Vous êtes sur la page 1sur 112

An

Sbado 01 de octubre de 2016. e x oANEXO


a l AL PERIDICO
P e r i d OFICIAL
ico Of icial 1

Gobierno del Estado


Libre y Soberano de Chihuahua
Registrado como
Artculo
de segunda Clase de
fecha 2 de Noviembre
de 1927

Todas las leyes y dems disposiciones supremas son obligatorias por el slo hecho de publicarse
en este Peridico.
Responsable: La Secretara General de Gobierno. Se publica los Mircoles y Sbados.
Chihuahua, Chih., sbado 01 de octubre de 2016. No. 79

Folleto Anexo
ACUERDO No. 108
REGLAMENTO DE LA LEY DE EQUILIBRIO

ECOLGICO Y PROTECCIN AL AMBIENTE

DEL ESTADO DE CHIHUAHUA


2
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 3

LIC. CSAR HORACIO DUARTE JQUEZ, GOBERNADOR CONSTITUCIONAL DEL ESTADO LIBRE Y
SOBERANODECHIHUAHUA,ENEJERCICIODELASFACULTADESQUEMECONFIEREELARTCULO
93 FRACCIN IV DE LA CONSTITUCIN POLTICA DEL ESTADO, Y CON FUNDAMENTO EN LO
DISPUESTO EN EL ARTCULO 7 DE LA LEY DE EQUILIBRIO ECOLGICO Y PROTECCIN AL
AMBIENTEDELESTADODECHIHUAHUA,ASCOMOENLOSARTCULOS1FRACCINIVYVII,10,
11,24,25Y31DELALEYORGNICADELPODEREJECUTIVODELESTADODECHIHUAHUA;Y:

CONSIDERANDO

PRIMERA.QuelaLeydeEquilibrioEcolgicoyProteccinalAmbientedelEstadodeChihuahua,
publicadaenelPeridicoOficialdelEstadoel8dejuniode2005,seemiticonelobjetodecontar
conuninstrumentojurdicoenlaentidadquepermitagarantizarelderechodetodapersonaaun
adecuadomedioambienteypropiciareldesarrollosustentable,lapreservacinyconservacinde
lasreasnaturalesprotegidas,elordenamientoecolgico,laregulacindelimpactoambiental,as
como establecer los procedimientos administrativos derivados de la prevencin y control de la
contaminacindelaatmsferaenelEstadodeChihuahua.

SEGUNDA. Que el citado ordenamiento legal, en su artculo Segundo Transitorio, determin la
facultaddelEjecutivodelEstadoparaexpedirelreglamentoaqueserefieredichaLey.

TERCERA. Que la proteccin al ambiente nicamente se lograr con un marco jurdico claro y
preciso, que se caracterice por dar seguridad y certeza jurdica a la actuacin de las personas,
incluyendolasinstitucionespblicas,socialesyprivadas.

CUARTA. Que, en virtud de lo anterior, es necesaria la emisin del instrumento jurdico que
permitaunamejoraplicacindelaLey,desarrollandoadetallesusdisposicionesyadaptndosea
las condiciones y necesidades actuales del Estado de Chihuahua, en atencin a su crecimiento
poblacional,diversificacindeactividadeseconmicas,impulsoalaindustria,ydemsactividades
quepuedantenerunimpactoenelmedioambiente.

QUINTO. Que con el propsito de coadyuvar en la consecucin de un ordenamiento
reglamentario que cumpla cabalmente con los objetivos de la Ley, entre otras materias, se
desarrollandemaneraamplialaintegracinyatribucionesdelConsejoEstatalparalaProteccin
al Ambiente y el Desarrollo Sustentable, as como el Programa de Autorregulacin en Materia
Ambientalquecompetealaentidad.

Porloanteriormentedescrito,tengoabienexpedirelsiguiente:

ACUERDO

NICO. Se expide el Reglamento de la Ley de Equilibrio Ecolgico y Proteccin al Ambiente del
EstadodeChihuahua,paraquedarredactadoenlossiguientestrminos:


4
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

REGLAMENTODELALEYDEEQUILIBRIOECOLGICOYPROTECCINALAMBIENTEDELESTADO
DECHIHUAHUA

TTULOI
DISPOSICIONESGENERALES

ARTCULO 1. El presente ordenamiento tiene por objeto reglamentar la Ley de Equilibrio
Ecolgico y Proteccin al Ambiente del Estado de Chihuahua, sus disposiciones son de orden
pblicoeinterssocial.

ARTCULO 2. La aplicacin del presente Reglamento corresponde al Ejecutivo Estatal, por
conductodelaSecretaradeDesarrolloUrbanoyEcologadelEstadodeChihuahua,sinperjuicio
delasatribucionesquelecorrespondanaotrasDependenciasyalosMunicipios,deconformidad
conladistribucindecompetencias,cuyasbasesestablecelaLey.

ARTCULO3.EnelmbitodesusatribucionescompetealaSecretaravigilarelcumplimientode
lasdisposicionesestablecidasenlaLey,enesteReglamentoydemsordenamientosrelativosala
materia.Paraunagestinambientalintegral,laSecretaraylaAutoridaddelAguapodrnactuar
demaneracoordinadacomoAutoridadAmbiental.

ARTCULO4.ParaefectosdelpresenteReglamentoseestaralasdefinicionesestablecidasenla
Ley de Equilibrio Ecolgico y Proteccin al Ambiente del Estado de Chihuahua, Ley para la
Prevencin y Gestin Integral de los Residuos del Estado de Chihuahua, la Ley General para la
Prevencin y Gestin Integral de los Residuos, la Ley General del Equilibrio Ecolgico y la
Proteccin al Ambiente y sus Reglamentos en materia de auditoria ambiental, reas naturales
protegidas,ordenamientoecolgico,impactoambiental,prevencinycontroldelacontaminacin
delaatmsfera,ascomoalassiguientes:

ACTIVIDADES RIESGOSAS: Aquellas que no hayan sido consideradas por la Federacin como
altamente riesgosas, las cuales sern clasificadas por la Secretara y publicadas en el Peridico
OficialdelEstado.

ADMINISTRACIN AMBIENTAL: Conjunto sistematizado de acciones que establece una empresa
paraelcontrol,preparacin,ejecucin,registroyproyeccindesusactividadesyprocesos,conel
propsitodeprevenirlacontaminacinambientalyprotegerypreservarlosrecursosnaturales;

AUDITOR AMBIENTAL ESTATAL: Persona fsica inscrita en el Registro Estatal de Prestadores de
Servicio para realizar auditoras ambientales estatales, determinar medidas preventivas y
correctivasderivadasdelarealizacindeunaauditoraambientalestatalylasdemsactividades
vinculadasconstas;

AUDITORIA AMBIENTAL ESTATAL: Proceso voluntario de autorregulacin, a travs del examen
exhaustivodelosequiposyprocesosdeunaempresa,ascomodelacontaminacinyriesgoque
la misma genera, que tiene por objeto evaluar el cumplimiento de sus polticas ambientales y
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 5

requerimientos normativos, con el fin de determinar las medidas preventivas y correctivas


necesarias para la proteccin del ambiente y las acciones que permitan que dicha instalacin
opereenplenocumplimientodelanormatividadambientalestatalvigente,ascomoconformea
normasextranjeraseinternacionalesybuenasprcticasdeoperacineingenieraaplicables;

AVISO DE INCORPORACION: Documento mediante el cual el responsable del funcionamiento de
una empresa comunica a la Secretara su intencin de registrarse en el programa de auditora
ambientalestatal;

BANDA DE FRECUENCIA: Intervalo de frecuencia donde se presentan componentes
preponderantesderuido;

BASEDEDATOS:Conjuntodeinformacinalmacenadaenformaordenadaylgicaenunsistema
decmputo,paralacualsediseanyestructuranaplicacionesespeciales,ascomodeseguridade
integridaddelamisma;

BASES DEL PROGRAMA DE AUTOREGULACION: Instrumento mediante el cual se establecer la
metodologa,requisitos,criterios,parmetrosyespecificacionesnecesariosparaeldesarrollode
lasauditorasambientalesestatales,conformealodispuestoenesteordenamiento;

BUENAS PRACTICAS DE OPERACION E INGENIERIA: Actividades de diseo, construccin y
operacin de un proceso, para la obtencin de ptimos resultados, cuya aplicacin ha sido
aceptadaatravsdeltiempo,porlaausenciadereglamentacinespecfica;

BITCORA DE ORDENAMIENTO ECOLGICO: El documento en donde consta el registro de los
avancesdelprocesoecolgico.

CAPACIDADDECARGA:Estimacindelatoleranciadeunecosistemaalusodesuscomponentes,
talquenorebasesucapacidadderecuperarseenelcortoplazosinlaaplicacindemedidasde
restauracinorecuperacinpararestablecerelequilibrioecolgico.

CERTIFICADO DE CUMPLIMIENTO: Reconocimiento que otorga la Secretara para identificar a las
industriasquecumplandemaneraintegralloscompromisosquesederivendelarealizacindelas
auditorasambientalesestatales;

CONTINGENCIAAMBIENTAL:SimulacindeRiesgo,derivadadeactividadeshumanasofenmenos
naturales,quepuedenponerenpeligrolaintegridaddeunoovariosecosistemas.

CICLO:Cadaunodelosmovimientosrepetitivosdeunavibracinsimple;

CONFLICTOSAMBIENTALES:Concurrenciadeactividadesincompatiblesenunreadeterminada;

CONSEJO:ConsejoEstatalparalaProteccinalAmbienteyelDesarrolloSustentable;

6
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

CUERPO RECEPTOR: La corriente o depsito natural de agua, presas, cauces, o bienes de


jurisdiccin estatal donde se descarguen aguas residuales, as como los terrenos en donde se
infiltrenoinyectendichasaguascuandopuedancontaminarelsueloolosacuferos.

DECIBEL:DcimapartedeunBel;susmboloesDB;

DECIBEL:A.SusmboloesDB(A);

DESCARGA: Accin de verter, infiltrar, depositar o inyectar aguas residuales a los sistemas de
alcantarilladomunicipaloauncuerporeceptordejurisdiccinestatal.

DICTAMENESGENERALESDEIMPACTOAMBIENTAL:Conjuntodepolticasymedidasemitidaspor
la Secretara basadas en estudios tcnicos para preservar el equilibrio ecolgico y proteger el
ambienteyquedebernserconsideradasporlasautoridadescompetentesparaelotorgamiento
depermisoparalarealizacindeunaobraoactividaddeterminada.;

DISPERSINACSTICA:Fenmenofsicoconsistenteenquelaintensidaddelaenergadisminuye
amedidaquesealejadelafuente;

DIRECCIN:DireccindeEcologadelaSecretaradeDesarrolloUrbanoyEcologadelEstadode
Chihuahua.

EMISIN:Instalacinenlaqueserealizanactividadesindustriales,comercialesodeservicio.

EMPRESA:Instalacinenlaqueserealizanactividadesindustriales,comercialesodeservicios;

ERRORDECONCEPTO:Todaalteracinovariacindelsentidodelainformacincontenidaenla
Cdula;

ERRORMATERIAL:cuandoseescribanletras,palabrasonmerosporotros,sinalterarelsentido
delainformacincontenidaenlaCdula;

ESTABLECIMIENTOSUJETOAREPORTE:TodainstalacinquedeacuerdoconlaLeyyelpresente
Reglamento, deba reportar sus emisiones y transferencia de contaminantes generados por sus
actividadesproductivas;

ESTRATEGIA ECOLGICA: La integracin de los objetivos especficos, las acciones, los proyectos,
losprogramasylosresponsablesdesurealizacindirigidaallogrodeloslineamientosecolgicos
aplicablesenelreadeestudio;

ESTUDIODERIESGO:Documentoquedaaconocerlosriesgosqueunaobraoactividadrepresenta
para el equilibrio ecolgico o ambiente, as como las medidas tcnicas de carcter preventivo o
correctivo,paraevitar,minimizarocontrolarlosefectosadversosalequilibrioecolgico;

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 7

FUENTEDEREA:Fuentesyactividadescuyasemisionesdecontaminantesdelaireseestimanen
formacolectivaapartirdemetodologasespecificasenlaelaboracindeinventariosdeemisiones.

FUENTEEMISORADERUIDO:Todacausacapazdeemitiralambienteruidocontaminante;

FUENTEFIJA:Instalacinestablecidaenunslolugarparaeldesarrollodeoperacionesoprocesos
industriales, comerciales, de servicios, o actividades que generen o puedan generar emisiones
contaminantesalaatmsfera;

FUENTE MVIL: Vehculos automotores, aviones, helicpteros, ferrocarriles, tranvas,
tractocamiones, autobuses, camiones, automviles, motocicletas, equipo y maquinarias no fijos
que con motivo de su operacin generen o puedan generar emisiones contaminantes a la
atmsfera;

FUENTEMLTIPLE:Fuentefijaquetienedosomsductosochimeneasporlasquesedescargan
lasemisionesalaatmsfera;

FRECUENCIA:Lavelocidadderepeticindeunaondasonora,suunidadmtricaeselHertz,cuyo
smboloesHz;

FRE:Formatodereportedeemisionesanual;

GASES:Sustanciasemitidasalaatmsfera,quesedesprendendelacombustindelosmotores;

HUMOS:Partculasslidasolquidas,visiblesqueresultandeunacombustinincompleta;

IMPACTOAMBIENTALSIGNIFICATIVOORELEVANTE:Aquelqueresultadelaaccindelhombreo
de la naturaleza, que provoca alteraciones en los ecosistemas y sus recursos naturales o en la
salud, obstaculizando la existencia y desarrollo del hombre y de los seres vivos, as como la
continuidaddelosprocesosnaturales.

INDICADORES AMBIENTALES: Variable que permite evaluar la efectividad de los lineamientos y
estrategiasecolgicas;

INMISIN:Lapresenciaaniveldepisodecontaminantesenlaatmsfera;

LEY:LaLeydeEquilibrioEcolgicoyProteccinalAmbientedelEstadodeChihuahua;

LEYGENERAL:LaLeyGeneraldelEquilibrioEcolgicoylaProteccinalAmbiente;

LEYDERESIDUOS:LaLeyGeneralparalaPrevencinyGestinIntegraldelosResiduos;

LICENCIADEFUNCIONAMIENTO:AutorizacindelaSecretariaenmateriadeprevencinycontrol
delacontaminacindelaatmosfera.
5
8
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


MEDIDASCORRECTIVAS:Accionesqueseaplicanalosequipos,actividades,procesos,programas,
procedimientos, vehculos o sistemas de una empresa, incluyendo la instalacin de equipo,
prcticas,olarealizacindeobras,conelobjetodecontrolar,minimizaroevitarlacontaminacin
ambientaloderestaurar,recuperar,compensar,ominimizarlosdaoscausadosalambienteoa
losrecursosnaturales;

MEDIDASPREVENTIVAS:Accionesqueconjuntaoseparadamenteseaplicanaunoomsequipos,
actividades, procesos, programas, procedimientos, prcticas, vehculos o sistemas de una
empresa,incluyendolainstalacindeequipoolarealizacindeobras,conelobjetodeprevenirla
contaminacinylosriesgosdecontingenciasambientales;

NORMAS TCNICAS ECOLGICAS: Las Normas Oficiales Mexicanas o las Normas que emita el
Estadoenmateriaambiental;

PLAN DE ACCIN: Documento resultante de la auditora ambiental estatal que contiene las
medidaspreventivasycorrectivas,ascomolosplazosparasurealizacin,quesecomprometea
realizarelresponsabledelaempresaauditada;

PLATAFORMA Y PUERTOS DE MUESTREO: Instalaciones para realizar el muestreo de gases o
partculasenductosochimeneas;

RECOLECCIN: Accin de acopio y transferencia de residuos al equipo destinado a conducirlos a
lasinstalacionesdealmacenamiento,reutilizacin,reciclaje,obtencindeenerga,tratamientoo
confinamiento;

REPORTE: Accin de hacerle llegar a la autoridad la informacin que es requerida por la Ley, su
Reglamentoydemsordenamientosaplicables.Losvocablosaviso,notificacinosimilaresdeben
entenderseenestemismoconcepto.

RETC:ElRegistrodeEmisionesyTransferenciadeContaminantesdelEstado,esunabasededatos
queseintegraconlainformacindelosestablecimientossujetosareportesobresusemisionesy
transferenciadecontaminantesalaire,agua,sueloysubsuelo,materialesyresiduos,ascomode
aquellas sustancias que determine la Secretara, la cual ser operada y administrada por esta, a
travsdelaDireccindeEcologa.Enelpresentereglamento,elRETCestambinreferidocomoel
Registro.

REGLAMENTO:ReglamentodelaLeydeEquilibrioEcolgicoyProteccinalAmbientedelEstado
deChihuahua;

RUIDO: Todo sonido cuya intensidad transgrede los lmites mximos permisibles establecidos en
esteReglamento.

SECRETARA:LaSecretaradeDesarrolloUrbanoyEcologadelEstadodeChihuahua;
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 9


SISTEMA DE ALCANTARILLADO MUNICIPAL: El conjunto de obras y acciones que permiten la
prestacindeunserviciopblicodealcantarilladoincluyendoelsaneamiento,entendiendocomo
tallaconduccin,tratamiento,alejamientoydescargadelasaguasresiduales.

SITIO CONTAMINADO: Lugar en el que se encuentran presentes residuos no peligrosos o de
manejoespecialyquepuedenconstituirunriesgoparaelambienteylasalud;

TRANSFERENCIA:Trasladodesustanciassujetasareporteaunsitioqueseencuentrafsicamente
separadodelestablecimientoquelasgener,confinalidadesdereutilizacin,reciclaje,obtencin
deenerga,tratamientooconfinamiento;incluyendodescargasdeaguasacuerposreceptoresque
sean aguas de jurisdiccin estatal, sistemas de alcantarillado y manejo de residuos de manejo
especial,salvosualmacenamiento;

UMBRALDEREPORTE:Cantidadmnimaapartirdelacual,losestablecimientossujetosareporte
de competencia estatal debern reportar las emisiones y transferencias de las sustancias, de
conformidadconloqueseestablezcaenelAcuerdoqueparatalefectoexpidalaSecretara.

VEHCULOSAUTOMOTORES:Todoartefactopropulsadoporunmotorqueseencuentredestinado
altransportedepersonasocarga;

VERIFICACINVEHCULAR:Medicindelasemisionesdegasesopartculasslidasolquidasala
atmsferaprovenientesdevehculosautomotores;

ZONA CRTICA: Aqulla que por sus condiciones topogrficas y meteorolgicas dificulta la
dispersinoregistraaltaconcentracindecontaminantesalaatmsfera;


TTULOII
PARTICIPACINSOCIALYORGANISMOSDECOORDINACIN

CAPTULOI
DESARROLLOYFUNCIONAMIENTODELCONSEJOESTATALPARALAPROTECCINALAMBIENTE
YELDESARROLLOSUSTENTABLE

SECCINI
CONFORMACINDELCONSEJO

ARTCULO5.Entrminosdelodispuestoenelartculo15delaLey,elEjecutivodelEstado,por
conducto de la Secretaria, contar con un rgano de coordinacin en materia Ecolgica,
denominado Consejo Estatal para la Proteccin al Ambiente y el Desarrollo Sustentable y se
integrarconformeloestablecidoporelcitadonumeral.

10
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO6.ElEjecutivoporconductodelaSecretaraconvocarentreelsectoracadmico,las
cmarasempresariales,lasociedadcivilecologistayloscolegiosdeprofesionistasalaeleccinde
losintegrantesdelConsejodeacuerdoalossiguientesrequisitosdeelegibilidad:

I. Serciudadanomexicanoenplenogocedesusderechos;

II. Mayorde30aosdeedad;

III. Dedemostradaprobidadysolvenciamoral;

IV. Tenerunaresidenciamnimadetresaosenlaentidad;y

V. Noserfuncionariopblico,salvoloscasosdelosmiembrossealadosenlasfraccionesI,
II,IIIyVdelArtculo15delaLey.

ARTCULO7.LosmiembrosdelConsejoquesemencionanenlasfraccionesIVyVIdelArtculo15
delaLey,durarnensuencargoeltrminodetresaos.

LaconvocatoriaparalarenovacindelosmiembrosdelConsejosepromoverconseismesesde
anticipacinalvencimientodeltrminodesugestinenelConsejoenfunciones.

ARTCULO8.ConformealodispuestoenelArtculo15delaLey,elsuplentedelConsejerotitular,
asumirlasfuncionesdeltitularenlasausenciasdeeste,conigualesderechosyprerrogativasen
tantoestnenfunciones.

Una vez determinado quienes sern integrantes del Consejo, el Presidente de dicho rgano
extenderelnombramientoasusmiembrosyprocederaprotestarleselcargo.

