite et, pour ce qui est d'une finale consonantique, de
n'avoir jamais qu'un anusvara. Deux autres obstacles sont le carac-
tere erratique de la ponctuation et la presence du sandhi sanskrit.
La premiere, qui a peut-etre, entre autres, servi a isoler de leur
entourage les mots expliques (un peu a la maniere de nos guille-
mets), est , malheureusement devenue trop irrationnelle clans les
deux manuscrits 58 . Quant au sandhi (sanskrit), on s'attendrait,
comme on vient de le dire, a ce qu'il ne soit pas fait. Mais, d'une
part, la situation ideale que nous venons d'envisager n'est pas sans
creer d'ambigultes: par exemple, un -rp devant consonne peut aussi
bien etre dil au sandhi sanskrit. D'autre part, on rencontre des cas
de sandhi effectivement et systematiquement fait 59 . Done; en face
de cas ou l'on a bien affaire a une finale prakrite intacte (ex. : cit-
tavikkhevo iti pathe ... ), on a toute une serie de cas ambigus, et, en-
fin, des exemples de finales sanskrites (ex. : ... parrikkal;i siinyal;i ... ),
que, pour une part, on peut evidemment interpreter comme de
possibles "doubles sandhP' ( un original pai'rikko siinyal;i ayant ete
57
Exemples : di:imeti (C) et tvamoti (B) pour diimedi; sarfraraaJ,laip
(C) et sarfrarakfia1Jaip (B) pour sarfraraaJ,laip (c'est-a-dire sarfraratnam);
tu/ aJJaapas.rtal,i (C) et tiir1Japasrtal,i (B) pour oaJJa : apasrtaJ.i; lajjavita (B)
pour J,lijjhavida, etc.
58
Par exemple, dans la sequence mot cite-glose, il arrive que chacune de ces
deux parties soit encadree de daJ,1t;la en C ou de points en B (ceux-ci sont-ils des
signes de ponctuation equivalents?), mais il arrive aussi bien qu'elles ne le soient
pas et qu 'entre elles un sandhi (sanskrit) soit fait ... ou non. Les cas abondent
de ponctuations qui ne repondent plus a rien .
59
Ainsi, systematiquement entre deux i, type : akkheslti pathe, etc.
XXVl Le commentaire de Harihara sur le Malatimadhava

a tort corrige en pairikkal}. silnyal}., comme probablement l'a ete


duvvasamalanga iti pour un duvvasamalango iti original), mais pas
toujours comme le montre hrdaye, bhrtau : pu$tau, uvvarantau :
amantau, yau vismayanandau. 11 est done difficile de nier l'existence
d'une "sanskritisation" des finales, d'autant plus, et c'est la rationa-
lite dont nous parlions, qu'elle se rencontre davantage clans le second
type de contexte ou ces mots prakrits, cites sans iti, doivent, avec
leurs gloses sanskrites avec lesquelles ils forment un tout, etre au cas
voulu par leur fonction clans ces phrases plutot longues. Dans ces
conditions, nous avons choisi de reproduire scrupuleusement, sans
permettre a notre ponctuation de les modifier, les finales des le~ons
des manuscrits, conservant ou choisissant les finales prakrites, mais
conservant aussi, quand ils se rencontrent clans les deux manuscrits,
les cas de sandhi (sanskrit) et de finales sanskritisees ..
On s'est aper~u que cette question est celle, toujours d'actualite,
de la citation de mots d'une langue differente de celle du contexte ou
ils sont introduits. Comme on le sait, les possibilites sont multiples
et les choix ont varie au cours des temps.

Note sur la presente edition


Le texte de la piece
Ce genre de commentaire ne peut se comprendre que si l'on a
le texte qu'il explique sous les yeux. 11 etait done necessaire de
l'accompagner du texte du Malatfmadhava. Pour ce faire, nous
avons choisi celui qu'etablit Ramkrishna Gopal Bhandarkar, tel qu'il
figure clans sa derniere edition de 1970. Nous y avons apporte
quelques corrections et quelques modifications. Celles-ci font l'objet
d'une liste qui vient immediatement a sa suite (pp. 363 a 369). Nous
n'avons pas retenu le texte etabli plus recemment, en fait un siecle
plus tard, par Michael Coulson, notamment parce qu'il aurait fallu
en modifier par trop la forme, celle-ci significative, pour le rendre
en ecriture devanagarf.
Le texte du Malatfmadhava qu'explique Harihara n'est evidem-
ment pas tout a fait le meme que celui propose par R. G. Bhandarkar.
Pour autant qu'on puisse le voir 60 . L'appendice I (pp. 425 a 447)
fournit la liste des differences que nous avons pu relever entre le texte
60
Voir ci-dessus p. xviii. Il est done impossible de reconstruire dans sa totalite
Introduction xx vii

tel que l'a edite R.G. Bhandarkar et celui que nous apercevons au
travers du commentaire.

Le texte du commentaire
Nous venons de dire que cette sorte de commentaire, qui ressemble
beaucoup a des notes, est, de ce fait, inseparable du texte qu'il ex-
plique. Mais, dans les manuscrits, il est consigne seul et d'un seul
tenant. Les uniques reperes sont, de temps a autre, des pratfka -
dont c'est la la fonction -, la mention des noms des personnages
parlant prakrit, avant la traduction en sanskrit de leurs propos, et
l'indication de la fin des actes. Nous avons done ajuste le commen-
taire au texte de la piece, en attribuant a chaque replique ce qui
lui revient, ou a chaque partie de replique clans le cas de propos
trop longs, par exemple clans le cas des longues tirades en prakrit,
tirades que Harihara, d'ailleurs, avait lui-meme divisees 61 . Nous
avons ajoute, entre crochets droits, les noms des personnages qui
parlent sanskrit et les numeros des vers, a la fin, mais aussi au
debut de leur explication.
Etant donne qu'il s'agit d'une premiere edition, et pour ne pas
nous couper des lecteurs indiens, nous avons choisi de presenter en
ecriture devanagarf le texte du commentaire (et, par la meme, celui
de la piece). Ce choix nous a conduit a suivre certaines habitudes qui
vont de pair avec l'usage de cette ecriture, notamment a appliquer
le sandhi, meme s'il est optionnel entre les mots d'une phrase 62 .

le texte du MM tel que le lisait Harihara. Cette remarque pour repondre a un


souhait plusieurs fois exprime, ainsi par R. Sinclair dans sa preface a !'edition
de M. Coulson : "A proper critical edition of Harihara's commentary (with a
reconstruction of his text of the play) remains a desideratum .. .''.
61
Voir, par exemple, en III, 12/13, dans la longue tirade de Lavangika, ou
nous avons decoupe en trois parties ce qui n'en fait qu'une pour H., et qui va de
Bhagavaty evaip.viidinTty iikhyiiyate (p. 118, 1. 350) a 0 saip.fayitakaumarabhava
bhavati (p. 122, 1. 426), etc.
62
Voir la kiirikii citee dans la Siddhiintakaumudi a propos de 2232 ( A VIII,
4, 18) : Saip.hitaikapade nityii nityii dhatiipasargayoJ;i / nityii samase viikye tu
sa vivak$iim apek$ate //. On pourrait done ne pas l'appliquer du tout, ce qui
faciliterait grandement la lecture et la comprehension du texte, surtout quand on
sait qu'il est de tradition, lorsqu'on use de l'ecriture devanagarf, de lier dans la
graphie les mots lies dans la prononciation. Nous avions essaye de ne pas suivre ce
dernier aspect de la tradition, mais nos lecteurs nous ont convaincu d'y renoncer.
Il reste, cependant, quelques traces de cette tentative dans cette edition. Pour ce
qui est de !'application du sandhi, nous avons, mais certainement insuffisamment,
XXVlll Le commentaire de Harihara sur le Malatimadhava

Malgre les inconvenients de cette pratique, qui rend tres malaise


l'emploi de notre ponctuation, nous n'avons pas pour autant renonce
completement a celle-ci. Ainsi, nous utilisons la virgule, mais a
deux fins seulement, d'abord pour isoler l'unite que forment le mot
glose et sa glose, ensuite pour souligner, quand cela est possible,
!'expression d'une cause63 . Le point-virgule nous sert a marquer la
fin d'une explication au nominatif clans le cadre de !'analyse d'un
mot compose 64 ; nous avons, enfin, recours au tiret (long) (- ) pour
isoler une explication a l'interieur d 'une explication65 . Ce sont la
les seuls signes de ponctuation empruntes a l'ecriture latine, dont
nous usons. Nous n'employons ni le point d'interrogation ni le point
d'exclamation. Nous evitons les deux-points (:), parce qu'ils peuvent
etre facilement confondus avec le visarga. A sa place, nous utilisons
le signe (=) entre un mot (ou plusieurs mots) et son explication.
Nous n'utilisons pas non plus le point, parce qu'il n'est pas suffi-
samment visible clans l'ecriture devanagarf. Dans ses usages, nous
nous servons du da:c:u;la.
Nous isolons les chaya au moyen de crochets doubles ( )places
avant et apres elles.
Nous ponctuons les citations de la fa<;on suivante. Si la citation
est en vers, et de quatre pada, nous la ponctuons comme un vers,
avec un da:c;u;la a la fin de l'hemistiche et deux a la fin du vers; si
elle est de deux pada seulement, nous ponctuons d'un seul dal}<;la
final; si elle est d'un seul pada, nous ne mettons aucun signe de