SECCINII
ATRIBUCIONESDELCONSEJOYDESUSMIEMBROS

ARTCULO9.DeacuerdoalodispuestoporelArtculo17deLey,sonatribucionesdelConsejo:

I. Promoveryfomentarlaparticipacindedistintosgrupossociales,enlarealizacindel
anlisisyconocimientodeprogramasquetenganporobjetoelmantenimientodel
equilibrioecolgicoylaproteccinalambiente;

II. Apoyaryasesorarenlaelaboracindeproyectosyprogramasestatales,regionalesy
municipalesdecarcterecolgico;

III. Revisaryanalizarlosordenamientosydisposicionesjurdicasvigentesyproponeral
Ejecutivo,porconductodelaSecretara,suadecuacinparaqueseencuentren
permanentementeactualizados;

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 11

IV. Fomentarlaparticipacindelapoblacinenaccionesencaminadasaprotegerel
ambiente;

V. Realizarestudiosreferentesalosproblemasquesurjanenmateriaambiental,
estableciendoobjetivos,prioridadesypolticasquepropongansolucionesastos;

VI. Organizaryparticipareneventosyforosdondeseanalicentemasambientales;

VII. Promoverlainvestigacinydivulgarlosavancescientficosqueexistensobrelaproteccin
delmedioambienteyecosistemas;y

VIII. LasdemsqueconformeaestaLeyysusreglamentoslecorrespondan.

ARTCULO10.DerechosyobligacionesdelosmiembrosdelConsejo:

I. Asistirpuntualmentealassesionesconvocadas;

II. Ejercersuderechodevoto;

III. Emitiropininenlosasuntosquesearequerida;

IV. Difundirentresusrepresentados,losacuerdos,planesyprogramasporellosaprobados;y

V. Revisarlainformacinquelesseaproporcionadaparasuestudio.

ARTCULO11.ElPresidente,tendrlassiguientesfunciones:

I. Convocar a los integrantes del Consejo para efectos de celebrar sus sesiones, por
conductodelSecretario,enlostrminosdelpresenteReglamento;

II. PresidirlassesionesdelConsejo;

III. ConcederelusodelapalabraalosintegrantesdelConsejoenlostrminosdelpresente
Reglamento;

IV. DeterminarelordenenquedebernseratendidoslosasuntosenelConsejo,mediantela
autorizacindelOrdendelDa;

V. Emitirvotodecalidadencasodeempate;

VI. ResolverlasmocionesdeprocedimientoqueseformulenporlosintegrantesdelConsejo;

VII. Declararelinicioyclausuraformalesdelostrabajosdelasesin;y

12
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

VIII. En general, tomar las medidas necesarias, durante la celebracin de las sesiones, para
proveer al cumplimiento de la Ley, del presente Reglamento y de los acuerdos del
Consejo.

ARTCULO12.ElSecretariotendrlassiguientesfunciones:

I. Formular el proyecto de Orden del Da de las sesiones, en atencin a los asuntos que
conformealasdisposicionesdelpresenteReglamentodebanagendarse;

II. Tomarlistadeasistenciayverificarydeclararlaexistenciadequrumlegalparasesionar;

III. Levantarelactadelasesin,formandoelapndicecorrespondiente,ylegalizndolacon
sufirma;

IV. Darlecturaalactadelasesinanterior,solicitandoladispensadelecturaqueensucaso
resulteprocedenteconformealodispuestoporelartculo44deesteReglamento;

V. Ser el conducto para presentar ante el Consejo proyectos de acuerdos y resoluciones,
integrandoelexpedienteyformulandoeldictamendeprocedimientocorrespondiente;

VI. CompilarlosacuerdosyresolucionesdictadasporelConsejoyproveeralcumplimientode
loprevistoenelpresenteReglamento;

VII. EmitirporconductodelreajurdicadelaSecretara,losdictmenesdeconstitucionalidad
ylegalidadqueelPresidente,elConsejoolosmiembrosdelConsejolesolicitenrespecto
delosproyectosdeacuerdosyresolucionesqueseandesuconocimiento;

VIII. TramitarlacorrespondenciaylosasuntosquenorequieranacuerdodelConsejo;

IX. TurnaralConsejolosasuntosdesucompetencia;

X. Recibirlosplanesyprogramasyconvocaralasesinextraordinariacorrespondiente;

XI. PublicaryejecutarlosacuerdosdelConsejo;y

XII. Engeneral,aquellasqueelPresidente,elConsejo,lasleyesylosreglamentosleconcedan.

ARTCULO13.Losgastosdetrasladoyviticosdelosconsejerosareunionesycomisionessern
sufragadosporlaSecretara.

ARTCULO 14. Las funciones que respecto de los miembros del Consejo se establecen en el
presenteReglamento,seotorgansinperjuiciodelasatribucionesprevistasporlaLey,yslopara
regularelfuncionamientocolegiadodelConsejo.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 13

ARTCULO 15. El Consejo ser presidido por el Gobernador del Estado o quien desempee sus
funcionesenlostrminosdeLey.

ActuarcomoSecretarioelSecretariodeDesarrolloUrbanoyEcologa,oelsuplentequeparatal
efectosehubieredesignado.

ARTCULO16.LosdemsmiembrosdelConsejotienenlaobligacindeasistiracuandomenosel
80% de las sesiones ordinarias y extraordinarias convocadas en los trminos del presente
Reglamento.

SECCINIII
ACUERDOSYRESOLUCIONESDELCONSEJO

ARTCULO 17. El Consejo ejercer las atribuciones que le concede el artculo 17 de la Ley,
mediantelaexpedicindeacuerdosyresolucionesdenaturalezaadministrativa,paraefectosde
regularlasatribucionesdesucompetenciadeacuerdoconlasdisposicioneslegalesaplicables.

ARTCULO18.ElprocedimientoparalaaprobacindelosacuerdosyresolucionesdelConsejose
regula por el presente Reglamento. En todo caso, deber observarse en su modificacin o
revocacin,elmismoprocedimientoquelesdioorigen.

ARTCULO19.LosacuerdosyresolucionesdelConsejodebernconteneralfinal,lacertificacin
queextiendaelSecretariorespectodeladifusinyparaquelosciudadanosdelEstadoconozcan
losacuerdosyresolucionesquedicteelConsejo,laSecretaraimplementarprogramasespeciales
dedifusinparaconseguirestepropsito.

ARTCULO 20. El Secretario compilar los acuerdos y resoluciones del Consejo, mediante los
instrumentos y mecanismos que considere convenientes, a fin de brindar a sus integrantes el
serviciodeconsultayactualizacinquerequieranparaelejerciciodesusfunciones.

ARTCULO21.Lacompilacinaqueserefiereelartculoanteriordeberponerseadisposicinde
laciudadanamedianteelestablecimientodelosprogramasdeedicin,publicacinydifusinque
alrespectosediseen,ydeacuerdoalasdisposicioneslegalesaplicables.

ARTCULO 22. Corresponde a la Secretara integrar los expedientes relativos a las sesiones del
Consejoyasusacuerdosyresoluciones.

SECCINIV
SESIONESDELCONSEJO

ARTCULO 23. Las sesiones del Consejo sern ordinarias y extraordinarias, por regla general
pblicas.

14
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO 24. Para que las sesiones del Consejo sean vlidas se requiere que hayan sido
convocadostodossusintegrantesyqueseencuentrepresenteporlomenoslamitadmsunode
susmiembros,entrelosquedeberestarelPresidenteoelrepresentantequehayadesignado.

ARTCULO 25. En caso de imposibilidad de asistencia del miembro titular a las asambleas, su
ausenciasercubiertaporelsuplenteconformealodispuestoenelArtculo15delaLey.

ARTCULO 26. El Consejo sesionar en reuniones ordinarias que se celebrarn cuando menos
cadatresmesesparatratarasuntosdesucompetencia.

ARTCULO 27. Podrn celebrarse sesiones extraordinarias del Consejo cuando sea necesario, de
acuerdoconlosprocedimientosquedecomnacuerdoseestablezcan.

ARTCULO28.ElSecretariodelConsejotienelafacultaddeemitirsuopininparadeterminaren
quecasodeberconsiderarselaexistenciadecontingenciaambientalyladecisindeconvocara
sesinextraordinaria.

ARTCULO 29. El pblico que asista a las sesiones del Consejo deber guardar compostura y
silencio, quedando prohibido alterar el orden, hacer ruido, faltar al respeto a los presentes, o
realizarcualquierotroactoquedistraigalaatencindesusintegrantes.

ElPresidentepodrordenareldesalojodelrecintodelConsejo,pudiendosolicitarelapoyodela
fuerzapblicasiresultanecesario.

ARTCULO 30. Para efectos de proceder a la celebracin de sesiones del Consejo, deber
convocarse previamente a sus integrantes por escrito, indicando la fecha y hora en que deber
celebrarselasesin,yensucaso,ellugarquehayasidodeclaradooficialparaelefecto.

ARTCULO31.Laconvocatoriaparalacelebracindesesionesordinariasdebersernotificadaen
formapersonalalosmiembrosdelConsejoconunaanticipacinde15das.Lasconvocatoriasa
las sesiones extraordinarias debern notificarse a los interesados por lo menos con tres das de
anticipacin.

ARTCULO32.LaconvocatoriaqueseexpidaparalacelebracindesesionesdelConsejodeberir
acompaadadelOrdendelDa,mismaquedebercontener,porlomenos,lossiguientespuntos:

I. Listadeasistenciaydeclaracindequrumlegal;

II. Aprobacindelactadelasesinanterior;

III. Presentacindeproyectosdeacuerdosyresoluciones;

IV. PresentacindeinformesydictmenesdelasComisiones;y

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 15

V. Asuntosgenerales.

ARTCULO33.Lassesionesordinariasyextraordinariaspodrncelebrarseencualquiermunicipio
delEstado.

Unavezinstalada,lasesinnopuedesuspendersesinoenlossiguientescasos:

I. Cuando se retire alguno o algunos de los miembros del Consejo, de manera que se
disuelvaelqurumlegalparasesionar;y,

II. CuandoelPresidenteestimeimposiblecontinuarconeldesarrollodelasesinporcausa
defuerzamayor.

Cuando se suspenda una sesin del Consejo, el Secretario har constar en el acta la causa de la
suspensin.

SECCINV
VOTACIN

ARTCULO 34. Los acuerdos y resoluciones se tomarn por mayora simple del nmero de
integrantesdelConsejopresentesenlasesin.

CorrespondealSecretariorealizarelcmputodelosvotosydeclararelresultadodelavotacin.

ARTCULO 35. Por regla general, la votacin se har en forma nominal manifestando cada
consejero,sunombreyelsentidodesuvoto,envozalta.

ARTCULO 36. Las resoluciones se tomarn en votacin econmica a propuesta del Presidente,
paralocuallosintegrantesdelConsejoquesemanifiestenafavordebernlevantarlamanoyde
sernecesario,loharndespuslosquesemanifiestenencontra.

ARTCULO37.Lasresolucionessetomarnporvotacinporcdulaprevioacuerdoeconmicodel
Consejo.

La votacin por cdula se realizar en forma impersonal, mediante la manifestacin del sentido
delvotoenboletasdiseadasparaelefecto,mismasqueserndestruidasunavezcomputadoel
resultadodelavotacin.

ARTCULO38.LosintegrantesdelConsejoqueaslodeseen,podrnrazonarelsentidodesuvoto
almomentodeemitirlo,elcualseharconstarenelacta,oensudefectopresentarlomediante
escrito que hagan llegar al Secretario a ms tardar al siguiente da hbil al de la clausura de la
sesin.

SECCINVI
16
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

LEVANTAMIENTODEACTA

ARTCULO39.DecadasesindelConsejoselevantaractaporelSecretario,mismaquedeber
contenerlossiguienteselementos:

I. Fecha,horaylugarenquesecelebrlasesin,yhoradesuclausura;

II. OrdendelDa;

III. Certificacindelaexistenciadequrumlegal;

IV. Asuntos tratados, con la descripcin de sus antecedentes, sus fundamentos legales, las
disposicionesquealrespectosehayanaprobadoyelresultadodelavotacin;y,

V. Relacindeinstrumentosqueseagregaronalapndice.

Decadasesinselevantargrabacinmagnetofnicauotrasconvenientesquepermitahacerlas
aclaraciones pertinentes respecto del acta; los medios o instrumentos que contengan las
grabacionesformarnpartedelapndice,ysernarchivadasdemanerapermanentedespusde
quesehayaaprobadoporelConsejoelactacorrespondiente.

ARTCULO 40. El Secretario llevar el Libro de Actas, autorizndolo con su firma en todas sus
hojas.

ARTCULO 41. El Presidente del Consejo autorizar con su firma, el libro de actas para las
asambleasyenelcualsellevarunapndice,alqueseagregarnlosdocumentosyexpedientes
relativosalosasuntostratadosenlassesionesdelConsejo.

ARTCULO42.LasactasdelConsejo,unavezaprobadas,setranscribirnalLibrodeActasconla
certificacinalfinal,suscritaporelSecretario,haciendoconstarlaaprobacindelacta.

ARTCULO43.LasactasdelConsejosernledasporelSecretarioenlasiguientesesinordinaria,
seguidolocualseaprobarnporsusmiembrosmedianteacuerdoeconmico.

Las observaciones que se formulen al acta sern asentadas por el Secretario previamente a su
transcripcinalLibrodeActas.

ARTCULO 44. Podr dispensarse la lectura del acta si el Secretario remite el proyecto a los
integrantesdelConsejocuandomenosconveinticuatrohorasdeanticipacinalasesinenque
debadrselelectura.

En la sesin correspondiente, el Secretario informar de la remisin anticipada y solicitar la
dispensadelectura,traslocualseprocederasuaprobacinenlostrminosdelartculoanterior.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 17

SECCINVII
COMISIONES

ARTCULO45.LosmiembrosdelConsejoejercenlasatribucionesquelaLeyyelReglamentodela
Ley les otorgan en materia ambiental de los problemas del Estado y los Municipios y sus
soluciones,loqueseharatravsdeComisiones.

ParaestudiarysupervisarqueseejecutenlasdisposicionesyacuerdosdelConsejo,sedesignarn
Comisiones entre sus miembros. Estas se integrarn con tres o ms miembros del Consejo, que
actuarnenformacolegiada.

ElPresidentepodrparticiparentodaslasComisionesqueconsiderenecesario.

Las Comisiones propondrn al Consejo los proyectos de solucin a los problemas de su
conocimiento,medianteeldictamendelosasuntosquelesseanturnados.

Las Comisiones podrn ser permanentes o especiales, y actuarn y dictaminarn en forma
individualoconjunta.

ARTCULO46.Enejerciciodesusfunciones,lasComisionesactuarnatravsdelaSecretarapara
requerir por escrito a los funcionarios, empleados y servidores pblicos de la administracin
estatal y municipal la informacin que requieran para el despacho de los asuntos de su
conocimiento.

ARTCULO47.ElConsejodesignaralosintegrantesdelasComisionesyelconsejeroquedeba
presidircadaunadeellas,apropuestadelPresidente.

Ensuprimerareunindetrabajo,lasComisionesdesignarndeentresusmiembrosalconsejero
quedebafungircomoSecretario.

ARTCULO48.SonfuncionesdelPresidentedeComisin:

I. PresidirlassesionesdeComisin;

II. ConvocaralosmiembrosdelaComisinparacelebrarsesiones;

III. DeterminarelordenenquedebernseratendidoslosasuntosenComisiones,mediantela
autorizacindelOrdendelDa;

IV. Emitirvotodecalidadencasodeempate;y

V. Engeneral,aquellasqueresultennecesariasparagarantizareldebidofuncionamientode
laComisin.

18
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO49.SonfuncionesdelSecretariodeComisin:

I. IntegraryllevarlosexpedientesdelosasuntosquehayansidoturnadosalaComisin;

II. Convocar en ausencia del Presidente a los miembros de la Comisin para celebrar
sesiones;

III. FungircomosecretariodeactasdelassesionesdelaComisin;

IV. Tomarlistadeasistenciaydeclararlaexistenciadequrumlegalparasesionar;y

V. En general, aquellas que el Presidente de la Comisin o la Comisin en pleno le
encomienden.

ARTCULO50.LassesionesdelasComisionessernconvocadasporsuPresidente,ySecretarioen
sucaso,cuandomenosconsietedasnaturalesdeanticipacin,yserequerirlapresenciadela
mitad mas uno de los integrantes, entre quienes debern estar presentes el Presidente y/o
Secretario. Al inicio de la sesin, se verificar el cumplimiento de la convocatoria en estos
trminos.

ParaquelasComisionespuedansesionarvlidamente,serequierelaasistenciadelamitadms
unodesusmiembros,entrelosquedeberestarsuPresidente.

ARTCULO 51. Las resoluciones se tomarn preferentemente por consenso, y en su caso, por
mayoradevotosdelosintegrantesdelaComisinqueseencuentrenpresentesystadebeser
presentadaparasuresolucinfinalalplenodelConsejo.

SECCINVIII
DENUNCIAPOPULAR

CAPTULONICO
DISPOSICIONESGENERALES

ARTCULO52.Todapersona,organizaciones,asociacionesysociedadespodrndenunciarantela
AutoridadAmbientalactosuomisionesqueproduzcanopuedanproducirdesequilibrioecolgico
odaosalambienteoalosrecursosnaturales,ocontravenganlasdisposicionesjurdicasenlas
materiasdelaLeyydelpresenteReglamento.

ARTCULO53.Ladenunciapopularconsistirenquecualquierpersonaquetengaconocimiento
de la existencia de la comisin de violaciones a la Ley y al presente Reglamento por parte de
alguna empresa y/o establecimiento, o prestador de servicios, reporte a la Autoridad Ambiental
dichas anomalas o violaciones, para que la autoridad competente en el mbito de sus
atribuciones proceda a verificar los hechos denunciados y sancionar de ser el caso al infractor
segncorresponda.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 19


ARTCULO54.Ladenunciapopularparasutrmiteysubstanciacin,bastarquesepresentepor
escritobajoprotestadedecirverdad,ycontenga:

I. Elnombreoraznsocial,domicilio,ytelfono,deldenunciante;

II. Elnombreoraznsocial,domicilio,telfonosilotiene,deldenunciadoy,ensucasodesu
representantelegal;

III. Losactos,hechosuomisionesdenunciados;

IV. Losdatosquepermitanidentificaralpresuntoinfractorolocalizarlafuentecontaminante;
y

V. Laspruebasqueensucasoofrezcaeldenunciante.

Asmismopodrformularseladenunciaporvatelefnicaencuyosupuestoelservidorpblico
que la reciba, levantar acta circunstanciada, y el denunciante deber ratificarla por escrito,
cumpliendo con los requisitos establecidos, en el presente artculo, en un trmino de tres das
hbiles siguientes a la formulacin de la denuncia,. En caso de que no sea ratificada por el
denunciante dentro del plazo establecido, se tendr por no presentada; emitiendo la autoridad
acuerdoadministrativodenoratificacinyarchivo;sinperjuiciodequelaautoridadcompetente
investiguedeoficioloshechosconstitutivosdeladenuncia.

No se admitirn denuncias notoriamente improcedentes o infundadas, aquellas en las que se
advierta mala f o carencia de fundamento, lo cual se notificar al denunciante a travs de
acuerdoadministrativodenoadmisin,debidamentefundadoymotivado.

ARTCULO55.LaAutoridadAmbiental,atravsdelaunidadadministrativacorrespondiente,una
vezrecibidaladenuncia,leasignarunnmerodeexpedienteylaregistrar.

Una vez registrada la denuncia, dentro de los 10 das hbiles siguientes a su presentacin, se
notificar al denunciante el acuerdo administrativo de admisin de la denuncia, sealando el
trmitequeselehadadoalamisma.

Si la denuncia presentada fuera competencia de otra autoridad, dentro de tres das hbiles
posteriores a dicha recepcin, se emitir un acuerdo administrativo de incompetencia
debidamentefundadoymotivadoenelcualseordenequeladenunciaseaturnadaalaautoridad
competente para su trmite y resolucin, debindose orientar al denunciante sobre la
competencia. El acuerdo administrativo de incompetencia ser notificado al denunciante,
anexandocopiadeloficiomedianteelcualsehizolaremisindeladenuncia.Enelcasodequela
autoridadcompetentefuesealgunaentidaddependientedelEjecutivodelEstadodeChihuahua,
elplazoestablecidoenelprrafoqueantecedeiniciarapartirdequelaautoridadcompetente
registreladenuncia.
20
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


Encasoderecibirsedosomsdenunciasporlosmismoshechos,actosuomisiones,laAutoridad
Ambiental,atravsdelaunidadadministrativacorrespondiente,acordarlaacumulacinenun
soloexpediente,debiendonotificaralosdenuncianteselacuerdoadministrativodeacumulacin
enelqueseindiqueelnmerodeexpedientealquefueintegradaladenunciadapresentada.

ARTCULO 56. Una vez admitida la denuncia, la Autoridad Ambiental, a travs de personal
debidamenteautorizadoprocederarealizarvisitadeinspeccinenlostrminosdelCaptuloIdel
Titulo VII de este Reglamento. En un plazo no mayor a sesenta das hbiles posteriores a la
notificacin del acuerdo de admisin de la denuncia, deber emitirse un acuerdo administrativo
deconclusinyarchivodedenuncia,enelqueseinformealdenunciantesiloshechosasentados
en el Acta de Inspeccin correspondiente constituyen o no infracciones a la normatividad
ambiental,yensucaso,siseimpusieronsancionesy/omedidascorrectivasodeseguridad.

En caso de que en la visita de inspeccin no se encuentren hechos u omisiones a la Ley, el
presente Reglamento y dems disposiciones aplicables, la Direccin emitir acuerdo
administrativodeconclusinyarchivo,notificandoaldenunciantelosresultadosdelainspecciny
elacuerdodeconclusindedenuncia,debidamentefundadoymotivado.

La formulacin de la denuncia popular, as como los acuerdos, resoluciones y recomendaciones
queemitalaAutoridadAmbientalnoafectarnelejerciciodeotrosderechosomediosdedefensa
que pudieran corresponder a los afectados conforme a las disposiciones jurdicas aplicables, no
suspendern ni interrumpirn sus plazos preclusivos, de prescripcin o de caducidad. Esta
circunstanciadebersealarsealosinteresadosenelacuerdodeadmisindelainstancia.

CAPTULOII
PARTICIPACINSOCIAL

SECCINI
COOPERACINYPARTICIPACINCIUDADANA

ARTCULO57.ElCiudadanoescoresponsabledelasaccionesqueafectenelmedioambienteyal
mismotiempoescoadyuvantedelaautoridad.

ARTCULO58.LapromocindelaconcienciaecolgicaenelEstadocomolosealaelArtculo21
delaLey,estaracargodelaSecretaraylosmunicipiosatravsdelassiguientesacciones:

I. ElreconocimientoyestmulosquesedeterminenporlaSecretarayelConsejoaescuelas
y profesores que promuevan la creacin de grupos o clubes ambientales que traten
cualesquieradelasreasdelatemticaambientaloecolgicadelestado.

II. La publicacin peridica de las acciones ambientales en medios electrnicos y en una
gaceta o publicacin impresa que contenga tanto las acciones de los poderes ejecutivo
legislativoyjudicialcomodelasaccionesdelasociedadcivil.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 21


III. La elaboracin de un programa de educacin ambiental formal para centros educativos
pblicosyprivados.

IV. Laelaboracindeunprogramadeeducacinnoformalparalaciudadanaengeneralen
suscentrosdetrabajoolugarespblicos.

V. Enlainvestigacincientfica,laSecretaraconosinelapoyodelosmunicipiosyelConsejo
Nacional de Ciencia y Tecnologa, crear un fondo ambiental para que a travs de un
concursodeoposicinlosinvestigadoresrealicenpropuestasdeinvestigacinacordescon
laagendaylaspolticaspblicasambientalesdefinidasenelConsejo.

SECCINII
CONSULTASYOPININPBLICA

ARTCULO 59. La Secretara, en coordinacin con el Consejo, convocar a consulta pblica los
siguientescasosrelacionadosconelequilibrioecolgicoyproteccinalambiente:

I. Lasobrasoactividadesqueafectenadosomsmunicipios.

II. Cuandoaslorequieralamanifestacindeimpactoambiental.

III. CualquiermodificacinualteracindelaLey.

IV. Cuandodeterminadaactividadenproduccinpongaenriesgoauncentrodepoblacin.

ARTCULO60.Lasconsultaspblicassernenlugarespblicosdefcilaccesoparalamayorparte
delapoblacin.

ARTCULO 61. Las consultas pblicas sern anunciadas en los principales medios de difusin
impresoscon30dasdeanticipacin,sealandoelordendelda,ellugarylahora.

ARTCULO 62. La Secretara registrar a las personas consultadas y establecer la comunicacin
permanente con los interesados sobre el asunto en cuestin y de todos aquellos que considere
fortalezcansuopinin.

SECCINIII
CONVENIOSCONSECTORESDELASOCIEDADYMEDIOSDECOMUNICACIN

ARTCULO63.LosconveniosdecolaboracinquecelebrelaSecretaraconlasorganizacionesde
lasociedadcivilylasuniversidadessloserealizarncuandocumplanconlosiguiente:

I. Seencuentrendebidamentereconocidasantelasinstanciascorrespondientes;

22
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

II. Presenten un programa anual de actividades en relacin con el equilibrio ecolgico y la


proteccindelambiente;

III. Tengancuandomenos1aodeactividadesrelacionadasconelmedioambiente;y

IV. Sepresenteadjuntounproyectoespecficodecolaboracin.

ARTCULO64.LaAutoridadAmbientalpodrcelebrarconveniosdecolaboracinconlosmedios
masivosdecomunicacinparalassiguientesactividades.

I. Difundirlasaccionesenmateriadeequilibrioecolgicoyproteccinalambiente.

II. Promover entre los diversos sectores pblico, social, acadmico, y privado la conciencia
delcuidadoypreservacindelmedioambiente.

III. ProporcionarinformacindelestadoqueguardanlosrecursosnaturalesdelEstado.

IV. Transparentar los procesos y acciones relativas al equilibrio ecolgico y proteccin al
ambiente.

SECCINIV
INFORMESOBREELESTADODELAMBIENTE

ARTCULO 65. Adems de lo que establece el Artculo 25 de la Ley, la Autoridad Ambiental
apoyar al Consejo en la elaboracin del Informe General sobre el Estado del Ambiente (IGEA)
observandolosiguiente:

I. Seconsiderendicesdecontaminacin,degeneracinderesiduos,emisiones,ycualquier
otrainformacinquecoadyuveenlaelaboracindelmismo.

II. SeinstituyalamodalidaddeobservatorioambientalacargodelaSecretaraconaccesoa
datosrelevantesdelostemasdelagua,aire,suelo,bosques,deldesarrollourbano,yque
steseaunainstanciadeconsultaalmenoselectrnicaparaelpblicoengeneral.

III. Se sealen adems de las condiciones ambientales, y en su caso, las condiciones
econmicas,socialesytecnolgicasdelaregin.

TTULOIII
POLTICAAMBIENTAL

CAPTULOI
PLANEACINAMBIENTALYORDENAMIENTOECOLGICO

SECCINI
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 23

DISPOSICIONESGENERALES

ARTCULO66.EnmateriadeordenamientoecolgicocompetealaSecretara:

I. Establecer con el apoyo del Consejo polticas, criterios, mecanismos, lineamientos,
estrategias ecolgicas e instrumentos de coordinacin y concertacin con personas,
organizacioneseinstitucionesdelossectorespblico,privadoysocialparalarealizacin
de acciones, programas y proyectos sectoriales dentro del proceso de ordenamiento
ecolgicoregional,enelmbitodesucompetencia;

II. Formular, aplicar, expedir, ejecutar, evaluar y modificar los programas de ordenamiento
ecolgico regional de la Entidad con la participacin que corresponda a otras
dependenciasyentidadesdelaAdministracinPblica;

III. Promover la incorporacin de la variable ambiental en la planeacin de acciones,
proyectos y programas de la Administracin Pblica Estatal, que incidan en el patrn de
ocupacindelterritorioatravsdelordenamientoecolgicoregional;

IV. Presidirloscomitsdeordenamientoecolgicoregionaldelterritorio;

V. Participarenlaformulacindelosprogramasdeordenamientoecolgicoderegionesque
abarquen una parte del territorio del Estado de Chihuahua y de una o ms o ms
entidades federativas, en coordinacin con el Ejecutivo Federal, los gobiernos de los
estados,susmunicipios,mediantelasuscripcindelosconveniosrespectivos;

VI. Participar en la elaboracin y aprobacin de los programas de ordenamiento ecolgico
local;

VII. PrestarapoyotcnicoalosmunicipiosdelaEntidadparalaformulacinyejecucindelos
programasdeordenamientoecolgicolocal;

VIII. Integrar, instrumentar y administrar el Sistema de Informacin Estatal sobre el
Ordenamiento Ecolgico, as como emitir los criterios necesarios para promover su
congruencia;

IX. EstablecerlosmecanismosdepromocinydifusindelSubsistema;

X. Celebrar convenios de concertacin con personas, organizaciones, grupos e instituciones
de los sectores privado y social para la realizacin de acciones conjuntas en materia de
ordenamientoecolgico;

XI. Emitir los criterios, lineamientos y estrategias para determinar los requisitos,
especificaciones, procedimientos, metas o parmetros que debern observar las
24
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

autoridades encargadas de la formulacin e instrumentacin de procesos de


ordenamientoecolgicoregional;

XII. Establecer los procedimientos e instrumentos que promuevan la participacin social
corresponsableenelprocesodeordenamientoecolgicoregional;y

XIII. LasdemsprevistasenesteReglamentoyenotrasdisposicioneslegalesyreglamentarias
enlamateria.

ARTCULO 67. Las dependencias y entidades de la Administracin Pblica proporcionarn a la
Secretara la informacin y el apoyo tcnico que requiera para la formulacin, expedicin,
ejecucin,evaluacinymodificacindelosprogramasdeordenamientoecolgicoregional.

SECCINII
DELPROCESODEORDENAMIENTOECOLGICO

ARTCULO68.Elordenamientoecolgicoregionaldeberllevarseacaboatravsdeunproceso
deplaneacinquepromueva:

I. La creacin e instrumentacin de mecanismos de coordinacin entre las dependencias y
entidadesdelaAdministracinPblicaEstatalylosgobiernosmunicipalesydelgobierno
federalenelmbitodesucompetencia;

II. Laparticipacinsocialcorresponsabledelosgruposysectoresinteresados;

III. La transparencia del proceso mediante el acceso, publicacin y difusin constante de la
informacingenerada,losmtodosutilizadosyresultadosobtenidos;

IV. Elrigormetodolgicodelosprocesosdeobtencindeinformacin,anlisisygeneracin
deresultados;

V. La instrumentacin de procesos sistemticos que permitan verificar los resultados
generadosencadaetapadelprocesodeordenamientoecolgicoregional;

VI. La generacin de indicadores ambientales que permitan la evaluacin continua del
proceso de ordenamiento ecolgico regional para determinar la permanencia de los
programas,suajusteolacorreccindedesviacionesensuejecucin;

VII. La asignacin de lineamientos y estrategias ecolgicas con base en la informacin
disponible;

VIII. Elestablecimientodeunsistemademonitoreodelprogramadeordenamientoecolgico;
y

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 25

IX. La permanencia o modificacin de lineamientos y estrategias ecolgicas a partir del


anlisisdelosresultadosdelmonitoreo.

El proceso de ordenamiento ecolgico deber prever mecanismos para determinar con una
periodicidad bienal, el cumplimiento de las metas previstas en los programas, as como la
evaluacindelosresultadosrespectodelasexpectativasdeordenacinplanteadas.

La Secretara promover que la modificacin de los programas de ordenamiento ecolgico
regional,sigaelmismoprocedimientoqueparasuformulacin.

ARTCULO 69. El ordenamiento ecolgico regional se realizar mediante el proceso de
ordenamientoecolgicoydebertenercomoresultadolossiguientesproductos:

I. Conveniosdecoordinacinquepodrnsuscribirsecon:

a) Las dependencias y entidades de la Administracin Pblica competentes y los
municipios,pararealizaraccionesqueincidanenelreadeestudio.

II. Programasdeordenamientoecolgicoregional,quedeberncontener:

a) El modelo de ordenamiento ecolgico que contenga la regionalizacin o la
determinacin de las zonas ecolgicas, segn corresponda, y los lineamientos
ecolgicosaplicablesalreadeestudio,yensucaso,sudecretodeexpedicin;y

b) Lasestrategiasecolgicasaplicablesalmodelodeordenamientoecolgico;y

III. Labitcoradeordenamientoecolgico.

ARTCULO 70. Los convenios de coordinacin tendrn los siguientes objetivos en los procesos
para determinar las acciones, plazos y compromisos que integran la agenda del proceso de
ordenamientoecolgicoydeberncontenercomomnimo:

I. Establecer las bases para precisar el rea de estudio que abarcar el proceso de
ordenamientoecolgico;

II. La identificacin y designacin de las autoridades e instituciones que llevarn a cabo las
acciones que resulten de los convenios o acuerdos de coordinacin, as como la
participacin y la responsabilidad que les corresponda a cada una de ellas en la
conduccineinstrumentacindelprocesodeordenamientoecolgico;

III. La integracin del rgano que instrumentar y dar seguimiento al proceso de
ordenamientoecolgico;

26
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

IV. Lasaccionesinicialesquedebarealizarcadapartedelconvenioparagarantizarelinicioy
desarrolloeficazdelprocesodeordenamientoecolgico;

V. Ladeterminacindelosproductosquedebernobtenersecomoresultadodelprocesode
ordenamientoecolgicorespectivo;

VI. Las dems normas oficiales mexicanas y normas tcnicas estatales que deban incluirse
comoanexosdelosconveniosdecoordinacin;

VII. Las dems estipulaciones que las partes consideren necesarias para el correcto
cumplimientodeloscompromisosdelconvenio.

ARTCULO 71. Los anexos de los convenios de coordinacin a que se refiere el artculo anterior
deberncontener,comomnimo:

I. La identificacin de los conflictos ambientales que debern prevenir o resolverse
medianteladeterminacindelineamientosyestrategiasecolgicas;

II. Los procedimientos de acceso a la informacin y de participacin social corresponsable
quedeberninstrumentarseencadaetapadelprocesodeordenamientoecolgico;

III. Los procedimientos y los plazos para la revisin integral del programa de ordenamiento
ecolgico;

IV. Los indicadores que se utilizarn para evaluar el cumplimiento y la efectividad del
programadeordenamientoecolgico;

V. Las acciones a realizar para la integracin y operacin de la bitcora de ordenamiento
ecolgico;y

VI. Los mecanismos de financiamiento y dems instrumentos econmicos que se utilizarn
paraelprocesodeordenamientoecolgico.

ARTCULO72.Losconveniosdecoordinacin,susanexosylosconveniosdeconcertacinquese
celebrendentrodelprocesodeordenamientoecolgico,seconsiderandederechopblicoysern
decumplimientoobligatorioparalaspartesqueloscelebren.

Para efectos del prrafo anterior, en los convenios de coordinacin y concertacin que se
suscribanseestablecernlasconsecuenciasylassancionesquesederivendesuincumplimiento,
afindeasegurarelintersgeneralygarantizarsuejecucinentiempoyforma.

Los convenios que se suscriban con la Federacin debern publicarse en el Peridico Oficial del
Estado.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 27

ARTCULO 73. El rgano que se encargar de la conduccin del proceso de ordenamiento


ecolgico,entrminosdelconveniodecoordinacinrespectivo,deberestablecerlasbasespara
suoperacin,lasaccionesnecesariasparalaformulacindelmodelodeordenamientoecolgico,
lasestrategiasecolgicasylaintegracindelabitcoradeordenamientoecolgico,atendiendoa
lodispuestoenlosArtculos31,32y33delaLey.

ARTCULO 74. En la determinacin de los lineamientos y estrategias ecolgicas aplicables al
programadeordenamientoecolgico,sedeberconsiderarcomomnimolosiguiente:

I. Losprogramasdecombatealapobrezaaplicablesporlostresrdenesdegobiernoenel
readeestudio;

II. Los proyectos y los programas de las dependencias y entidades de los tres rdenes de
gobierno,aplicablesenelreadeestudio;

III. Los instrumentos de poltica ambiental que, conforme a la legislacin vigente, resulten
aplicablesalreadeestudio;

IV. Lasreasnaturalesprotegidas,loshbitatscrticosparalaconservacindelavidasilvestre
ylasreasderefugioparaprotegerespeciesacuticas;

V. Lasreascrticasparalaconservacindelosecosistemasylabiodiversidad;

VI. Lascuencashidrolgicas;

VII. Lazonificacinforestal;

VIII. Ladisponibilidaddeagua;

IX. Elcambioclimticoylosdesastresnaturales;

X. Los impactos negativos de las actividades productivas y sociales, incluyendo aqullos de
baja probabilidad de ocurrencia, que tengan o puedan tener efectos en el
aprovechamientosustentabledelosrecursosnaturales,elmantenimientodelosbienesy
losserviciosambientalesylaconservacindelosecosistemasylabiodiversidadenelrea
deestudio;y

XI. Las dems que determine el rgano encargado de la conduccin del proceso de
ordenamientoecolgicoy,queporsuscaractersticas,debandeserconsideradas.

ARTCULO75.Elregistrodelosavancesdelprocesodeordenamientoecolgicosellevaracabo
enlabitcoradeordenamientoecolgicoytendrporobjeto:

28
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

I. Proporcionar e integrar informacin actualizada sobre el proceso de ordenamiento


ecolgico;

II. Seruninstrumentoparalaevaluacinde:

a) Elcumplimientodelosacuerdosasumidosenelprocesodeordenamientoecolgico;y

b) Elcumplimientoylaefectividaddeloslineamientosyestrategiasecolgicas;

III. Fomentar el acceso de cualquier persona a la informacin relativa al proceso de
ordenamientoecolgico;y

IV. Promover la participacin social corresponsable en la vigilancia de los procesos de
ordenamientoecolgico.

ARTCULO76.Labitcoradeordenamientoecolgicodeberincluir:

I. Elconveniodecoordinacin,susanexosy,ensucaso,lasmodificacionesqueserealicena
losmismos;

II. Elprogramadeordenamientoecolgico;

III. Losindicadoresambientalesparalaevaluacinde:

a) Elcumplimentodeloslineamientosyestrategiasecolgicas;y

b) La efectividad de los lineamientos y estrategias ecolgicas en la solucin de los
conflictosambientales;y

IV. Los resultados de la evaluacin del cumplimiento y de la efectividad del proceso de
ordenamientoecolgico.

ARTCULO77.Lacartografa,monitoreodelaire,basesdedatosydocumentosqueformenparte
de la bitcora de ordenamiento ecolgico, debern apegarse a los formatos y estndares que
establezcalaSecretaraparasuintegracinalSubsistema.

ARTCULO78.LosindicadoresambientalesaqueserefierelafraccinIIIdelartculo76tendrn
porobjeto:

I. Identificar cambios en la calidad de los recursos naturales o la evolucin de conflictos
ambientales;y

II. Facilitarlacomparacindesitiosmonitoreadosenelcorto,medianoylargoplazos.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 29

ARTCULO 79. La Secretara promover el acceso a la informacin y la participacin social


corresponsable en cada etapa del proceso de ordenamiento ecolgico mediante la realizacin,
entreotras,delassiguientesacciones:

I. IncorporaralSistemaEstataldeOrdenamientoEcolgico,lainformacinquesegenereen
cadaetapa;

II. Incorporaralosprogramasrespectivoslosresultadosdelosmecanismosdeparticipacin
socialutilizadosenelprocesodeordenamientoecolgico;y

III. Promoverlasuscripcindeconveniosdeconcertacinconlosdiversosgruposysectores
privadoysocialparalarealizacindeaccionesconjuntas,dirigidasalaaplicacinefectiva
delosprogramasdeordenamientoecolgico.

ARTCULO 80. La Secretara podr disear, aplicar y gestionar los instrumentos econmicos
previstos en el artculo 172 de la Ley, que incentiven la participacin de las autoridades y las
personasinvolucradasencadaetapadelprocesodeordenamientoecolgico.

SECCINIII
ORDENAMIENTOECOLGICOREGIONAL

ARTCULO81.LosconveniosquesuscribaelGobiernodelEstadoconelGobiernoFederalyensu
casoconotrosEstados,conlaparticipacinquecorrespondaalosmunicipios,paralaformulacin
delosprogramasdeordenamientoecolgicoaqueserefiereelartculo20BIS2delaLeyGeneral
y33delaLey,ademsdelosrequisitossealadosenelartculo70deesteReglamento,debern
establecer,entreotrosaspectos:

I. Lasmateriasyactividadesqueconstituyenelobjetodelconveniorespectivo;

II. La congruencia con las disposiciones del Plan Nacional de Desarrollo, el Plan Estatal de
Desarrollo,laprogramacinsectorialambiental,yelprogramadeordenamientoecolgico
regional;

III. Lasobligacionesdelaspartes;

IV. Lasautoridadesdelostresrdenesdegobiernoqueestarnrepresentadasenelcomit
regionaldeordenamientoecolgicorespectivo;

V. Las personas, organizaciones, grupos e instituciones de los sectores privado y social que
formarnpartedelcomitregionaldeordenamientoecolgicorespectivo;y

VI. Unplandetrabajoqueincluya:

a) Losobjetivosymetasquesepretendanalcanzar;
30
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


b) La revisin del marco jurdico aplicable para la instrumentacin del programa de
ordenamientoecolgicoregional;

c) Elcronogramadelasactividadesarealizar;

d) Lavigenciadelconvenio,susmecanismosdeterminacin,solucindecontroversiasy,
ensucaso,modificacinyprrroga;

e) Los rganos que llevarn a cabo las acciones que resulten de los convenios de
coordinacin,incluyendolosdeevaluacin;

f) Las bases para identificar los recursos materiales y financieros, y dems necesarios
paralarealizacindelasaccionesprevistas,ascomolosresponsablesdefacilitarlosy,
ensucaso,aportarlos;y

g) Los mecanismos para incorporar a la bitcora de ordenamiento ecolgico los
resultadosdelaevaluacindelprocesodeordenamientoecolgico.

ARTCULO 82. Para la formulacin de los programas de ordenamiento ecolgico regional, se
debernrealizarlassiguientesacciones:

I. Identificar las actividades sectoriales que inciden en el rea de estudio, as como su
relacin con posibles conflictos ambientales que generen, sobre todo con respecto a la
oferta y demanda de recursos naturales; el mantenimiento de los bienes y servicios
ambientales, as como de la proteccin y conservacin de los ecosistemas y de la
biodiversidad;

II. Ubicarlaszonasdondesepresentenconflictosambientalesquedebanresolverseconla
aplicacin de las estrategias ecolgicas definidas en el programa de ordenamiento
ecolgico;y

III. Generar un modelo de ordenamiento ecolgico que maximice el consenso entre los
sectores, minimice los conflictos ambientales y favorezca el desarrollo sustentable en la
regin.

ARTCULO 83. Los estudios tcnicos para la realizacin de los programas de ordenamiento
ecolgico regional debern realizarse a travs de las siguientes etapas de caracterizacin,
diagnstico,pronsticoypropuesta.

Laejecucindeestasetapassesujetaraloslineamientosymecanismosquedetermineelcomit
regionaldeordenamientoecolgicorespectivo.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 31

ARTCULO 84. La etapa de caracterizacin tendr por objeto describir el estado de los
componentes natural, social y econmico del rea de estudio, considerando, entre otras, las
siguientesacciones:

I. Delimitar el rea de estudio, considerando las actividades sectoriales, las cuencas, los
ecosistemas,lasunidadesgeomorfolgicasyloslmitespolticoadministrativos,lasreas
deatencinprioritaria,ydemsinformacinnecesaria;

II. Identificar y describir el conjunto de atributos ambientales que reflejen los intereses
sectorialesdentrodelreadeestudio;

III. Identificar los intereses sectoriales y atributos ambientales a travs de mecanismos de
participacinsocialcorresponsable;y

IV. Establecer criterios para identificar prioridades entre los atributos ambientales y los
interesessectorialesenlasreasdeestudio.

Elproductofinaldelaetapadecaracterizacindeberserpresentada,entreotrosrequisitos,en
informacinmesurableyeninstrumentoscartogrficos.