renonce a l'appliquer quand la clarte l'exigeait. En fait , autant qu'on puisse le


voir dans nos manuscrits - mais nous n'en avons pas fait une etude en regle - il
semble bien que le sandhi n 'ait pas ete systematiquement applique . Et ainsi font
encore aujourd'hui certains editeurs "traditionnels". D 'apres eux, il convient
d 'appliquer le sandhi, sauf lorsque l'on fait une pause dans l'enonciation. Ce
qui signifie qu'on pourrait utiliser cette pratique pour souligner des articulations
syntaxiques, comme on le fait a l'aide de nos signes de ponctuation.
63
Exemple, p . 3, 1. 35 : Bhiitesasya sirasi keyarp. ketaka5ikhasankety abhidhane
'naucitfcintanam acittasyaiva, anaucityasyaiva sarp.dehanidanatvat.
Exemple, Jatiikan;iagotre prasiita : JatiikarIJ.f; tasyal;i putr~ (p. 12, 1. 212) .
64

Autre exemple, Ucchvasitani : phullani, yani kusumani; te$iirp. ye, kesaral;i :


kiiijalkani padmakarIJ.ikave$tanaprayliIJ.i; te$iirp. rasat~ k~ay~ sparsat~ Sftalo
ya amodal;i; tena vasitam udyanarp. y ena (p. 36, ll. 709-711) . Comme on le voit,
le mot explique au nominatif est, ensuite, repris par l'anaphorique au cas voulu
par sa relation avec le terme suivant.
65
Exemple, dans !'explication de mar$a (p. 6, 1. 110) : SiitradhareIJ.a niyujya-
manal;i sarvarp. sahate - taduktarp. nirvahayati - iti mar$aIJ.at mlir$al;i.
Introduction XXIX

ponctuation a la fin de la citation en question. Si la citation est en


prose, par exemple un siitra, nous ne ponctuons pas.
Pour en revenir au sandhi, par souci de coherence nous avons
choisi, clans le cas du parasavarl}adesasandhi concerne par A VIII, 4,
59, l'anusvara et non la nasale de meme point d'articulation que celui
de !'occlusive qui suit. Ainsi ala:cpkara et non alankara, sa:cpbandha
et non sambandha, ki:cp tavat et non kin tavat. Dans le meme souci,
nous avons choisi pour ce qui est du visargasandhi, dont il est traite
en A VIII, 3, 36, !'assimilation et non le visarga. Ainsi nissaha et
non ni};lsaha. Mais seulement clans un mot apres un prefixe, non
entre deux mots.
Nous observons, par ailleurs, la pratique moderne courante de ne
pas redoubler une consonne apres r : nous ecrivons uparyalindakam,
et non uparyyalindakam comme c'est, en general, le cas clans nos
manuscrits 66 . Nous avons, enfin, choisi v en face de b clans le cas de
l'alternance du type vakula/ bakula.

L'apparat critique
Nous suivons, clans !'ensemble, les principes enonces clans les
deux fascicules intitules Regles et recommandations pour Jes editions
critiques de Jacques Andre et de Jean Irigoin.
Notre apparat est done toujours positif. Le lemme y est de la
forme qu'il a clans le texte edite, avec !'indication de la source qui le
donne ou, si c'est une correction, de la mention ego. Nous n'avons
pas juge utile d'indiquer la forme exacte qu'ont ces lemmes clans les
manuscrits (aussi longtemps, bien sfir, qu'elle n'est pas incorrecte).
En revanche, les le<;ons rejetees sont donnees telles qu'elles figurent
clans les manuscrits.
Nous avons, pour autant que les contraintes de l'ecriture devana-
garl le permettent, evite de donner des unites qui ne soient pas
signifiantes. Nous avons meme, parfois, donne plus que strictement
necessaire pour faciliter le reperage de la partie concernee, par exem-
ple clans une longue sequence de lettres.
Dans le cas des corrections, autant qu'il est possible, nous don-
nons immediatement apres la forme corrigee la forme dont elle est
la correction. Quand ce n'est pas possible, lorsque la forme corrigee
66
Redoublement optionnel selon A VIII, 4, 46 .
xxx Le commentaire de Harihara sur le Malatimadhava