ARTCULO 85. La etapa de diagnstico tendr por objeto identificar y analizar los conflictos
ambientalesenelreadeestudio,mediantelarealizacindelassiguientesacciones:

I. Elaborar un anlisis de aptitud para los sectores involucrados en las actividades de
aprovechamiento de los recursos naturales, la conservacin de los ecosistemas y la
biodiversidad y el mantenimiento de los bienes y servicios ambientales en el rea de
estudio,delcualseproducirelmapadeaptituddelterritoriocorrespondiente;

II. Identificar los conflictos ambientales a partir del anlisis de la concurrencia espacial de
actividadessectorialesincompatibles;y

III. Delimitar las reas que se debern preservar, conservar, proteger o restaurar, as como
aquellas que requieran el establecimiento de medidas de mitigacin para atenuar o
compensarimpactosambientalesadversos,considerando:

a) Degradacinambiental,desertificacinocontaminacin;

b) Conservacindelosecosistemasylabiodiversidadyelmantenimientodelosbienesy
serviciosambientales;

c) reasnaturalesprotegidas,hbitatscrticosparalaconservacindelavidasilvestrey
reasderefugioparaprotegerespeciesacuticas;

d) Recursosnaturalesimportantesparaeldesarrollodeactividadessectoriales;
32
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


e) Susceptibilidadariesgosnaturalesoaefectosnegativosdelcambioclimtico;y

f) Losdemsqueserequieranparaefectosdeestafraccin.

ARTCULO 86. La etapa de pronstico tendr por objeto examinar la evolucin de los conflictos
ambientales, a partir de la previsin de las variables naturales, sociales y econmicas. En esta
etapaseconsiderar,demaneraenunciativa,msnolimitativa:

I. Eldeteriorodelosbienesyserviciosambientales;

II. Losprocesosdeprdidadecoberturavegetal,degradacindeecosistemasydeespecies
sujetasaproteccin;

III. Losefectosdelcambioclimtico;

IV. Las tendencias de crecimiento poblacional y las demandas de infraestructura urbana,
equipamientoyserviciosurbanos;

V. Los impactos ambientales acumulativos considerando sus causas y efectos en tiempo y
lugar;y

VI. Las tendencias de degradacin de los recursos naturales y de cambio de los atributos
ambientalesquedeterminanlaaptituddelterritorioparaeldesarrollodelasactividades
sectoriales.

ARTCULO 87. La etapa de propuesta tendr por objeto generar el modelo de ordenamiento
ecolgicodelterritorio,enelcualseincluirnloslineamientosyestrategiasecolgicas.

ARTCULO88.Loslineamientosyestrategiasecolgicas,aquehacereferenciaelartculoanterior,
deberncontenerloscriteriosparalaregulacinambientaldelosasentamientoshumanosaque
serefiereelartculo37delaLey.

ARTCULO 89. La Secretara deber someter, con la concurrencia de los Municipios, en los
trminos de los convenios respectivos, el producto final de la etapa de caracterizacin y la
propuesta de programa de ordenamiento ecolgico regional a un proceso de consulta pblica
conformealassiguientesbases:

I. La realizacin de talleres de planeacin para promover la participacin social
corresponsable;

II. Lapublicacindeunavisoqueindiqueellugardondepuedaconsultarselainformacina
queserefiereesteartculo,ascomoelplazoyprocedimientospararecibirlaspropuestas,
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 33

estableciendo los espacios y los medios donde el pblico podr manifestar sus
observaciones.

LaSecretaraanalizarlasobservacionesquesepresentenduranteelprocesodeconsultapblica,
aefectodequeseconsiderenenelprogramayencasodeserdesechadasdeberargumentarlas
razonestcnicasy/ojurdicas.

III. Laconvocatoriaaunareuninpblicadeinformacinenlosmediosdedifusinoficialdel
Estadoconlaparticipacinquecorrespondaasusmunicipios.

ARTCULO 90. La Secretara promover la modificacin de los programas de ordenamiento
ecolgico a que hace referencia la presente Seccin cuando se d, entre otros, alguno de los
siguientessupuestos:

I. Los lineamientos y estrategias ecolgicas ya no resulten necesarios o adecuados para la
disminucin de los conflictos ambientales y el logro de los indicadores ambientales
respectivos;y

II. Las perturbaciones en los ecosistemas causadas por fenmenos fsicos o meteorolgicos
quesetraduzcanencontingenciasambientalesqueseansignificativasyponganenriesgo
elaprovechamientosustentabledelosrecursosnaturales,elmantenimientodelosbienes
yserviciosambientalesylaconservacindelosecosistemasylabiodiversidad.

ARTCULO91.Lamodificacindeloslineamientosyestrategiasecolgicasaquehacereferencia
la fraccin I del artculo anterior se podr realizar, entre otros supuestos, cuando conduzca a la
disminucindelosimpactosambientalesadversosocasionadosporlasactividadesproductivas,los
asentamientoshumanosyelaprovechamientodelosrecursosnaturales.

ARTCULO92.Lasmodificacionesaunprogramadeordenamientoecolgicoseguirnlasmismas
reglasyformalidadesestablecidasparasuexpedicin.

SECCINIV
DELAPARTICIPACINENLOSPROGRAMASDEORDENAMIENTOECOLGICOLOCAL

ARTCULO 93. La Secretara participar en la formulacin y aprobacin de los programas de
ordenamientoecolgicolocalenloscasosprevistosenlaLeyyenlaLeyGeneral.

ARTCULO94.LaparticipacindelaSecretaraenlaformulacinyaprobacindelosprogramas
localesdeberllevarseacaboconformealassiguientesbases:

I. Propondrlarealizacindeprocesosdeordenamientoecolgico;

II. Promoverquelosestudiostcnicoscorrespondientesserealicenconformealodispuesto
enelartculo83delpresenteReglamento;y
34
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


III. Promoverqueparalaaprobacindelprogramarespectivo,losmunicipiosyensucasoel
gobierno federal observen las formalidades establecidas en la legislacin aplicable en el
mbitodesucompetencia.

SECCINV
SISTEMADEINFORMACINESTATALSOBREELORDENAMIENTOECOLGICO

ARTCULO 95. La Secretara desarrollar un Sistema de Informacin Estatal sobre el
OrdenamientoEcolgico,queestaradisposicindelosinteresadosytendrporobjetoregistrar,
organizar,actualizarydifundirlainformacindisponiblesobreelordenamientoecolgicoregional
enlaEntidad.

ARTCULO96.LaSecretaraincorporaraesteSistemalasbitcorasdeordenamientoecolgico
que sean competencia del Estado y los Municipios, as como de aquellos que se realicen con la
Federacinmediantelasuscripcindeconveniosdecoordinacin.

ARTCULO 97. La Secretara emitir lineamientos y criterios que determinen formatos y los
estndares para la presentacin de los productos derivados del proceso de ordenamiento
ecolgicoquecorresponda,parasuinclusinenelSistema.

ARTCULO 98. La Secretara emitir los lineamientos para la inclusin de las autorizaciones,
concesionesydemspermisosdesucompetenciaqueseotorguenenlasreasdeestudiodelos
diferentesprogramasdeordenamientoecolgicoenelSistema.

SECCINVI
COMITESDEORDENAMIENTOECOLGICO

ARTCULO 99. Para la integracin de los comits de ordenamiento ecolgico, la Secretara y el
Consejo promover la participacin de personas, organizaciones, grupos e instituciones de los
sectores pblico, privado y social, con el fin de lograr la congruencia de planes, programas y
accionessectorialesenelreadeestudio,ascomoresolverlosconflictosambientalesypromover
eldesarrollosustentable.

ARTCULO100.Loscomits,seajustarnaloquesedetermineenelconveniodecoordinacin
respectivoylaSecretarapromoverqueestoscuentenconlassiguientesatribuciones:

I. Fomentar la articulacin del programa de ordenamiento ecolgico respectivo con el
programadeordenamientoecolgicoregionaldelterritorio;

II. Verificarqueenlosprocesosdeordenamientoecolgico,seobserveloestablecidoenla
SeccinIICaptuloITituloIIIdelpresenteReglamento;

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 35

III. Verificar que los resultados del proceso de ordenamiento ecolgico se inscriban en la
bitcora de ordenamiento ecolgico, cuando cumplan con los requerimientos que se
establezcanenelSistemadeInformacinEstatalsobreelOrdenamientoEcolgico;

IV. Sugerirlamodificacindelosplanes,losprogramasylasaccionessectorialesenelreade
estudioylasuscripcindelosconveniosnecesarios;y

V. Lasdemsqueseannecesariasparaelcumplimientodesuobjeto.

ARTCULO101.LaSecretarapromoverqueloscomitsaquehacereferenciaelartculo99del
Reglamentocuentencon:

I. Unrganoejecutivoresponsabledelatomadedecisionesparalainstrumentacindelas
acciones, procedimientos, estrategias y programas del proceso de ordenamiento
ecolgico, y que estar integrado por las autoridades y miembros de la sociedad civil
determinadosenelconveniodecoordinacinrespectivo;y

II. Un rgano tcnico encargado de la realizacin de los estudios y anlisis tcnicos
necesarios para la instrumentacin de las acciones, procedimientos, estrategias y
programasdelprocesodeordenamientoecolgico.

ARTCULO 102. La Secretara promover que cada comit elabore su reglamento interior, en el
cualseestablecernlosmecanismosyprocedimientosparasufuncionamiento.

CAPTULOII
ENMATERIADEIMPACTOAMBIENTAL

SECCINI
DISPOSICIONESGENERALES

ARTCULO103.EnmateriadeimpactoambientalcorrespondealaDireccin:

I. Evaluar el impacto ambiental y emitir las resoluciones correspondientes para la realizacin de
proyectos de obras o actividades a que se refiere la Ley de Equilibrio Ecolgico y Proteccin al
AmbientedelEstadodeChihuahuayelpresenteReglamento;

II.Formular,publicaryponeradisposicindelpblicolasguasparalapresentacindelInforme
Preventivo,elManifiestodeImpactoAmbientalydelEstudiodeAnlisisdeRiesgo;

III.SolicitarlaopinindeotrasDependenciasdelostresrdenesdegobiernoydeexpertosenla
materiaparaquesirvandeapoyoalasevaluacionesdeimpactoambientalqueseformulen;

36
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

IV.Vigilarelcumplimientodelasdisposicionesdeestereglamento,ascomolaobservanciadelas
resoluciones previstas en el mismo, e imponer las sanciones y dems medidas de control y
seguridadnecesarias,conarregloalasdisposicioneslegalesyreglamentariasaplicables,y

V.LasdemsprevistasenesteReglamentoyenotrasdisposicioneslegalesyreglamentariasenla
materia.

SECCINII
PROCEDIMIENTODEEVALUACINDELIMPACTOAMBIENTAL

ARTCULO 104. Para obtener la autorizacin a que se refiere la fraccin I Artculo 103 de este
reglamento,elinteresadoenformapreviaalarealizacindelaactividaddequesetrate,deber
presentar a la Direccin una manifestacin de impacto ambiental o bien un informe preventivo
que indique que la actividad de que se trate no causar desequilibrio ecolgico. La Direccin
analizarelinformepreventivoycomunicaralinteresadosiprocedeonounamanifestacinde
impactoambientalconformelasnormastcnicasecolgicasexistentes.

ARTCULO 105. Quienes pretendan llevar a cabo alguno de las siguientes obras o actividades,
debern sujetarse en estricto apego a lo contemplado en el artculo que antecede, siempre y
cuandonoseanobrasoactividadesreservadasexclusivasdelaFederacin;

I. Caminos,puentesyvasgeneralesdecomunicacinnoreservadasalaFederacin;

II. Zonas y Parques Industriales, Naves Industriales, Fraccionamientos y Unidades
Habitacionales,MercadosdeAbasto,CentrosdeEspectculoseInstalacionesDeportivasy
Recreativasyterminalesindependientesdeautobusesyconstruccinengeneral;

III. Hospitales,Sanatorios,Cementerios,FunerariasyCrematorios;

IV. DesarrollosTursticosEstatalesyPrivados;

V. Instalacindetratamientos,confinamientoy/oeliminacindeaguasresiduales;

VI. Instalacin de tratamiento, confinamiento y/o eliminacin de residuos slidos no
peligrososyrellenossanitarios;

VII. AutoConsumodeHidrocarburosydeGasL.P.

VIII.Extraccindecanteras,arena,gravayarcilla;

IX. FabricacindeAlimentos:

a) Preparacinyenvasedefrutasylegumbres.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 37

b) Beneficiodecerealesyotrosgranosyfabricacindeproductosdemolino.
c) Matanzadeganadoypreparacin,conservacinyempacadodecarnes.
d) Fabricacinytratamientodeproductoslcteos.
e) Preparacin,conservacinyenvasadodepescadosymariscos.
f) Beneficioymoliendadecerealesyotrosproductosagrcolas.
g) Fabricacin de chocolates, dulces, confituras, jarabes, concentrados y colorantes para
alimentos.
h) Fabricacindeproductosalimenticiosdiversos.
i) Fabricacindeproductosdepanadera,nixtamalytortillas.
j) Fabricacindeaceitesygrasascomestibles.
k) Fabricacindealimentosparaganado.

X. IndustriaTextil:

a) Preparacin,hilado,tejidoyacabadodetextilesdefibrasblandas.
b) Fabricacindetejidosyartculosdepunto.
c) Preparacin,hilado,tejidoyacabadodetextilesdefibrasdurasycordeleradetodotipo.
d) Fabricacindeotrosproductostextiles,tapicesyalfombras.
e) Fabricacindeprendasdevestir.
f) Fabricacindeotrosartculosconfeccionadoscontextilesyotrosmateriales.

XI. Fabricacindecalzadoeindustriadelcuero:

a) Fabricacindecalzado,exceptolosmoldeadosdehuleoplstico.
b) Industriasdelcueroypielymaterialessucedneos.

XII. Industriayproductosdemadera,corchoycarbnvegetal:

a) Fabricacindeproductosdeaserraderos,triplayysimilares.
b) Fabricacindeenvasesdemaderayartculosdepalma,carrizoysimilares.
c) Fabricacindeotrosartculosdemaderaycorcho.
d) Fabricacindeproductosdecarbnvegetalysusderivados.
e) Fabricacin y reparacin de muebles y accesorios, excepto los de metal y los de plstico
moldeado,incluyecolchones.

XIII. Industriaseditorialdeimpresinyconexas;

a) Industriaeditorial.
b) Impresin,encuadernacinyactividadesconexas.
38
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


XIV.Fabricacindeproductosdehuleyplstico:

a) Fabricacindeproductosdehule,bolsas,tuberayenvases.
b) Fabricacindematerialesyartculosdeplstico.
c) Fabricacinyrevitalizacindellantasdecmara.
d) Fabricacindeartculosdeplsticoyjuguetes.

XV.FabricacindeproductosmineralesnoreservadosalaFederacinymezclasasflticas:

a) Fabricacindeartculosdebarro,lozayporcelana.
b) Fabricacindevidrioyproductosdevidrio,fibrasdevidrioysusproductos.
c) Fabricacindeproductosdearcillaparalaconstruccin.
d) Fabricacindeconcretohidrulico,concretopremezclado,mrmol.
e) Fabricacindeotrosproductosdemineralesnometlicos.
f) Fabricacindemezclasasflticas.

XVI.Fabricacindeproductosmetlicos,ensambleyreparacindemaquinaria,equipoysus
partes.

a) Fabricacindeutensiliosagrcolas,herramientasdemanoyartculosdeferretera.
b) Fabricacindemueblesmetlicos,accesoriosysureparacin.
c) Fabricacindeproductosmetlicosestructurales,tanques,calderasysimilares.
d) Fabricacindeotrosproductosmetlicos.
e) Fabricacin, ensamble y reparacin de mquinasherramientas y equipos para trabajar
madera,metalesyotrosmateriales.
f) Fabricacin,ensambleyreparacindemaquinariayequipoparaindustriasespecficas.
g) Fabricacin,ensambleyreparacindemaquinaraparaoficina.
h) Fabricacin, ensamble y reparacin de maquinara y equipo de uso comn a varias
industrias.

XVII. Fabricacin y ensamble de maquinaria, equipo, aparatos, accesorios y artculos


elctricosyelectrnicosysuspartes:

a) Fabricacin, ensamble y reparacin de transformadores, motores y otra maquinaria y
equipodegeneracinyutilizacindelaenergaelctrica.
b) Fabricacindeequipoyaparatosderadio,televisinycomunicaciones.
c) Fabricacinyensambledeaparatoselctricosdeusodomsticoysuspartes.
d) Fabricacindeotrosaparatos,accesoriosysuministroselctricos.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 39

XVIII.Otrasindustriasmanufactureras:

a) Fabricacin y reparacin de instrumentos de medida y control, equipo y aparatos
cientficosyprofesionales.
b) Fabricacindeaparatos,instrumentosyaccesoriosdepticayfotografa.
c) Fabricacinyensamblederelojesysuspartes.
d) Fabricacindejoyas,artculosdeorfebreraydefantasa.
e) Fabricacinyensambledeinstrumentosmusicalesysuspartes.
f) Fabricacindeaparatosyartculosmusicalesysuspartes.
g) Fabricacindeaparatosyartculosdeportivos,incluyeequipodebillar,bolicheydepesca.
h) Industriamanufactureranoclasificadaanteriormente.

XIX.IndustriaAutomotriz:

a) Fabricacindearneses.
b) Fabricacindevidriosautomotrices.
c) Fabricacinyensambledebicicletasysimilares.
d) Fabricacindeaccesoriosautomotrices.
e) Talleresmecnicos,tallerdeenderezadoypintura,serviciodelavadoyengrasado.

XX.SubestacionesElctricas;

XXI. Obras hidrulicas como presas de control de avenidas y riego menores, pozos aislados,
unidadeshidroagrcolasmenores,bordos,obrasderehabilitacin;

XXII.Construccineinstalacindesitiosparaelalmacenamientotemporaldemateriales
peligrosos;y

XXIII. Las dems que la Secretara establezca siempre y cuando no sean exclusivas de la
Federacin.

ARTCULO 106. Corresponde a los Municipios, autorizar las actividades y/u obras, que se
encuentrenbajoConveniooAcuerdoconelGobiernodelEstado,atravsdelaSecretara,sinque
elloimpliquelaprdidadelasfacultadesqueleconfierelaLeydeEquilibrioEcolgicoyProteccin
al Ambiente del Estado de Chihuahua, mismo que podr ser revocado en cualquier momento,
previoavisoporescritocontreintadasdeanticipacin.

ParaquelosMunicipiosestnenposibilidadesdecelebrarelconvenioantescitado,tendrnque
cumplirconlosrequerimientosestablecidosporlaSecretara.

40
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO 107. El interesado deber presentar ante la Direccin la solicitud de autorizacin en


materiadeimpactoambiental,conlosrequisitosmnimoscontempladosenelartculo44delaLey
yelpresenteReglamento.

ARTCULO108.ElInformePreventivoseformularenapegoalaguaqueexpidalaDirecciny
debercontenercomomnimolainformacinsiguiente:

I. Datos generales de quien pretenda realizar la obra o actividad proyectada y de quien
hubiereelaboradolosproyectosoestudiosprevioscorrespondientes;

II. Descripcindelaobraoactividadproyectada,queincluyaladescripcindelambientey
ensucaso,laidentificacindeotrasfuentesdeemisindecontaminantesexistentesenel
readeinfluenciadelproyecto,losplanosdelocalizacindelreaenlaquesepretende
realizarelproyecto;

III. Descripcin de las sustancias o productos que vayan a emplearse en la ejecucin de la
obraoactividadylosqueensucasovayanaobtenersecomoresultadodelaactividad,
incluyendo emisiones a la atmsfera, descargas de aguas residuales, tipos de residuos o
procedimientosparasudisposicinfinal;

IV. Laidentificacindelosimpactosambientalessignificativosorelevantesyladeterminacin
delasaccionesymedidasparasuprevencinymitigacin;

V. Referencias segn corresponda a Normas Oficiales Mexicanas u otras disposiciones que
regulen las emisiones, las descargas, o el aprovechamiento de recursos naturales,
aplicables a la obra o actividad; al plan parcial de desarrollo urbano o de ordenamiento
ecolgicoenelcualquedaincluidalaobraoactividad;

VI. Comprobar fehacientemente y sin excepcin la implementacin y/o mantenimiento de
acciones y medidas preventivas y/o correctivas enfocadas a la proteccin de los suelos,
caminosyestacionamientospblicos,privadosypatiosdemaniobras.Loanteriortambin
aplicarpararutasdetrnsitovehicularenbancosdeextraccindematerialesconelfin
deevitarlacontaminacinporfiltracionescontaminantesycoadyuvarenelcontroldela
polucindelaireporpartculassusceptiblesdeaspersinalaatmsfera;y

VII. OriginaldelcertificadodeingresosemitidoporlaSecretaradeHacienda,queacrediteel
pagodelosderechoscorrespondientes.

El Informe Preventivo deber acompaarse en su caso de la proyeccin y propuesta que
contendr las acciones y/o medidas de prevencin, mitigacin y control para los impactos
ambientales identificados en cada una de las etapas, para reducir los impactos ambientales
adversosyelProgramadeRecuperacinyRestauracindelreaimpactadaalconcluirlavidatil
de la obra o al trmino de la actividad correspondiente, el cual deber contener la viabilidad
tcnicayjurdicaparasurealizacin.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 41


ARTCULO109.LaManifestacindeImpactoAmbiental,deberpresentarsecuandoporlaobrao
actividadarealizarse,elentornoambientaloecolgicosufracambiootransformacindefondoy
deberejecutarseenestrictoapegoalaguaqueparatalesefectosestablezcalaDireccin,lacual
debercontenercomomnimo,lainformacinsiguiente:

I. Nombre,denominacinoraznsocial,nacionalidad,ydomiciliodequienpretendallevara
cabolaobraoactividad;

II. Descripcindelaobraoactividadproyectada,desdelaetapadeseleccindelsitioparala
ejecucin de la misma; superficie de terreno requerido; programa de construccin,
montaje de instalaciones y operacin correspondiente; tipo de actividad, volmenes de
produccinprevistoseinversionesnecesarias;claseycantidadderecursosnaturalesque
habrn de aprovecharse, tanto en la etapa de construccin como en la operacin o el
desarrollo de la actividad; el programa para el manejo de residuos, tanto en la
construccinymontajecomodurantelaoperacinodesarrollodelaactividad;programa
para el abandono de la obra o cese de la actividad; descripcin del escenario ambiental
conanterioridadalaejecucindelproyectoyreasalternativasdeobra;

III. Aspectos socioeconmicos del rea donde pretenda desarrollarse la obra o actividad;
estudiosecolgicossobreelhbitat,lafloraylafauna,ydescripcindelposibleescenario
ambientalmodificadoporlaobraoactividaddequesetrate;

IV. Vinculacin con los ordenamientos jurdicos aplicables en materia ambiental y
regulacionessobreusodelsueloenelreacorrespondiente;

V. Identificacin, descripcin y evaluacin de los impactos ambientales que ocasionara la
ejecucindelproyectooactividadensusdistintasetapas.;

VI. Encasodediversificacindeproductos,cambiodemateriasprimasoprocesosdelaobra
o actividad inicialmente proyectadas se har necesaria la presentacin de un nuevo
manifiestoouncomplementodelmismo,acriteriodelaDireccin.

VII. Pronsticosambientalesy,ensucaso,evaluacindealternativas;

VIII. Identificacindelosinstrumentosmetodolgicosyelementostcnicosquesustentanlos
resultadosdelamanifestacindeimpactoambiental;

IX. Comprobar fehacientemente y sin excepcin la implementacin y/o mantenimiento de
acciones y medidas preventivas y/o correctivas enfocadas a la proteccin de los suelos,
caminosyestacionamientospblicos,privadosypatiosdemaniobras.Loanteriortambin
aplicarpararutasdetrnsitovehicularenbancosdeextraccindematerialesconelfin
deevitarlacontaminacinporfiltracionescontaminantesycoadyuvarenelcontroldela
polucindelaireporpartculassusceptiblesdeaspersinalaatmsfera;y
42
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


X. OriginaldelcertificadodeingresosemitidoporlaSecretaradeHacienda,queacrediteel
pagodelosderechoscorrespondientes.

La Manifestacin de Impacto Ambiental deber acompaarse en su caso de la proyeccin y
propuesta que contendr las acciones y/o medidas de prevencin, mitigacin y control para los
impactos ambientales identificados en cada una de las etapas, para reducir los impactos
ambientales adversos y el Programa de Recuperacin y Restauracin del rea impactada al
concluir la vida til de la obra o al trmino de la actividad correspondiente, el cual deber
contenerlaviabilidadtcnicayjurdicaparasurealizacin.

ARTCULO 110. Cuando la realizacin de las obras y/o actividades de que se trate sean
consideradasactividadesriesgosasdentrodelmbitoEstatal,encualquieradelasmodalidadesdel
estudio en materia de impacto ambiental, deber acompaarse de un estudio de anlisis de
riesgo.

ARTCULO 111. La Direccin podr requerir al interesado informacin adicional o
complementaria, cuando se requiera para hacer posible la evaluacin, as como solicitar los
elementostcnicosquesirvierondebaseparadeterminarelimpactoambiental.

En el caso de reincidir en el error o se omita en ms de dos ocasiones la presentacin de la
informacin requerida en la evaluacin del proyecto, se notificar la baja del tramite y deber
iniciarsenuevamente.

ARTCULO 112. La Direccin evaluar los estudios de impacto ambiental y si esta se ajusta a lo
previsto en este Reglamento emitir su resolucin dentro de los cuarenta y cinco das hbiles
posterioresasupresentacin.

Cuando para la evaluacin se requiera el dictamen tcnico a que se refiere el artculo 114 del
presente Reglamento, la resolucin correspondiente se emitir en un plazo mximo de sesenta
dashbilessiguientesalapresentacindelestudioenmateriadeimpactoambiental.

ARTCULO113.Enlaevaluacindelestudioenmateriadeimpactoambiental,seconsiderarnlos
siguienteselementos:

I. Elordenamientoecolgico;

II. LasdeclaratoriasdereasnaturalesprotegidasysusProgramasdeManejo;

III. Los criterios ecolgicos para la proteccin de la flora y la fauna silvestre; para el
aprovechamientoracionaldeloselementosnaturales,yparalaproteccindelambiente;

IV. Laregulacinecolgicadelosasentamientoshumanos;y

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 43

V. Los Reglamentos, Normas Oficiales Mexicanas, Normas Tcnicas Ecolgicas Estatales y


demsordenamientosydisposicioneslegalesrelacionadasconlamateria.

ARTCULO 114. Para la evaluacin de los estudios en materia de impacto ambiental de obras o
actividades que por sus caractersticas hagan necesaria la intervencin de otras Dependencias o
EntidadesdelaAdministracinPblicaEstatal,laDireccinpodrsolicitarastaslaformulacin
deunDictamenTcnicoalrespecto.

ARTCULO115.Unavezevaluadoelestudiodeimpactoambientaldelaobraoactividaddeque
setrate,laDireccinformularycomunicaralosinteresadoslaresolucincorrespondiente:

I. Autorizandolarealizacindelaobraoactividaddemaneracondicionada,enlostrminos
y/ocondicionessealadosenelestudio;

II. Autorizando la realizacin de la obra o actividad, de manera condicionada a la
modificacinoreubicacindelproyecto;y

III. Negandodichaautorizacin;

En los casos de la fraccin I y II, la Direccin precisar la vigencia de la autorizacin. Una vez
vencidalavigenciadelapresenteResolucin,yencasodequeelpromotornorealiceentiempoy
formalasolicituddeRevalidacinenelplazoestablecido,sinexcepcin,debertramitarunnuevo
estudiodeImpactoAmbiental.

ARTCULO 116. La ejecucin de la obra o actividad deber sujetarse a lo dispuesto en la
resolucinrespectivaylaDireccinpodrverificarencualquiermomentoelcumplimientodela
misma.

ARTCULO117.Todapersonafsicaomoral,pblicaoprivadaquepretendallevaracaboalguna
obraoactividadsujetaalaautorizaciny/orevalidacinenmateriadeimpactoambientalenel
Estado, deber sin excepcin implementar y mantener acciones y medidas preventivas y/o
correctivasenfocadasalaproteccindelossuelos,caminosyestacionamientospblicos,privados
ypatiosdemaniobras.Loanteriortambinaplicarpararutasdetrnsitovehicularenbancosde
extraccin de materiales con el fin de evitar la contaminacin por filtraciones contaminantes y
coadyuvar en el control de la polucin del aire por partculas susceptibles de aspersin a la
atmsfera.

ARTCULO 118. Cuando se realicen modificaciones al proyecto de obra o actividad durante el
procedimiento de evaluacin del impacto ambiental, el promovente deber hacerlas del
conocimiento de la Direccin, con el objeto de que sta, en un plazo no mayor de diez das,
procedaasolicitarinformacinadicionalparaevaluarlosefectosalambientederivadosdetales
modificaciones, cuando stas no sean significativas, o requerir la presentacin de un nuevo
estudiodeimpactoambiental,cuandolasmodificacionespropuestaspuedancausardesequilibrios
ecolgicos,daosalasalud,ocausarimpactosacumulativososinrgicos.
44
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


Todo interesado que desista de ejecutar una obra o actividad sometida a autorizacin, deber
comunicarloenformaescritaalaDireccin,duranteelprocedimientodeevaluacindelimpacto
ambiental,osiyasehubieraotorgadolaautorizacindelimpactoambiental,deberadoptarlas
medidas que determine la Direccin a efecto de que no se produzcan alteraciones nocivas al
equilibrioecolgicooalambiente.
Sielpromoventepretenderealizarmodificacionesalproyectodespusdeemitidalaautorizacin
enmateriadeimpactoambiental,debersometerlasalaconsideracindelaDireccin,laque,en
unplazonomayoradiezdas,determinar:Siesnecesarialapresentacindeunnuevoestudiode
impacto ambiental; si las modificaciones propuestas no afectan el contenido de la autorizacin
otorgada, o si la autorizacin otorgada requiere ser modificada con objeto de imponer nuevas
condicionesalarealizacindelaobraoactividaddequesetrata.
En este ltimo caso, las modificaciones a la autorizacin debern ser dadas a conocer al
promoventeenunplazomximodeveintedas.
ARTCULO 119. Cuando por cualquier causa no se lleve a cabo una obra o actividad en los
trminosdelaautorizacinotorgadaenmateriadeimpactoambiental,laSecretaraordenarla
suspensindelaobraoactividadyevaluarlascausasyconsecuenciasdelincumplimientoafin
deimponerlassancionesadministrativasquecorrespondan,yensucasoprocederpenalmentesi
existenbasesfundadas.

ARTCULO120.Encasodequeunavezotorgadalaautorizacindelimpactoambientalaquese
refiereelartculo115deesteReglamento,porcasofortuitoofuerzamayorsepresentarencausas
supervenientes del impacto ambiental, la Direccin podr en cualquier tiempo evaluar
nuevamente la manifestacin de impacto ambiental de que se trate y requerir al interesado la
presentacindelainformacinadicionalquefuerenecesariaparaevaluarelimpactoambientalde
laobraoactividadrespectiva.

La Direccin podr revalidar la autorizacin otorgada, as como modificarla, suspenderla o
revocarla, si estuviere en riesgo el equilibrio ecolgico o se produjeren efectos adversos en el
ambiente.

EntantolaDireccindictelaresolucinaqueserefiereelprrafoanterior,previaaudienciaque
otorgue a los interesados, podr ordenar la suspensin temporal, parcial o total de la obra o
actividad correspondiente en caso de peligro inminente de desequilibrio ecolgico o dao
ambiental.

ARTCULO 121. Debern contar con autorizacin previa de la Direccin en materia de impacto
ambiental las personas fsicas o morales que pretendan realizar actividades de construccin de
instalaciones, exploracin o aprovechamiento de recursos naturales, de repoblamiento,
traslocacin,recuperacin,trasplante,siembradeespeciesdeflora,fauna,silvestresoacuticas,
enreasnaturalesprotegidasdeintersEstatal.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 45

Los interesados en obtener la autorizacin a que se refiere el prrafo anterior, presentarn a la


Secretaraunamanifestacindeimpactoambiental,conformeloprevistoenlosartculos108,109
y110delpresenteReglamento.

ARTCULO 122. Quienes realizaron obras o actividades pblicas y privadas sin contar con la
autorizacin previa de la Direccin, independientemente de que en su caso se ordenen las
medidas correctivas o de urgente aplicacin, de seguridad y se apliquen las sanciones que
correspondan conforme a lo dispuesto en la Ley, el presente Reglamento y dems disposiciones
jurdicasaplicables,debernpresentarantelaDireccinunestudiodeimpactoambientalcomose
contemplaenlosartculos108,109y110delpresenteReglamento,segncorrespondacadacaso
enparticular.

Paralaimposicindelasmedidasdeseguridadylassanciones,laDireccindeberdeterminarel
grado de afectacin ambiental ocasionado o que pudiera ocasionarse por la realizacin de las
obrasoactividadesdequesetrate.

ARTCULO 123. Los estudios en materia de impacto ambiental a que se refiere el presente
Reglamento debern ser realizados por un Prestador de Servicios Profesionales Ambientales
debidamenteinscritoyautorizadoenelRegistroEstataldePrestadoresdeServiciosProfesionales
Ambientales en la Secretara de Desarrollo Urbano y Ecologa, para lo cual deber presentar la
documentacinqueestableceelArtculo126deesteReglamento.

ARTCULO124.Cualquierpersonaqueconsiderequeenlarealizacindeobrasoactividadesse
exceden los lmites y condiciones establecidos en las Normas Oficiales Mexicanas y reglamentos
para la proteccin del ambiente, podr denunciarlo a la Direccin y solicitar se considere la
procedencia de requerir a quienes lleven a cabo dicha obra o actividad, la presentacin de un
estudiodeimpactoambientalenlamodalidadquelecorresponda.

Eldenunciantedeberincluirsusdatosdeidentificacin,ylainformacinquepermitalocalizarel
lugarenqueseestejecutandolaobraoactividad,eidentificaraquienlalleveacabo.

ARTCULO 125. Recibida la solicitud a que se refiere el artculo que antecede y calificada de
procedente, la Direccin har una visita de inspeccin de la obra o actividad de los hechos
denunciadosylerequerirparaqueenunplazodediezdashbilesapartirdequesurtaefectos
lanotificacin,presenteladocumentacinrequeridaymanifiesteloqueasuderechoconvenga.

LaDireccinanalizarelinformedelapersonaquerealicelaobraoactividad,llevaracabolas
verificacionesqueprocedan,yenelplazodediezdashbilescomunicaralapersonarequerida
si procede o no un estudio en materia de impacto ambiental. En tanto la Direccin comunique
dicha resolucin, previa audiencia de los interesados podr ordenar como medida de seguridad
cuando exista riesgo inminente de desequilibrio ecolgico o afectaciones graves al ambiente, la
suspensin total o parcial, temporal o definitiva de la realizacin de la obra o actividad,
independientementedelassancionesadministrativasqueprocedan.

46
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

La Direccin podr exigir al solicitante el cumplimiento de las remediacin solicitada establecida en


las autorizaciones en materia ecolgica, as como las aportaciones en especie destinadas a la
educacin ambiental o actividades para el mejoramiento del medio ambiente.

SECCINIII
REGISTROESTATALDELOSPRESTADORESDESERVICIOSPROFESIONALESAMBIENTALES

ARTCULO 126. La Direccin establecer un Registro Estatal de Prestadores de Servicios
Profesionales Ambientales que realicen estudios en materia de impacto y riesgo ambiental, por
girodeespecialidaddeacuerdoallistadoqueparaelefectoladireccinemita.

Los interesados en inscribirse presentarn ante la Direccin una solicitud, con la informacin y
documentossiguientes:

I. Solicitudporescritodenuevoingreso,indicandoelgiroalquedeseanacreditarse,dirigida
alaDireccindeEcologaacompaadodelformatocorrespondiente.

II. Documentacinprobatoriadelosestudiosrealizados,ascomoloscursosacreditadosen
lamateriadurantelosdosaosprximospasados.

III. CdulaProfesional.

IV. Copia certificada expedida por el Registro Estatal de Profesiones, con la que acredite el
legalejerciciodelaprofesinoespecialidad.

V. ExperienciaprofesionalenImpactoAmbiental.

VI. Dosfotografastipottulo,recientes.

VII. Aprobar el examen y/o evaluacin de conocimientos aplicado por una institucin
acadmicareconocidaqueparatalesefectosdesignelaSecretara;

VIII. Respaldo tcnico mnimo en las reas de manejo de metodologa y modelaciones en
impactoyriesgoambiental,recursosnaturales;yprocesosproductivos,porlocualdeber
anexarelcurrculodeestostcnicosasusolicituddeRegistro.

ARTCULO 127. Recibida la solicitud y realizada la evaluacin a que se refiere el artculo que
antecede,laDireccinenunplazodequincedashbilesresolversiesprocedentelainscripcin
delinteresadoenelRegistro.

ARTCULO 128. La Direccin podr cancelar el registro de los prestadores de servicios
profesionalesambientalesquerealicenestudiosdeimpactoambientalpor:

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 47

I. Haber proporcionado informacin falsa o incorrecta para su inscripcin en el Registro


Estatal;

II. Incluirinformacinfalsaoincorrectaenlosestudiosquerealicen;y

III. Presentarlainformacindelosestudiosquerealicen,detalmaneraqueinduzcanalerror
oalaincorrectaapreciacindelaevaluacin.

ARTCULO129.ParaquelaDireccinreconozcavalidezalasmanifestacionesdeimpactoyriesgo
ambientalqueseformulen,serequerirqueelprestadordeserviciosprofesionalesambientales
seencuentreinscritoenelRegistroEstatalenelgirocorrespondiente.

Elpadrndeprestadoresserproporcionandoaquienlosolicite.

ARTCULO 130. Los Prestadores de Servicios Profesionales Ambientales, debern sin excepcin
tomar una capacitacin como mnimo dos veces por ao, de acuerdo al calendario que
previamenteestablecerlaDireccin,siendoesterequisitoindispensable.

ARTCULO 131. Para que los Prestadores de Servicios Profesionales Ambientales, continen
inscritosenelRegistroEstataldebernde;

I. Solicitaranualmentesurefrendoenelgirodeespecialidadquetendrunavigenciaconforme
alaocalendario,del01deEneroal31deDiciembre.

II. Comprobar capacitacin en materia ambiental, 2 veces al ao en donde lo establezca la
DireccindeEcologa;

III. Presentar el comprobante de pago de capacitacin, segn lo establezca la Direccin de
Ecologa.

ARTCULO 132. Los prestadores de servicios que elaboren los estudios de impacto ambiental
debern observar lo establecido en la Ley, su Reglamento, las Normas Oficiales Mexicanas y los
demsordenamientoslegalesyreglamentariosaplicables.

Asimismo,declararn,bajoprotestadedecirverdad,quelosresultadosqueseobtuvieronatravs
delaaplicacindelasmejorestcnicasymetodologascomnmenteutilizadasporlacomunidad
cientfica y del uso de la mayor informacin disponible, medidas de prevencin y mitigacin
sugeridassiendolasmsefectivasparaatenuarlosimpactosambientales.

ARTCULO 133. Si se comprueba que en la elaboracin de los documentos en cuestin la
informacin es falsa, el responsable ser sancionado de conformidad con lo dispuesto en el
CaptuloVITituloUndcimodelaLey,yenelpresenteReglamento,sinperjuiciodeladenuncia
que la Secretara realice ante el Ministerio Pblico por la comisin de delitos ambientales y
cualquierotrodelitosegnseaelcasoconcreto.
48
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


SECCINIV
PARTICIPACINPBLICAYDERECHOALAINFORMACIN

ARTCULO 134. La Secretara publicar un listado de las solicitudes de autorizacin, de los
informespreventivosydelasmanifestacionesdeimpactoambientalquereciba.

Estelistadodebercontener,porlomenos,lasiguienteinformacin:

I. Nombredelpromovente;

II. Fechadelapresentacindelasolicitud;

III. Nombredelproyectoeidentificacindeloselementosquelointegran;

IV. Tipodeestudiopresentado:informepreventivoomanifestacindeimpactoambiental;y

V. Lugarendondesepretendellevaracabolaobraoactividad,indicandoelMunicipio.

ARTCULO 135. Los expedientes de evaluacin de las manifestaciones de impacto ambiental
estarnadisposicindecualquierpersonaparasuconsulta.

El promovente de la manifestacin de impacto ambiental podr solicitar desde la fecha de
presentacin de su solicitud de impacto ambiental que se mantenga en reserva aquella
informacin que, de hacerse pblica, afectara derechos de propiedad industrial o la
confidencialidaddelosdatoscomercialescontenidosenella,enlostrminosdelasdisposiciones
legales aplicables. La informacin reservada permanecer bajo responsabilidad y custodia de la
SecretaraenlostrminosdelaLeydeTransparenciayAccesoalaInformacinPblicadelEstado
deChihuahuaydemsdisposicioneslegalesaplicables.

En todo caso el promovente de la manifestacin de impacto ambiental deber identificar los
derechos de propiedad industrial y los datos comerciales confidenciales en los que sustente su
solicitud.

ARTCULO 136 La consulta de los expedientes podr realizarse en das y horas hbiles, en las
oficinasdelaSecretarayenlaDelegacinRegionalquecorresponda.

ARTCULO137.LaSecretara,asolicituddecualquierpersonadelacomunidaddequesetrate,
podr llevar a cabo una consulta pblica, respecto de proyectos sometidos a su consideracin a
travsdemanifestacionesdeimpactoambiental.

La solicitud deber presentarse por escrito dentro del plazo de diez das contados a partir de la
publicacinenloslistadosdelasmanifestacionesdeimpactoambiental.Enellasedeberhacer
mencinde:
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 49


I. Laobraoactividaddequesetrate;

II. Lasrazonesquemotivanlapeticin;

III. Elnombreoraznsocialydomiciliodelsolicitante;y

IV. Lademsinformacinqueelparticulardeseeagregar.

ARTCULO138LaSecretara,dentrodeloscincodassiguientesalapresentacindelasolicitud,
notificaralinteresadosudeterminacindedaronoinicioalaconsultapblica.

ARTCULO 139. Cuando la Secretara decida llevar a cabo una consulta pblica, deber hacerlo
conformealassiguientesbases:

I. El da siguiente a aquel en que resuelva iniciar la consulta pblica, notificar al
promoventequedeberpublicar,enuntrminonomayordecincodascontadosapartir
dequesurtaefectoslanotificacin,unextractodelaobraoactividadenunperidicode
amplia circulacin en el Estado; de no hacerlo, el plazo para concluir el procedimiento
quedarsuspendido.LaSecretarapodr,entodocaso,declararlacaducidad.

Elextractodelproyectocontendr,lasiguienteinformacin:

a) Nombredelapersonafsicaomoralresponsabledelproyecto;

b) Una breve descripcin de la obra o actividad de la que se trate, indicando los
elementosquelaintegran;

c) Ubicacin del lugar en el que la obra o actividad se pretenda ejecutar, indicando el
Municipioylosecosistemasexistentesascomosucondicinalmomentoderealizar
elestudio,y

d) Indicacin de los principales efectos ambientales que puede generar la obra o
actividadylasmedidasdemitigacinyreparacinqueseproponen.

II. Cualquier ciudadano de la comunidad de que se trate podr solicitar a la Secretara que
ponga a disposicin del pblico la manifestacin de impacto ambiental en el Municipio
quecorresponda;

III. Dentrodelosveintedassiguientesaaqulenquelamanifestacindeimpactoambiental
hayasidopuestaadisposicindelpblico,conformealodispuestoenlafraccinanterior,
cualquier interesado podr proponer el establecimiento de medidas de prevencin y
mitigacin,ascomolasobservacionesqueconsiderepertinentes,lascualesseagregarn
alexpediente.
50
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


Lasobservacionesypropuestasdebernformularseporescritoycontendrnelnombrecompleto
delapersonafsicaomoralquelashubiesepresentadoysudomicilio,y

IV. LaSecretaraconsignar,enlaresolucinqueemita,elprocesodeconsultapblicaylos
resultadosdelasobservacionesypropuestasformuladas.