peut etre vue comme la correction de l'une aussi bien que de l'autre
forme, nous donnons d'abord la lec;on de C et ensuite celle de B.
Le signe * represente une ou plusieurs syllabes, soit manquantes
a cause d'une deterioration du manuscrit, soit illisibles.
Un point d'interrogation devant une syllabe indique que sa lec-
ture est douteuse. Un point d'interrogation devant une syllabe, le
tout entre parentheses rondes, indique une autre lecture possible de
la syllabe precedente.
Nous signalons les lacunes que montre le copiste de B - le co-
piste de C n'en montre pas - par la mention om. B in lac., ou par
!'indication de la longueur du blanc laisse par le copiste 67 .

Appendices
La derniere partie de cet ouvrage comprend :
a) une liste des corrections et des modifications apportees dans
sa presente reproduction a !'edition du Malatimadhava par R. G.
Bhandarkar (pp. 365-371).
b) Des notes. Dans le texte du commentaire, les chiffres entre
parentheses et figurant en fin de phrase, apres la ponctuation finale
(dal}c;la), renvoient aux notes donnees de lap. 373 a lap. 425. Ces
notes portent, pour certaines, sur l'etablissement du texte. Dans
d'autres, nous expliquons ou traduisons les passages les plus difficiles
a nos yeux68 . D'autres, enfin, fournissent les references des citations
(ou font etat de notre ignorance a leur sujet) et ajoutent, le cas
echeant, des renseignements concernant ces citations. 11 va sans dire
que nous n'avons pas toujours pu eclairer le texte autant que nous
l'aurions voulu. C'est ainsi que lorsque nous n'avons pas pu trouver
de source, ou de reference, pour certaines definitions ou assertions,
nous so mmes reste silencieux69 .
67
Le copiste de B indique, en effet, ce qui nous apparait comme des lacunes,
soit par un ou plusieurs tirets, ou encore un trait, horizontaux, soit par un blanc.
Ainsi, pour le seul acte I, lacunes d'une syllabe indiquees par un tiret : p. 21,
1. 407; p. 25, 1. 472; p. 32, 1. 629; lacune de trois syllabes indiquee par trois tirets :
p. 49, 1. 976, par un trait continu : p. 49, 1. 973; lacunes plus longues indiquees
par un blanc : p. 54, 1.1084; p. 55, 1.1091; p. 58, 1. 1160; p. 58, 11. 1162-1163 et
p . 59, 1. 1173.
68
Ainsi, pour l'acte V, en particulier les notes 2, 3, 4, 5, 6, 8, 9, 11, 13, 14, 15,
16, 17, 18, 40, 41.
69
Par exemple, quelle est l'origine, s'il y en a une, de cette etymolo-
Introduction XXXI

c) Un premier appendice (pp. 427-449) donne la liste des diffe-


rences relevees entre le texte du Malatimadhava edite par R. G.
Bhandarkar et le meme tel qu'on peut le voir au travers du com-
rnentaire de Harihara.
d) Un deuxierne appendice (pp. 451-454) donne la liste des va-
riantes dans le texte du Malatimadhava mentionnees dans le com-
mentaire.
e) Un premier index (pp. 455-461) donne la liste des mots prakrits,
deSI et d'une langue vernaculaire, mentionnes dans le commentaire.
f) Un deuxieme index (pp. 463-470) donne la liste des citations
faites par Harihara.
g) Un troisieme et dernier index (pp. 471-486) donne la liste des
termes qui designent des realites et des notions diverses appartenant,
notamment, aux domaines de la poetique, de la dramaturgie et de
l'erotique.

gie de bhava : Cittadharmopagrahi.r:io rasan bhavayati samajikan iti bhaval;i.


(p . 7, 11. 120-121), et de arya : arad yatal;i - dilraip. gatal;i - gramyatvat
ni$phalajfvitanfrasatvasarad ity aryal;i (p. 7, 11. 125-126)?