ARTCULO140.DuranteelprocesodeconsultapblicaaqueserefierenlosArtculos137al140
del presente Reglamento, la Secretara, en coordinacin con las autoridades locales, podr
organizarunareuninpblicadeinformacincuandosetratedeobrasoactividadesquepuedan
generar desequilibrios ecolgicos graves o daos a la salud pblica o a los ecosistemas, de
conformidadconlassiguientesbases:

I. La Secretara, dentro del plazo de veinticinco das contados a partir de que resuelva dar
inicioalaconsultapblica,emitirunaconvocatoriaenlaqueexpresarelda,lahorayel
lugarenqueseverificarlareunin.

II. Lareunindeberefectuarsedentrodeunplazonomayoracincodasysedesahogar
enunsoloda;

III. Elpromoventedeberexponerlosaspectostcnicosambientalesdelaobraoactividadde
quesetrate,losposiblesimpactosqueseocasionaranporsurealizacinylasmedidasde
prevencin y mitigacin que seran implementadas, y atender durante la reunin las
dudasqueleseanplanteadas;

IV. Al finalizar se levantar un acta circunstanciada en la que se asentarn los nombres y
domicilios de los participantes que hayan intervenido formulando propuestas y
consideraciones, el contenido de stas y los argumentos, aclaraciones o respuestas del
promovente y los participantes podrn solicitar una copia del acta circunstanciada
levantada,y

V. Concluida la reunin y antes de que se dicte la resolucin en el procedimiento de
evaluacin, los asistentes podrn formular observaciones por escrito que la Secretara
anexaralexpediente.

TTULOIV
REASNATURALESPROTEGIDAS

CAPTULOI
ADMINISTRACINDELASREASNATURALESPROTEGIDAS


ARTCULO141.LasAreasNaturalesProtegidastienencomopropsitopreservarlosambientes
naturales, salvaguardar la diversidad gentica de las especies silvestres, asegurar el
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 51

aprovechamiento racional de los ecosistemas, proporcionar un campo propicio para la


investigacin, proteger poblados y vas de comunicacin, sitios escnicos, proteger sitios
hidrolgicos,generarconocimientos,tecnologaydemsqueindicaelartculo61delaLey.

ARTCULO 142. De conformidad con el artculo 62 de la Ley las reas naturales protegidas de
jurisdiccinlocalson:

I. ParquesEstatales;
II. Parquesurbanos;
III. Zonassujetasaconservacinecolgica;y
IV. LasquesedeterminenenlosacuerdosconlaFederacinoenotrosordenamientos.

ARTCULO143.Laadministracindelasreasnaturalesprotegidasseefectuardeacuerdoasu
categora de manejo, de conformidad con lo establecido en la Ley, el presente Reglamento, el
Decreto de Creacin, las Normas Oficiales Mexicanas, su Programa de Manejo y dems
disposicioneslegalesyreglamentariasaplicables.

ARTCULO144.Enlaadministracindelasreasnaturalesprotegidassedebernadoptar:

I. Lineamientos,mecanismosinstitucionales,programas,polticasyaccionesdestinadasa:

a) Laconservacin,preservacin,proteccinyrestauracindelosecosistemas;

b) Elusoyaprovechamientosustentabledelosrecursosnaturales;

c) Lainspeccinyvigilancia;

II. Medidasrelacionadasconelfinanciamientoparasuoperacin;

III. Instrumentos para promover la coordinacin entre los distintos niveles de gobierno, as
comolaconcertacindeaccionesconlossectorespblico,socialyprivado;y

IV. Accionestendientesaimpulsarlacapacitacinyformacindelpersonaltcnicodeapoyo.

ARTCULO 145. Las reas naturales protegidas competencia del Estado sern administradas
directamenteporlaSecretaray,stapodr,unavezquesecuenteconelprogramademanejo
respectivo, otorgar la administracin a los gobiernos de los municipios, as como ejidos,
comunidades agrarias, pueblos indgenas, grupos y organizaciones sociales y empresariales,
universidades,centrosdeeducacineinvestigacinydemspersonasmoralesinteresadas,previa
opinin del Consejo Estatal para la Proteccin al Ambiente y el Desarrollo Sustentable,
suscribindose para tal efecto los convenios de concertacin o acuerdos de coordinacin
correspondientes.

52
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO 146. Las personas morales interesadas en administrar un rea natural protegida
deberndemostrarantelaSecretaraquecuentanconcapacidadtcnica,financieraodegestin
y, presentar un programa de trabajo acorde con lo previsto en el programa de manejo, que
contengalasiguienteinformacin:

I. Objetivosymetasquesepretendenalcanzar;

II. Perododuranteelcualsepretendeadministrarelreanaturalprotegida;

III. Origen y destino de los recursos financieros, materiales y humanos que se pretenden
utilizar;y

IV. Gestiones o mecanismos propuestos para obtener el financiamiento del rea natural
protegidaduranteelperodopretendidodeadministracin.

ARTCULO 147. La administracin y manejo de cada una de las reas naturales protegidas se
efectuaratravsdeunDirector,elcualsernombradodeacuerdoconlassiguientesbases;

I. LaSecretara,emitirunaconvocatoriaenlosdiariosdemayorcirculacinenlaEntidad,
conelfindequelaspersonasinteresadaspropongancandidatosaocuparelcargo;

II. Loscandidatosdeberntener,experienciaen;

a) Trabajodecamporelacionadoconelmanejoyconservacinderecursosnaturalesen
reasnaturalesprotegidas;

b) Capacidaddecoordinacinyorganizacindegruposdetrabajo;

c) Conocimientosdelaregin;

d) Conocimientosdelalegislacinambiental;y

e) Conocimiento en actividades econmicamente productivas que se relacionen con el
usoyaprovechamientoderecursosnaturalesenelreanaturalprotegidadequese
trate.

III. Las propuestas recibidas sern presentadas al Consejo, el cual seleccionar a tres
candidatos;y

IV. LaternasersometidaalaconsideracindeltitulardelaSecretara,quienseleccionaral
candidatoqueocuparelcargo.

ARTCULO 148. Para el establecimiento, administracin y manejo de las reas naturales
protegidasdelEstado,laSecretaraconlaparticipacindelConsejopodrsuscribirconveniosde
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 53

concertacin o acuerdos de coordinacin con los habitantes de las reas, propietarios,


poseedores, gobiernos municipales, pueblos indgenas, instituciones acadmicas y de
investigacin y dems organizaciones sociales, pblicas y privadas, con el fin de propiciar el
desarrollo integral de la comunidad y de asegurar la proteccin, conservacin, desarrollo
sustentableyrestauracindelosecosistemasysubiodiversidad.

Los convenios y acuerdos que se suscriban debern sujetarse, en todo caso, a las previsiones
contenidasenlaLey,elpresenteReglamentoylasdemsdisposicioneslegalesyreglamentarias
aplicables, as como a lo establecido en las declaratorias y en los programas de manejo
respectivos.

ARTCULO 149. Los instrumentos de concertacin y coordinacin que suscriba la Secretara
podrnreferirse,entreotras,alassiguientesmaterias:

I. Administracindelasreas;

II. Prevencindecontingenciasycontroldeemergencias;

III. Capacitacinyeducacinambiental;

IV. Asesoratcnica;

V. Ejecucin de programas, proyectos y acciones de desarrollo comunitario y
aprovechamientosustentable,conservacinyrestauracindelosrecursos;

VI. Investigacin;y

VII. Financiamientoymecanismosparasuaplicacin.

ARTCULO 150. Los instrumentos de concertacin y coordinacin debern contener, por lo
menos,lasiguienteinformacin:

I. Lareferenciaalosplanesyprogramasenmateriadepolticaambientalnacionalconlos
queserelacionen;

II. Unplandetrabajoqueincluya:

a) Losobjetivosymetasquesepretendanalcanzar;

b) Eldesglose,origenydestinodelosrecursosfinancieros,materialesyhumanosquese
pretendanutilizar;

c) Losdatosgeneralesdelaspersonasresponsablesdelaejecucindelplan;

54
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

d) Elcronogramadelasactividadesarealizar;

III. Losmecanismosdefinanciamiento;

IV. Lasobligacionesdelaspartes;

V. Resolucindecontroversias;y

VI. La vigencia del instrumento, sus formas de terminacin y, en su caso, el nmero y la
duracindesusprrrogas.

ARTCULO151.Losconveniosyacuerdosatravsdeloscualesseotorguelaadministracinde
lasreasnaturalesprotegidasdebernespecificar,ademsdeloprevistoenelartculoanterior,
lasaccionescuyaejecucin,ensucaso,mantengalaSecretara.

En este caso, deber elaborarse un acta de entrega recepcin que contenga el inventario de los
bienes muebles e inmuebles que se encuentren bajo la administracin directa del rea natural
protegidadequesetrate.

ARTCULO 152. La Secretara podr suscribir bases de colaboracin con otras dependencias o
entidades de la Administracin Pblica, cuyas actividades se encuentren relacionadas con la
administracinymanejodelasreasnaturalesprotegidas.

ARTCULO153.LaSecretarallevaracabolaevaluacinyseguimientoanualdelasaccionesque
sederivendelosinstrumentosquesesuscriban.Asimismo,podrmodificarodarporterminados
dichosinstrumentoscuandosepresentealgunaviolacinalasobligacionescontradas.

CAPTULOII
PROCEDIMIENTODEDECLARATORIA

ARTCULO154.Losestudiostcnicosjustificativosparaelestablecimientodelasreasnaturales
protegidas,sernelaboradosporlaSecretara,yensucaso,stapodrsolicitarlacolaboracinde
otrasdependenciasdelEjecutivo,ascomodeorganizacionespblicasoprivadas,universidades,
instituciones de investigacin o cualquier persona fsica o moral con experiencia y capacidad
tcnicaenlamateria.

El tipo de rea natural protegida que se pretenda declarar, deber estar fundamentada en las
caractersticas biolgicas y la vocacin de uso de suelo, tomando en consideracin los aspectos
socialesdelaspoblacioneslocales,ascomolosaprovechamientosqueenellaserealicen.

ARTCULO 155. Los estudios tcnicos justificativos que se refiere el artculo anterior debern
contener,porlomenos,losiguiente:

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 55

I. Informacin general en la que se incluya: el nombre del rea propuesta; el o los


municipiosendondeselocalizaelrea;superficie;vasdeacceso;mapaconladescripcin
limtrofe y nombre de las organizaciones, instituciones, organismos gubernamentales o
asociacionescivilesparticipantesenlaelaboracindelestudio;

II. Evaluacinambiental,endondesesealen:ladescripcindelosecosistemas,especieso
fenmenos naturales que se pretende proteger; razones que justifiquen el rgimen de
proteccin;estadodeconservacindelosecosistemas,especiesofenmenosnaturales;
relevancia de los ecosistemas representados en el rea propuesta; antecedentes de
proteccindelrea,yubicacinrespectoalasregionesprioritarias;

III. Diagnstico del rea, en el que se mencionen: caractersticas histricas y culturales;
aspectos socioeconmicos relevantes desde el punto de vista ambiental; usos y
aprovechamientos,actualesypotencialesdelosrecursosnaturales;situacinjurdicadela
tenencia de la tierra; proyectos de investigacin que se hayan realizado o que se
pretendan realizar; problemtica especfica que deba tomarse en cuenta, y centros de
poblacinexistentesalmomentodeelaborarelestudio;y

IV. Propuestademanejo,enlaqueseespecifique:

a) Zonificacinysusubzonificacindemanerapreliminar,basadaenlascaractersticasy
estado de conservacin de los ecosistemas, especies o fenmenos naturales que se
pretende proteger; aspectos socioeconmicos desde el punto de vista ambiental y,
usosyaprovechamientosactualesypotencialesdelosrecursosnaturales;

b) Tipoocategorademanejo,tomandoenconsideracinlosestudiosquejustifiquensu
establecimiento,ascomolasubzonificacinpreliminar;

c) Administracin;

d) Operacin,y

e) Financiamiento.

ARTCULO 156. Los estudios previos justificativos, una vez concluidos, debern ser puestos a
disposicin del pblico para su consulta por un plazo de 30 das naturales, en las oficinas de la
SecretarayensuDelegacinRegionalmsprximaadondeselocaliceelreaquesepretende
establecer.

ARTCULO 157. Las declaratorias para el establecimiento de las reas naturales protegidas
deberncontenerloprevistoporelartculo74delaLey.

ARTCULO 158. Para el cumplimiento de los objetivos previstos en la Ley, en relacin al
establecimiento y manejo de las reas naturales protegidas, se realizar una subdivisin que
56
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

permita identificar y delimitar las porciones del territorio que la conforman, acorde con sus
elementos biolgicos, fsicos y socioeconmicos, los cuales constituyen un esquema integral y
dinmico, por lo que cuando se realice la delimitacin territorial de las actividades en las reas
naturales protegidas, sta se llevar a cabo a travs de las siguientes zonas y sus respectivas
subzonas,deacuerdoasucategorademanejo:

I. Laszonasncleo,quetendrncomoprincipalobjetivolapreservacindelosecosistemas
amedianoylargoplazo,yquepodrnestarconformadasporlassiguientessubzonas:

a) Deproteccin:Aquellassuperficiesdentrodelreanaturalprotegida,quehansufrido
muy poca alteracin, as como ecosistemas relevantes o frgiles y fenmenos
naturales,querequierendeuncuidadoespecialparaasegurarsuconservacinalargo
plazo;y

b) De uso restringido: Aquellas superficies en buen estado de conservacin donde se
busca mantener las condiciones actuales de los ecosistemas, e incluso mejorarlas en
los sitios que as se requieran, y en las que se podrn realizar excepcionalmente
actividades de aprovechamiento que no modifiquen los ecosistemas y que se
encuentrensujetasaestrictasmedidasdecontrol.

II. Las zonas de amortiguamiento, tendrn como funcin principal orientar a que las
actividades de aprovechamiento, que ah se lleven a cabo, se conduzcan hacia el
desarrollosustentable,creandoalmismotiempolascondicionesnecesariasparalograrla
conservacin de los ecosistemas de sta a largo plazo, y podrn estar conformadas
bsicamenteporlassiguientessubzonas:

a) De uso tradicional: Aquellas superficies en donde los recursos naturales han sido
aprovechados de manera tradicional y continua, sin ocasionar alteraciones
significativasenelecosistema.Estnrelacionadasparticularmenteconlasatisfaccin
delasnecesidadessocioeconmicasyculturalesdeloshabitantesdelreaprotegida;

b) Deaprovechamientosustentabledelosrecursosnaturales:Aquellassuperficiesenlas
que los recursos naturales pueden ser aprovechados, y que, por motivos de uso y
conservacindesusecosistemasalargoplazo,esnecesarioquetodaslasactividades
productivasseefectenbajoesquemasdeaprovechamientosustentable;

c) De aprovechamiento sustentable de agroecosistemas: Aquellas superficies con usos
agrcolasypecuariosactuales;

d) De aprovechamiento especial: Aquellas superficies generalmente de extensin
reducida, con presencia de recursos naturales que son esenciales para el desarrollo
social,yquedebenserexplotadassindeteriorarelecosistema,modificarelpaisajede
forma sustancial, ni causar impactos ambientales irreversibles en los elementos
naturalesqueconforman;
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 57


e) De uso pblico: Aquellas superficies que presentan atractivos naturales para la
realizacin de actividades de recreacin y esparcimiento, en donde es posible
mantenerconcentracionesdevisitantes,enloslmitesquesedeterminenconbaseen
lacapacidaddecargadelosecosistemas;

f) De asentamientos humanos: En aquellas superficies donde se ha llevado a cabo una
modificacin sustancial o desaparicin de los ecosistemas originales, debido al
desarrollodeasentamientoshumanos,previosaladeclaratoriadelreaprotegida;y

g) Derecuperacin:Aquellassuperficiesenlasquelosrecursosnaturaleshanresultado
severamente alterados o modificados, y que sern objeto de programas de
recuperacinyrehabilitacin.

ARTCULO159.Enlasreasnaturalesprotegidas,podrnestablecerseunaomszonasncleoy
deamortiguamiento,segnseaelcaso,lascualesasuvez,podrnestarconformadaspordistintas
subzonas,deacuerdoalacategorademanejoqueselesasigne.

ARTCULO 160. Las subzonas destinadas a la proteccin tendrn por objeto mantener las
condiciones de los ecosistemas representativos de las reas, as como la continuidad de sus
procesosecolgicosyelgermoplasmaqueenelloscontiene.Estassubzonaspodrnestablecerse
enaquellassuperficiesque:

I. Nohayansidosignificativamentealteradasporlaaccindelhombre;

II. Contenganelementosdeecosistemasnicosofrgiles,oseanelescenariodefenmenos
naturalesquerequieranunaproteccinintegral;y
III. Sean propicias para el desarrollo, reintroduccin, alimentacin y reproduccin de
poblacionesdevidasilvestre,residentesomigratorias,incluyendoespeciesenriesgo.

Enlassubzonasdeproteccin,slosepermitirrealizaractividadesdemonitoreodelambiente,
de investigacin cientfica que no implique la extraccin o el traslado de especmenes, ni la
modificacindeloshbitats.

ARTCULO161.Paramanteneromejorarlascondicionesdelosecosistemaspodrndelimitarse
subzonasdeusorestringido,enaquellasporcionesrepresentadasporecosistemasquemantienen
condiciones estables y en donde existen poblaciones de vida silvestre, incluyendo especies
consideradasenriesgoporlasNormasOficialesMexicanas.Enestassubzonasslosepermitir:

I. Lainvestigacincientficayelmonitoreodelambiente;

II. Las actividades de educacin ambiental y turismo de bajo impacto ambiental que no
impliquenmodificacindelascaractersticasocondicionesoriginales;

58
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

III. Laconstruccindeinstalacionesdeapoyo,exclusivamenteparalainvestigacincientfica
ymonitoreodelambiente;y

IV. Excepcionalmente la realizacin de actividades de aprovechamiento que no modifiquen
losecosistemas.

ARTCULO 162. Las subzonas de uso tradicional, tendrn como finalidad mantener la riqueza
culturaldelascomunidades,ascomolasatisfaccindelasnecesidadesbsicasdelospobladores
que habiten en el rea natural protegida. Estas subzonas podrn establecerse en aquellas
superficiesdondelosrecursosnaturaleshansidoaprovechadosdemaneratradicionalycontinua,
y que actualmente estn siendo aprovechados, sin ocasionar alteraciones significativas en los
ecosistemas.

En dichas subzonas no podrn realizarse actividades que amenacen o perturben la estructura
naturaldelaspoblacionesyecosistemasolosmecanismospropiosparasurecuperacin.Slose
podrnrealizaractividadesde:

I. Investigacincientfica;

II. Educacinambientalydeturismodebajoimpactoambiental,ascomolainfraestructura
deapoyoqueserequiera,utilizandoecotecniasymaterialestradicionalesdeconstruccin
propiosdelaregin;y

III. Aprovechamiento de los recursos naturales para la satisfaccin de las necesidades
econmicas bsicas y/o de autoconsumo de los pobladores, utilizando mtodos
tradicionales enfocados a la sustentabilidad, conforme lo previsto en las disposiciones
legalesyreglamentariasaplicables.

ARTCULO163.Lassubzonasdeaprovechamientosustentabledelosrecursosnaturales,tendrn
por objeto el desarrollo de actividades productivas bajo esquemas de sustentabilidad y la
regulacin y control estrictos del uso de los recursos naturales. Estas subzonas se establecern
preferentemente en superficies que mantengan las condiciones y funciones necesarias para la
conservacin de la biodiversidad y la prestacin de servicios ambientales. En dichas subzonas se
permitirexclusivamente:

I. El aprovechamiento y manejo de los recursos naturales renovables, siempre que estas
accionesgenerenbeneficiospreferentementeparalospobladoreslocales;

II. Lainvestigacincientfica;

III. Laeducacinambiental;y

IV. Eldesarrollodeactividadestursticas.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 59

Asimismo, el aprovechamiento sustentable de la vida silvestre podr llevarse a cabo siempre y


cuandosegaranticesureproduccincontroladaosemantenganoincrementenlaspoblacionesde
las especies aprovechadas y el hbitat del que dependen; y se sustenten en los planes
correspondientes autorizados por la Secretara, conforme a las disposiciones legales y
reglamentariasaplicables.

ARTCULO 164. En aquellas superficies en que los recursos naturales han sido aprovechados de
manera continua con fines agrcolas y pecuarios, se podrn establecer subzonas de
aprovechamientosustentabledeagroecosistemas.Endichassubzonassepodrnrealizar:

I. Actividadesagrcolasypecuariasdebajaintensidadquesellevenacaboenprediosque
cuentenconaptitudparaestefin,yenaquellosenquedichasactividadesserealicende
maneracotidiana;y

II. Actividades de agroforestera y silvopastoriles que sean compatibles con las acciones de
conservacindelrea,yquecontribuyanalcontroldelaerosinyevitarladegradacin
delossuelos.

La ejecucin de las prcticas agrcolas, pecuarias, agroforestales y silvopastoriles que no estn
siendo realizadas en forma sustentable, debern de orientarse hacia la sustentabilidad y a la
disminucindelusodeagroqumicoseinsumosexternosparasurealizacin.

ARTCULO 165. Las subzonas de aprovechamiento especial podrn establecerse en aquellas
superficies de extensin reducida que se consideren esenciales para el desarrollo social y
econmicodelaregin.Endichassubzonasslosepodrnejecutarobraspblicasoprivadaspara
la instalacin de infraestructura o explotacin de recursos naturales, que originen beneficios
pblicos,queguardenarmonaconelpaisaje,quenoprovoquendesequilibrioecolgicogravey
queestnsujetosaestrictasregulacionesdeusodelosrecursosnaturales.

ARTCULO 166. Las subzonas de uso pblico podrn establecerse en aquellas superficies que
contengan atractivos naturales para la realizacin de actividades recreativas, de esparcimiento y
deeducacinambiental.

Endichassubzonassepodrllevaracaboexclusivamentelaconstruccindeinstalacionesparael
desarrollo de servicios de apoyo al turismo, a la investigacin y monitoreo del ambiente, y la
educacinambiental,congruentesconlospropsitosdeproteccinymanejodecadareanatural
protegida.

ARTCULO167.Lassubzonasdeasentamientoshumanosseestablecernensuperficiesdondese
ha llevado a cabo una alteracin, modificacin sustancial o desaparicin de los ecosistemas
originales debido a un uso intensivo por el desarrollo de asentamientos humanos, previo a la
declaratoriadelreanaturalprotegida.

60
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

Estas subzonas comprendern los asentamientos humanos localizados dentro del rea natural
protegidaylasreservasterritorialesdelosmismos.

ARTCULO168.Lassubzonasderecuperacintendrnporobjetodetenerladegradacindelos
recursos y establecer acciones orientadas hacia la restauracin del rea. Estas subzonas se
establecern en aquellas superficies donde se ha llevado a cabo una alteracin, modificacin
sustancial o desaparicin de los ecosistemas originales debido a actividades humanas o
fenmenosnaturales,caracterizndoseporpresentaralgunosdelossiguientesaspectos:

I. Unaltoniveldedeteriorodelsuelo;

II. Perturbacinseveradelavidasilvestre;

III. Relativamentepocadiversidadbiolgica;

IV. Introduccindeespeciesexticas;

V. Sobreexplotacindelosrecursosnaturales;

VI. Regeneracinnaturaldelacubiertavegetalpobreonula;

VII. Procesosdedesertificacinaceleradayerosin;y

VIII. Alteracinocasionadaporfenmenosnaturalesyhumanos.

Enestassubzonasdebernutilizarsepreferentementeparasurehabilitacin,especiesnativasde
la regin; o en su caso especies compatibles con el funcionamiento y la estructura de los
ecosistemasoriginales.

Las subzonas de recuperacin tendrn carcter provisional y debern ser monitoreadas y
evaluadas peridicamente para detectar los cambios que se presenten. Una vez que estas
subzonas hayan sido rehabilitadas, se les determinar cualquier otro tipo de las subzonas antes
mencionadas.

ARTCULO169.Cuandoladeclaratoriadeunreanaturalprotegidaimpliquelaexpropiacinde
superficies, se seguir el procedimiento establecido en el Titulo Segundo del Libro nico del
RgimenPatrimonialdelEstadocontenidoenelCdigoAdministrativodelEstado.

CAPTULOIII
ZONASDERESTAURACINENLASREASNATURALESPROTEGIDAS

ARTCULO 170. En trminos de lo establecido en el Captulo I del Ttulo Sexto de la Ley, la
Secretara dentro de las reas naturales protegidas, formular y ejecutar programas de
restauracin ecolgica, con el propsito de que se lleven a cabo las acciones necesarias para la
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 61

recuperacinyrestablecimientodelascondicionesquepropicienlaevolucinycontinuidaddelos
procesosnaturalesqueenellassedesarrollan.

Losprogramasderestauracin,debernatenderalasdisposicionesylineamientoscontenidosen
el programa de manejo del rea natural protegida respectiva, de conformidad con las zonas
correspondientes.

ARTCULO 171. Los programas de restauracin ecolgica que formule la Secretara y que se
ejecutenenlasreasnaturalesprotegidas,deberncontenerporlomenoslosiguiente:

I. La descripcin del ecosistema o ecosistemas afectados, sealando las especies de vida
silvestre caractersticas de la zona y, de manera especfica, las que se encuentran en
riesgo;

II. Eldiagnsticodelosdaossufridosenlosecosistemas;

III. Lasaccionesderestauracinquedebernrealizarse,incluyendo:

a) Lasformasparainducirlarecuperacindelaspoblacionesnaturales;

b) Larepoblacin,reintroduccinotraslocacindeejemplaresypoblaciones,conformea
losordenamientoslegalesenmateriadevidasilvestre;

c) Lasobrasyprcticasdeconservacindesueloyaguaquesetenganprevistas,y

d) Losmtodosparaelcontroldeplagasyenfermedades.

IV. Eltiempodeejecucin;

V. Loscostosylasfuentesdefinanciamientoquesetenganprevistas;

VI. Lasmodalidadesalaprovechamientodelosrecursosnaturalesafectados,conelobjetode
permitirsurestauracinyrestablecimiento;

VII. La evaluacin y el seguimiento de la recuperacin del ecosistema, estableciendo la
periodicidadconlaquesellevaracabodichaevaluacinylosindicadoresaevaluar;

VIII. Losmediosporlosquedeberllevarseacaboladifusinperidicadelosavancesdelas
accionesderestauracin;y

IX. Lacoordinacindeaccionesconlostresrdenesdegobierno.

ARTCULO 172. La Secretara promover con la participacin que le corresponda al Gobierno
Federal,laexpedicindedeclaratoriasparaelestablecimientodezonasderestauracinecolgica
62
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

en aquellas reas que presenten procesos de degradacin o desertificacin, o graves


desequilibrios ecolgicos, o se estn presentando procesos acelerados de desertificacin o de
degradacin que impliquen la perdida de recursos de muy difcil regeneracin, recuperacin o
restablecimiento,oafectacionesirreversiblesalosecosistemasosuselementos,conelpropsito
de que se lleven a cabo las acciones necesarias para la recuperacin y restablecimiento de las
condicionesquepropicienlaevolucinycontinuidaddelosprocesosnaturalesquesedesarrollan
enlasreasnaturalesprotegidas.

Losestudiosquejustifiquenlaexpedicindedichasdeclaratoriasdeberncontener:

I. Informacingeneralenlaqueseincluya:

a) Nombre de las organizaciones, instituciones, organismos gubernamentales o
asociacionescivilesqueparticiparonenlaelaboracindelestudio;

b) Nombredelreapropuesta;

c) Entidadfederativaymunicipiosendondeselocalizaelrea;

d) Superficie;

e) Ubicacingeorreferenciada;

f) Vasdeacceso;y

g) Mapaquecontengaladescripcinlimtrofe.

II. Diagnsticoquecomprenda:

a) Razonesquejustifiquenelrgimenderestauracin;

b) Descripcindelosprocesosaceleradosdedesertificacin,degradacinoafectaciones
irreversiblesdelosecosistemasosuselementos;

c) Identificacindelosrecursosdemuydifcilregeneracin,quesehayanperdidoyque
pretendanrecuperarseorestablecerse;

d) Relevancia, a nivel estatal, regional y en su caso nacional, de los ecosistemas a
restaurar;e

e) Identificacindelasactividadeshumanasofenmenosnaturalesquecondujeronala
degradacin,talescomo:incendios,inundaciones,plagasyotrassimilares.

III. Descripcindelascaractersticasfsicasenlasquesemencione:
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 63


a) Fisiografaytopografa;

b) Geologa;

c) Tiposdesuelos;

d) Hidrologa;y

e) Factoresmeteorolgicos.

IV. Aspectossocioeconmicos,queincluyan:

a) Condicionessocialesdelaregin;

b) Actividadessobrelasqueestbasadasueconoma;

c) Asentamientoshumanos;

d) Tenenciadelatierra;

e) Litigiosactualmenteenproceso;

f) Usosdelsuelo;

g) Usotradicionaldelavidasilvestredelaregin;e

V. Institucionesquehanrealizadoproyectosdeinvestigacinenelrea.

ARTCULO 173. En materia de programas y zonas de restauracin en las reas naturales
protegidas,correspondealaSecretara:

I. Coordinarlasaccionesderestauracintendientesalarecuperacinyrestablecimientode
lascondicionesquepropicienlaevolucinylacontinuidaddelosprocesosnaturalesenlas
zonasderestauracinecolgica;

II. Mantenerlascaractersticasoriginalesdelusodelsuelodelosecosistemasarestaurar,de
modo que se evite el establecimiento de asentamientos humanos y la realizacin de
actividadesnocompatiblesconlosobjetivosderestauracin;y

III. Autorizar la realizacin de actividades productivas en las zonas de restauracin, cuando
stas resulten compatibles con las acciones previstas en los programas de manejo y de
restauracinrespectivas.

64
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO174.Enlaszonasderestauracindelasreasnaturalesprotegidaselaprovechamiento
de recursos naturales, de la vida silvestre, as como la realizacin de cualquier tipo de obra o
actividad,sesujetarnalascondicionessiguientes:

I. La reforestacin de estas zonas se realizar de preferencia con especies nativas de la
regin; o en su caso, especies compatibles con el funcionamiento y la estructura de los
ecosistemasnaturalesoriginales.Losespecmenesexticosdebernserreemplazadospor
elementosnaturalesdelecosistemaatravsdeproyectosdemanejoespecfico;

II. Restablecimientodelascondicionespropiciasparalaregeneracinnaturaloinducida;y

III. El aprovechamiento de especies de vida silvestre, slo se autorizar cuando exista
compatibilidadconlasactividadesderestauracin,deconformidadconloestablecidoen
lasdisposicionesjurdicasenmateriadeVidaSilvestre.

Los interesados debern elaborar los proyectos especficos de manejo en poblaciones naturales,
que permitan garantizar que la tasa de aprovechamiento no rebase la renovacin natural de las
poblaciones.

ARTCULO 175. Una vez logrados los objetivos plasmados en el programa de restauracin, a la
superficie restaurada se le podr dar el tratamiento de subzona de recuperacin durante un
perodonomenoracincoaos;transcurridodichoperodolaSecretaradeterminarlassubzonas
definitivasquelecorrespondern,deconformidadconloestablecidoenelprogramademanejo
delreanaturalprotegidarespectiva.

CAPTULOIV
FORMULACINDELOSPROGRAMASDEMANEJO

ARTCULO176.Lasreasnaturalesprotegidasdeberncontarconunprogramademanejoque
ser elaborado por la Secretara en los trminos del artculo 82 de la Ley. El programa deber
sujetarse a las disposiciones contenidas en la declaratoria del rea natural protegida de que se
trate,ytendrporobjetolaadministracindelamisma.

ARTCULO177.LaSecretaraelaborarlostrminosdereferenciaparaformularelProgramade
Manejo, mismos que sern publicados en el Peridico Oficial del Estado. En la formulacin del
programademanejosedeberpromoverlaparticipacinde:

I. Los habitantes, propietarios y poseedores de los predios que conforman el rea
respectiva;

II. Los gobiernos municipales, de las Dependencias de la Administracin Pblica Federal y
Estatalque,porsucompetencia,pudieranaportarelementosalprograma;

III. Losgobiernosestatalesymunicipales,ensucaso;y
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 65


IV. Lasorganizacionessociales,pblicasoprivadas,ydemspersonasinteresadas.

ARTCULO 178. El programa de manejo de cada rea natural protegida, deber contener lo
sealadoporelartculo82delaLey,ascomolaespecificacindelasdensidades,intensidades,
condicionantesymodalidadesaquesesujetarnlasobrasyactividadesquesevienenrealizando
en las mismas, en trminos de lo establecido en la Ley, el presente Reglamento, el decreto de
creacindelreanaturalprotegidadequesetrate,ydemsdisposicioneslegalesyreglamentarias
aplicables. En dicho programa se deber determinar la extensin y delimitacin de la zona de
influenciadelreaprotegidarespectiva.

ARTCULO179.Adems,elprogramademanejocontendrladelimitacin,extensinyubicacin
de las subzonas que se sealen en la declaratoria, as como los trminos de referencia; la
Secretara deber promover que las actividades que realicen los particulares se ajusten a los
objetivosdedichassubzonas.

ARTCULO180.Lasreglasadministrativasaquesesujetarnlasactividadesquesedesarrollenen
el rea natural protegida, debern contener, conforme a la declaratoria y dems disposiciones
legalesyreglamentarias:

I. Disposicionesgenerales;

II. Horarios de visita para la realizacin de las actividades que as lo requieran, de
conformidadconlascaractersticaspropiasdelasmismas;

III. Actividades y aprovechamientos permitidos, as como sus lmites y lineamientos, de
conformidadconlasNormasOficialesMexicanas,ascomoconlaszonasysubzonasque
paratalefectoseestablezcanysealenenladeclaratoriarespectiva;

IV. Prohibiciones;y

V. Faltasadministrativas.

ARTCULO 181. Una vez que se cuente con el programa de manejo del rea protegida, la
SecretarapublicarenelPeridicoOficialdelEstadounresumendelmismo,quedebercontener
losiguiente:

I. Categoraynombredelreanaturalprotegida;

II. FechadepublicacinenelPeridicoOficialdelEstadodeladeclaratoriarespectiva;

III. Planodeubicacindelreanaturalprotegida;

IV. Objetivosgeneralesyespecficosdelprograma;
66
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


V. Delimitacin,extensinyubicacindelaszonasysubzonasestablecidasysealadasenla
declaratoria;y

VI. Lasreglasadministrativasaquesesujetarnlasactividadesquesedesarrollanenelrea
naturalprotegida.

ARTCULO182.Elprogramademanejoserrevisadoporlomenoscadacincoaosconelobjeto
deevaluarsuefectividadyproponerposiblesmodificaciones.

ARTCULO183.Elprogramademanejopodrsermodificadoentodooenparte,cuandoste
resulteinoperanteparaelcumplimientodelosobjetivosdelreanaturalprotegida,paralocualla
SecretarasolicitarlaopinindelConsejo.

PrevioanlisisyopinindelConsejo,sepodrmodificarelprogramademanejocuando:

I. Lascondicionesnaturalesyoriginalesdelreahayancambiadodebidoalapresenciade
fenmenosnaturalesyserequieraelplanteamientodeestrategiasyaccionesdistintasa
lasestablecidasenelprogramavigente;

II. Tcnicamentesedemuestrequenopuedencumplirseestrategiasoaccionesestablecidas
enelprogramavigente;o

III. Tcnicamente se demuestre la necesidad de adecuar la delimitacin, extensin o
ubicacindelassubzonassealadasenladeclaratoriacorrespondiente.

ARTCULO 184. Las modificaciones al programa de manejo que resulten necesarias debern
seguir el mismo procedimiento establecido para su elaboracin y un resumen de las mismas se
publicarenelPeridicoOficialdelEstado.

CAPTULOV
AUTORIZACIONESYPERMISOS

ARTCULO 185. Para los usos y aprovechamientos que se lleven a cabo dentro de las reas
naturales protegidas, la Secretara otorgar las tasas de aprovechamiento respectivas y
establecer las proporciones, lmites de cambio aceptables o capacidades de carga
correspondientes,deconformidadconlosmtodosyestudiosrespectivos.

Paralaelaboracindelosmtodosyestudiosquepermitanestablecerlasproporciones,lmitesde
cambio aceptables o capacidades de carga, la Secretara podr solicitar la colaboracin de otras
dependenciasEstatales,FederalesyMunicipales,ascomodeorganizacionespblicasoprivadas,
universidades, instituciones de investigacin o cualquier persona con experiencia y capacidad
tcnicaenlamateria.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 67

ARTCULO 186. En las reas naturales protegidas slo se podrn realizar aprovechamientos de
recursos naturales que generen beneficios a los pobladores que ah habiten y que sean acordes
con los esquemas de desarrollo sustentable, la declaratoria respectiva, su programa de manejo,
losprogramasdeordenamientoecolgico,lasnormasoficialesmexicanasydemsdisposiciones
legalesaplicables.

Losaprovechamientosdebernllevarseacabopara:

I. Autoconsumo;o

II. Desarrollodeactividadesyproyectosdemanejoyaprovechamientosustentablesiempre
ycuando:

a) No se introduzcan especies silvestres exticas diferentes a las ya existentes o
transgnicas;

b) Se mantenga la cobertura vegetal, estructura y composicin de la masa forestal y la
biodiversidad;

c) No se afecte significativamente el equilibrio hidrolgico del rea o ecosistemas de
relevanciaparaelreaprotegidaoqueconstituyanelhbitatdelasespeciesnativas;

d) Noseafectenzonasdereproduccinoespeciesenvedaoenriesgo;

e) Tratndose de aprovechamientos para autoconsumo de lea, otros no extractivos,
estos sern aprobados nicamente para quienes habiten dentro del rea natural
protegida y debern contar con la autorizacin respectiva y la manifestacin de
impacto ambiental autorizada, en los trminos de las disposiciones legales y
reglamentariasaplicables;

f) Los aprovechamientos pesqueros no impliquen la captura incidental de especies
consideradasenriesgoporlasdisposicioneslegalesyreglamentariasaplicables,niel
volumen de captura incidental sea mayor que el volumen de la especie objeto de
aprovechamiento;y

g) Tratndose de obras y trabajos de exploracin y de explotacin de minerales o
sustancias no reservadas a la Federacin dentro de las reas naturales protegidas,
cuentenconlaautorizacinexpedidaporlaSecretara,deconformidadconelartculo
195delpresenteReglamento.

ARTCULO 187. El uso turstico y recreativo dentro de las reas naturales protegidas, se podr
llevaracabobajolostrminosqueseestablezcanenelprogramademanejodecadareanatural
protegida,ysiempreque:

68
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

I. Noseprovoqueunaafectacinsignificativaalosecosistemas;

II. Preferentementetenganunbeneficiodirectoparalospobladoreslocales;

III. Promuevalaeducacinambiental;y

IV. Lainfraestructurarequeridaseaacordeconelentornonaturaldelreaprotegida.

ARTCULO 188. Los visitantes y prestadores de servicios tursticos en las reas naturales
protegidasdeberncumplirconlasreglasadministrativascontenidasenelProgramadeManejo
respectivo,ytendrnlassiguientesobligaciones:

I. CubrirlascuotasestablecidasenlaLeyEstataldeIngresos;

II. Hacerusoexclusivamentedelasrutasysenderosestablecidospararecorrerelrea;

III. Respetarlasealizacinylaszonasdelrea;

IV. Acatarlasindicacionesdelpersonaldelrea;

V. Proporcionar los datos que les sean solicitados por el personal del rea para efectos
informativosyestadsticos;

VI. BrindarelapoyoylasfacilidadesnecesariasparaqueelpersonaldelaSecretararealice
labores de vigilancia, proteccin y control, as como en situaciones de emergencia o
contingencia;y

VII. Hacer del conocimiento del personal del rea natural protegida las irregularidades que
hubieren observado, as como aquellas acciones que pudieran constituir infracciones o
delitos.

Quienesdemaneratemporalopermanenteresidanenlasreasnaturalesprotegidas,tendrnlas
obligacionessealadasenelprogramademanejorespectivo.

ARTCULO189.Losprestadoresdeserviciostursticosdeberncerciorarsedequesupersonaly
los visitantes cumplan con las reglas administrativas del rea protegida, siendo responsables
solidariosdelosdaosyperjuiciosquepudierencausar.

ARTCULO 190. Los investigadores que ingresen al rea natural protegida con propsitos de
realizarcolectaconfinescientficosdebern:

I. Informar al Director del rea natural protegida sobre el inicio de las actividades
autorizadaspararealizarcolectacientficayhacerlellegarcopiadelosinformesexigidos
endichaautorizacin;
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 69


II. Cumplirconlascondicionantesestablecidasenlaautorizacin;

III. Acatarlasindicacionesdelpersonal,queseencuentrenestablecidasenlosinstrumentos
jurdicosaplicables;

IV. Respetarlasealizacinylaszonasdelreanaturalprotegidadequesetrate;

V. Respetarlasreglasadministrativas;y

VI. Hacer del conocimiento del personal del rea natural protegida las irregularidades que
hubiere observado, as como aquellas acciones que pudieran constituir infracciones o
delitos.

Los resultados contenidos en los informes a que se refiere la fraccin I del presente artculo no
estarn a disposicin del pblico, salvo que se cuente con el consentimiento expreso del
investigador.

ARTCULO191.Quienescuentenconautorizacinparaelmanejoyaprovechamientosustentable
delavidasilvestreenpropiedadesejidalesoprivadas,debern:

I. Presentar al Director del rea natural protegida, la autorizacin correspondiente y copia
delosinformesquerinda;

II. Cumplirconlascondicionantesestablecidasenlaautorizacin;

III. Respetarlasealizacinylaszonasdelreanaturalprotegidadequesetrate;y

IV. Respetarlasreglasadministrativas.

ARTCULO192.Deacuerdoconladeclaratoriapodrnestablecerselassiguientesprohibiciones,
salvoquesecuenteconlaautorizacinrespectiva:

I. Cambiarelusodelsuelodesuperficiesquemantenganecosistemasoriginales;

II. Molestar, capturar, remover, extraer, retener o apropiarse de vida silvestre o sus
productos;

III. Removeroextraermaterialmineral;

IV. Trasladarespecmenesdepoblacionesnativasdeunacomunidadbiolgicaaotra;

V. Alterar o destruir por cualquier medio o accin los sitios de alimentacin, anidacin,
refugiooreproduccindelasespeciessilvestres;
70
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


VI. Alimentar, tocar o hacer ruidos intensos que alteren el comportamiento natural de los
ejemplaresdelavidasilvestre;

VII. Introducirplantas,semillasyanimalesdomsticos;

VIII. Introducirejemplaresopoblacionessilvestresexticas;

IX. Daar,cortarymarcarrboles;

X. Hacerunusoinadecuadooirresponsabledelfuego;

XI. Interrumpir,desviar,rellenarodesecarflujoshidrulicosocuerposdeagua;

XII. Abrirsenderos,brechasocaminos;

XIII. Arrojar, verter o descargar cualquier tipo de desechos orgnicos, residuos slidos o
lquidos o cualquier otro tipo de contaminante, tales como insecticidas, fungicidas y
pesticidas,entreotros,alsuelooacuerposdeagua;

XIV. Utilizar lmparas o cualquier fuente de luz para aprovechamiento u observacin de
ejemplaresdelavidasilvestre;

XV. Usaraltavoces,radiosocualquieraparatodesonido,quealtereelcomportamientodelas
poblaciones o ejemplares de las especies silvestres o que impida el disfrute del rea
protegidaporlosvisitantes;y

XVI. Hacerusodeexplosivos.

LospobladoresdelasreasnaturalesprotegidasquedarnexceptuadosdelasfraccionesII,IIIyIX
cuandoseencuentrenrealizandolaactividadconfinesdeautoconsumodentrodelosprediosde
supropiedadynoexistaprogramademanejo.

ARTCULO193.SerequerirdeautorizacinporpartedelaSecretarapararealizardentrodelas
reasnaturalesprotegidas,atendiendoalaszonasestablecidasysinperjuiciodelasdisposiciones
legalesaplicables,lassiguientesobrasyactividades:

I. Colectadeejemplaresdevidasilvestre,ascomodeotrosrecursosbiolgicosconfinesde
investigacincientfica;

II. Lainvestigacinymonitoreoquerequierademanipularejemplaresdeespeciesenriesgo;

III. El aprovechamiento de la vida silvestre, as como el manejo y control de ejemplares y
poblacionesquesetornenperjudiciales;
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 71


IV. Elaprovechamientoderecursosbiolgicosconfinesdeutilizacinenlabiotecnologa;

V. Aprovechamientoforestal;

VI. Aprovechamientoderecursospesqueros;

VII. Obras que, en materia de impacto ambiental, requieran de autorizacin en los trminos
delArtculo42delaLeyyelpresenteReglamento;

VIII. Usoyaprovechamientodeaguasnacionales;

IX. Prestacindeserviciostursticos:

a) Visitasguiadasincluyendoelaprovechamientonoextractivodevidasilvestre;

b) Recreacinenvehculosterrestres,acuticos,subacuticosyareos;

c) Pescadeportivorecreativa;

d) Campamentos;

e) Serviciosdepernoctaeninstalacionesestatales;y

f) Otrasactividadestursticasrecreativasdecampoquenorequierandevehculos.

X. Filmaciones, actividades de fotografa, la captura de imgenes o sonidos por cualquier
medio,confinescomercialesquerequierandeequiposcompuestospormsdeuntcnico
especializadocomoapoyoalapersonaqueoperaelequipoprincipal;

XI. Actividadescomerciales,exceptolasqueserealicendentrodelazonadeasentamientos
humanos;y

XII. Obrasytrabajosdeexploracinyexplotacinmineras.

ARTCULO 194. La Secretara, en el mbito de sus atribuciones podr otorgar los permisos,
autorizaciones, licencias y concesiones que se requieran para la exploracin, explotacin o
aprovechamientoderecursosenlasreasnaturalesprotegidas,entrminosdeloestablecidopor
lasdisposicioneslegalesyreglamentariasaplicables.

ARTCULO195.Paraobtenerunaautorizacinparalaprestacindeserviciostursticosenelrea
naturalprotegida,elinteresadodeberpresentarsolicitudporescrito,enlacualsecontenganlos
siguientesdatos:

72
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

I. Nombre,denominacinoraznsocial;

II. Nacionalidad;

III. Tipodeservicio;

IV. Descripcindelaactividad;

V. Tiempodeestancia;

VI. Lugaresavisitar;y

VII. Ensucaso,plizadesegurosdelviajeroytripulantes,eltipodetransportequeseutilizar
para llevar a cabo la actividad, as como la infraestructura que se requiera para su
desarrollo, misma que deber contar con la autorizacin que en materia de impacto
ambientalcorrespondaenlostrminosdelaLeyyelpresenteReglamento.

ARTCULO 196. La solicitud de autorizacin para la prestacin de servicios tursticos deber ir
acompaadadelasiguientedocumentacin:

I. Actadenacimientodelsolicitanteocopiasimpledelactaconstitutivadelasociedad;

II. Instrumentoqueacreditelapersonalidaddelrepresentantelegal;

III. En su caso, documento que acredite la propiedad de la embarcacin o vehculo y
autorizacionesotorgadasporotrasdependencias;

IV. Matrculaycaractersticasdelaembarcacinovehculo;y

V. Comprobantedelpagodederechoscorrespondiente.

ARTCULO197.Paralaobtencindeunaautorizacinparallevaracabofilmaciones,actividades
de fotografa o captura de imgenes o sonidos por cualquier medio, con fines comerciales que
requierandeequiposcompuestospormsdeuntcnicoespecializadocomoapoyoalapersona
que opera el equipo principal, el interesado deber presentar solicitud por escrito, en la cual se
contenganlossiguientesdatos:

I. Nombre o razn social del solicitante, domicilio para or y recibir notificaciones, nmero
de telfono y correo electrnico, en su caso, y copia de una identificacin oficial o acta
constitutivadelasociedadoasociacin;

II. Datosdelresponsabledeldesarrollodelasactividades;

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 73

III. Tipoycaractersticasdelolosvehculosquesepretendanutilizarparalarealizacindela
actividad;

IV. Programa de actividades a desarrollar,enelcualseincluya,fecha,horariosdeingreso y
salida,tiempodeestanciaenelreanaturalprotegidayubicacindelsitioonombrede
laslocalidadesdondesepretendanllevaracabodichasactividades;

V. Nmerodepersonasauxiliares;

VI. Tipodeequipoautilizarparalaactividad;

VII. Informe del tipo de filmacin, captura de imgenes o sonidos por cualquier medio
indicandoelfindelasmismas;y

VIII. Acreditarelpagodederechoscorrespondiente.

ARTCULO 198. Para la obtencin de una autorizacin para la realizacin de actividades
comerciales, el interesado deber presentar solicitud por escrito, en la cual se contengan los
siguientesdatos:

I. Nombre,denominacinoraznsocial;

II. Nacionalidad;

III. Tipodeactividadquesedesearealizarenelreaprotegidaycaractersticasespecficasde
losproductosquesedeseanexpender;

IV. Periodicidaddelaactividadquesedesearealizar;y

V. Croquis de localizacin de la superficie a utilizar y, en su caso, informacin de la
infraestructuranecesariapararealizarlaactividad.

ARTCULO199.Paralarealizacindeobrasytrabajosdeexploracinyexplotacinderecursos
mineros no reservados a la federacin dentro de las reas naturales protegidas, el interesado
debersolicitar,alaSecretaralaautorizacincorrespondiente,atravsdeunescritoenelquese
incluyalasiguienteinformacin:

I. Nombre,denominacinoraznsocialdelpromovente;

II. Ubicacin, superficie y colindancias del predio de que se trate, debidamente
georreferenciado;

III. Caractersticasfsicasybiolgicasdedichopredio;y

74
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

IV. Informacinrelevantesobrelanaturalezadelasobrasytrabajosquesedesarrollarnyla
formacomosellevarnacabo.

La Secretara verificar que las actividades previamente mencionadas sean compatibles con la
declaratoria y el programa de manejo del rea natural protegida donde se pretendan realizar
dichasactividades,ascomoconlasdisposicioneslegalesyreglamentariasaplicablesalamateria.
Una vez cumplido con lo anterior, la Secretara expedir la autorizacin en un plazo de 20 das
hbilescontadosapartirdelapresentacindelasolicitud.

ARTCULO 200. Los promoventes de las obras o trabajos a que se refiere el artculo anterior,
podrn optar por solicitar que el trmite de autorizacin correspondiente, se integre dentro del
procedimientodeevaluacindeimpactoambiental.

ARTCULO201.Lavigenciadelasautorizacionesser:

I. Hastapordosaos,paraprestacindeserviciostursticos;

II. Porelperiodoquedureeltrabajo,parafilmacionesocapturadeimgenesosonidospor
cualquiermedio,confinescomercialesquerequieranmsdeuntcnicoespecializado;y

III. Porunao,paraventadealimentosyartesanas.

Lasautorizacionesantescitadaspodrnserrevalidadasanualmente.

ARTCULO 202. Las solicitudes de autorizacionesdebernpresentarseantelaSecretara,lacual
analizarsuprocedenciaeintegrarelexpedientequecorresponda.

ARTCULO 203. La Secretara resolver respecto de la solicitud de autorizacin dentro de los
treinta das hbiles siguientes a aqul en que se haya recibido, salvo que se establezca un plazo
distintoenelprogramademanejodelreanaturalprotegidadequesetrate.Transcurridodicho
plazo sin que se emita la resolucin correspondiente, se entender negada la autorizacin y la
Secretara a peticin del particular y dentro de los cinco das siguientes, expedir la constancia
correspondiente.

ARTCULO 204. Sern causas de revocacin de las autorizaciones cualquiera de los siguientes
supuestos:

I. Elincumplimientodelasobligacionesylascondicionesestablecidasenellas;

II. Daaralosecosistemascomoconsecuenciadelusooaprovechamiento;y

III. Infringir las disposiciones previstas en la Ley, el presente ordenamiento, el programa de
manejo del rea protegida respectiva y las dems disposiciones legales y reglamentarias
aplicables.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 75


ARTCULO 205. Debern presentar un aviso acompaado con el proyecto correspondiente, al
Director del rea natural protegida de que se trate, quienes pretendan realizar las siguientes
actividades:

I. Educacinambientalquenoimpliqueningunaactividadextractiva;

II. Investigacinsincolectaomanipulacindeespecmenesdeespeciesnoconsideradasen
riesgo;

III. Monitoreo sin colecta o manipulacin de especmenes de especies no consideradas en
riesgoy

IV. Filmaciones, actividades de fotografa, la captura de imgenes o sonidos por cualquier
medio, con fines cientficos, culturales o educativos, que requieran de equipos
compuestos por ms de un tcnico especializado como apoyo a la persona que opera el
equipoprincipal.

Duranteeldesarrollodelasactividadesaqueserefierenlasfraccionesanteriores,losinteresados
debernrespetarlosiguiente:

a) Depositarlabasurageneradaenloslugaressealadosparatalefecto;

b) Atender las observaciones y recomendaciones formuladas por el personal del rea
naturalprotegida,relativasaasegurarlaproteccinyconservacindelosecosistemas
delrea;

c) Respetarlasrutas,senderosysealizacinestablecida;

d) Nodejarmaterialesqueimpliquenriesgosdeincendiosenelrea;

e) Noalterarelordenycondicionesdelsitioquevisitan;

f) Noalimentar,acosarohacerruidosintensosquealterenalafaunasilvestre;

g) Nocortaromarcarrbolesoplantas;

h) Noapropiarsedefsilesuobjetosarqueolgicos;

i) Noencenderfogatasconvegetacinnativa;y

j) Noalterarlossitiosdeanidacin,refugioyreproduccindeespeciessilvestres.

TTULOV
76
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

PROTECCINALAMBIENTE

CAPTULOI
PREVENCINYCONTROLDELACONTAMINACINDELAATMSFERA

SECCINI
DISPOSICIONESGENERALES

ARTCULO 206. Las atribuciones en materia de prevencin y control de la contaminacin de la
atmsfera, sern ejercidas por el Estado, los Municipios y el Consejo, de conformidad con lo
dispuestoenlaLeyyelpresenteReglamento.

ARTCULO207.CompetealaSecretara:

I. Formular los criterios ecolgicos generales que debern observarse en la prevencin y
controldelacontaminacindelaatmsferasinperjuiciodelosdecarcterparticularque
formulecadaMunicipio;

II. Expedir las normas tcnicas ecolgicas aplicables en la Entidad, en congruencia con las
emitidas por la Federacin, en relacin a los niveles de emisin de contaminantes a la
atmsferaprovenientesdefuentesdeterminadas;

III. Establecersistemasdemonitoreodelacalidaddelaireyemitirdictmenestcnicossobre
losestablecidosporlosMunicipios;

IV. Vigilar se cumplan las disposiciones del presente Reglamento y dems ordenamientos
legalesaplicablesenlamateria;

V. Convenir y en su caso requerir la instalacin de equipo de control de emisiones
contaminantes a la atmsfera con quienes realicen obras o actividades de jurisdiccin
estatal;

VI. Promover en coordinacin con las Autoridades competentes, la instalacin de industrias
queutilicentecnologasycombustiblesquegenerenmenorcontaminacinalaatmsfera;

VII. Promover el fortalecimiento de la conciencia ecolgica, a travs de los medios de
comunicacin masiva y la participacin social para la prevencin y control de la
contaminacinalaatmsfera;

VIII. PromoverantelasAutoridadesdeeducacincompetentes,laincorporacindecontenidos
enloscicloseducativos,ascomoeldesarrollodeplanesyprogramasparalaformacinde
especialistasenmateriadeprevencinycontroldelacontaminacinatmosfrica;

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 77

IX. Promover el desarrollo de investigaciones sobre las causas y efectos de los fenmenos
ambientales, as como el desarrollo de tcnicas y procedimientos tendientes a la
prevencinycontroldelacontaminacindelaatmsfera;

X. Expedir los instructivos, cuestionarios, formatos y manuales necesarios para el
cumplimientodelReglamento;

XI. PromoverantelasAutoridadescompetenteslareubicacindelasfuentesfijas,cuandolas
condicionestopogrficasymeteorolgicasdelsitioenqueseubican,dificultelaadecuada
dispersin de contaminantes a la atmsfera, cuando la calidad del aire as lo requiera o
cuando las caractersticas de los contaminantes constituyan un riesgo inminente de
desequilibrioecolgico;y

XII. Promoverantelasautoridadescompetenteslalimitacinosuspensindelainstalacino
funcionamiento de industrias, comercios, servicios, desarrollo urbano o cualquier
actividadqueafecteopuedaafectarelambienteocausardesequilibrioecolgico.

ARTCULO 208. Sern responsables del cumplimiento de las disposiciones del presente
Reglamento y de las Normas Oficiales Mexicanas, las personas fsicas o morales, pblicas o
privadasquepretendanorealicenobrasoactividadesporlasqueemitanalaatmsferaolores,
gases,partculasslidasolquidas.

ARTCULO 209. Las emisiones de olores, gases, partculas slidas y lquidas que se generen por
fuentesfijasymvilesnodebernexcederlosnivelesmximospermisiblesdeemisineinmisin,
por contaminantes y por fuentes de contaminacin que dictaminen las Normas Oficiales
Mexicanas o Normas Tcnicas Ecolgicas. Tomando en cuenta la diversidad de tecnologas que
presentan las fuentes, podrn establecerse en la Licencia de Funcionamiento correspondiente
diferentes valores al determinar los niveles mximos permisibles, segn se trate de fuentes
existentes,nuevasylocalizadasenzonascrticas.

ARTCULO 210. La Secretara establecer y mantendr actualizado un sistema estatal de
informacindelacalidaddelaire,quecontendrlosdatosdemonitoreoatmosfricoquellevea
cabo la propia Secretara y en coordinacin con los Municipios, as como los inventarios de las
fuentes de contaminacin, de jurisdiccin Federal, Estatal y Municipal, y sus emisiones; dichos
inventariosseintegranconlainformacinquesepresenteenlostrminosdeesteReglamento.

ARTCULO 211. El establecimiento y operacin de los sistemas de monitoreo de la calidad del
aire,debernsujetarsealasnormasqueexpidalaSecretaraencongruenciaconlasemitidaspor
laFederacin.

SECCINII
CONTROLDEEMISIONESPROVENIENTESDEFUENTESFIJAS

78
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO 212. Los responsables de las fuentes fijas por las que se emitan olores, gases o
partculasslidasolquidasalaatmsferaestarnobligadosa:

I. Emplearequiposysistemasquecontrolenlasemisionesalaatmsfera;

II. Integrar un inventario de sus emisiones en el formato o cuestionario que determine la
Secretara;

III. InstalarplataformasypuertosdemuestreoconformealaNormaOficialMexicanavigente
yaplicable;

IV. Medirsusemisionescontaminantesalaatmsferayregistrarsusresultadosenelformato
o cuestionario que determine la Secretara y remitir a sta los registros cuando as lo
solicite;

V. Llevaracabolamedicinyevaluacindesusemisionescontaminantesalaatmsferaen
elentornodelprediodondeestalocalizadalafuentefijaparaconocerlacontribucinde
susemisiones;cuandolafuenteselocaliceenzonasurbanas,colindeconreasnaturales
protegidasopuedancausargravedeterioroalosecosistemasysusrecursosnaturaleso
enlasalud,ajuiciodelaSecretara;

VI. Llevarunabitcoradeoperacinymantenimientodesusequiposdeprocesoydecontrol;

VII. DaravisoanticipadoalaSecretaradeliniciodeoperacindesusprocesos,enelcasode
parosprogramados,siellospuedenprovocarcontaminacin;y

VIII. DaravisodeinmediatoalaSecretaraencasodefalladelequipodecontrol,sistapuede
provocarcontaminacinparaquesedetermineloconducente.

ARTCULO213.Lasfuentesfijasdecompetenciaestatalqueemitanopuedanemitirolores,gases
opartculasslidasolquidasalaatmsfera,requierenlicenciadefuncionamientoexpedidaporla
Secretara.

ARTCULO 214. Para obtener la licencia a que se refiere el artculo anterior, los responsables
presentarnalaSecretaraunasolicitud,acompaadadelainformacinydocumentossiguientes:

I. Datosgeneralesdelsolicitante;

II. Ubicacin;

III. DescripcindelProceso;

IV. Distribucindemaquinariayequipo;

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 79

V. Materiasprimasocombustiblequeseutiliceensuprocesoyformadealmacenamiento;

VI. Transportedemateriasprimasocombustiblesalreadeproceso;

VII. Transformacindemateriasprimasocombustibles;

VIII. Productos,subproductosydesechosquevayanagenerarse;

IX. Almacenamiento,transporteydistribucindeproductosysubproductos;

X. Cantidadynaturalezadeloscontaminantes;

XI. Equiposparaelcontroldelacontaminacinquevayanautilizarse;y

XII. Programa de contingencias que contenga las medidas y acciones que se llevarn a cabo
cuandosepresentencondicionesmeteorolgicasoemisionesdeolores,gasesopartculas
extraordinariasynocontroladas,emitidoporlaautoridadcorrespondiente;

XIII. OtrosquedeterminelaSecretara.

ARTCULO215.Recibidalainformacinaqueserefiereelartculoanterior,laSecretaradentro
de un plazo de 15 das hbiles formular y comunicar al interesado la resolucin
correspondiente:

I. AutorizacindelaLicenciadeFuncionamiento;

II. Autorizarlademaneracondicionada;

III. NegardichaLicenciadeFuncionamiento.

EnelcasodelaFraccinIyIIlaSecretaraprecisarlavigenciadelaLicenciadeFuncionamiento,
laperiodicidadconquedeberremitiralaDireccinelinventariodeemisionescontaminantes,la
informacinydocumentacinindicadaparalaactualizacindelafuentesfijas.

ARTCULO 216. La Secretara podr modificar con base en la informacin a que se refiere el
ltimoprrafodelartculoanterior,losnivelesmximosdeemisinespecficosquehubierefijado
enlaautorizacinotorgadacuando:

I. Lazonaenlaqueseubiquelafuenteseconviertaenunazonacrtica;

II. Existantecnologasdecontroldecontaminantesalaatmsferamseficientes;y

III. Existanmodificacionesenlosprocesosdeproduccinempleadosporlafuente.

80
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO 217. Las emisiones de contaminantes debern canalizarse a travs de ductos y


chimeneas de descarga, con la altura efectiva de acuerdo a la Norma Oficial Mexicana aplicable
para dispersar dichas emisiones. Cuando por cuestiones tcnicas no pueda cumplirse con lo
dispuesto en este artculo, el responsable de la fuente fija deber presentar a la Secretara un
estudiojustificativoparaquestadetermineloconducente.

ARTCULO 218. La combustin a cielo abierto en zonas de jurisdiccin estatal requerir de la
autorizacin de la Secretara, y el interesado deber solicitarlo as con un mnimo de diez das
hbiles de anticipacin a la fecha en que se tenga programado el evento, con la informacin y
documentacinsiguiente:

I. Croquis de localizacin del predio, indicando el lugar preciso en que se efectuarn las
combustiones, construcciones existentes, colindancias ms prximas y condiciones de
seguridadqueimperanenellugar;

II. Programacalendarizado,enelquesepreciselafechayhorariosenlosquetendrnlugar
lascombustiones;

III. Tiposycantidadesdecombustiblequeseincinerar;y

IV. OtrosqueconsiderenecesarioslaSecretara.

La Secretara podr suspender de manera temporal o definitiva el permiso a que se refiere este
artculo,cuandosepresentealgunacontingenciaambientalenlazona.

SECCINIII
CONTROLDEEMISIONESPROVENIENTESDEFUENTESMVILES

ARTCULO 219. Las emisiones de los vehculos automotores que circulen en el territorio del
Estado no debern rebasar los lmites mximos permisibles establecidos en las Normas Oficiales
Mexicanasaplicables.

Lospropietariosdedichosvehculosdebernobservarlasmedidasdeprevencinycontroldela
contaminacin atmosfrica que se establezcan en la Ley, el presente Reglamento y dems
disposicionesaplicables.

ARTCULO220.CorrespondealaSecretara:

I. AplicarlasNormasOficialesMexicanasoexpediryaplicarlasNormasTcnicasEcolgicas,
que establezcan los niveles de emisin mxima permisible de contaminantes a la
atmsfera generados por vehculos automotores, as como las que definan los
procedimientos de verificacin de dichos niveles de emisin, en congruencia con las
emitidasporlaFederacin;y

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 81

II. Participar en la prevencin y control de la contaminacin generada por vehculos


automotores que circulen en el Estado, y promover el establecimiento de programas de
verificacin obligatoria, inscripcin y registro de centros autorizados de verificacin en
coordinacinconlosmunicipios.

III. LasdemsqueconformealaLey,esteReglamentoyotrasdisposicioneslecorrespondan.

ARTCULO221.LaSecretariadeberdecontarconunprogramadeverificacinvehicular,enlas
ciudadesqueapliquenatendiendoalodispuestoenlasNormasOficialesMexicanasenrelacina
lamateria.

CAPTULOII
PREVENCINYCONTROLDELACONTAMINACINPORRUIDO,VIBRACIONES,OLORES,ENERGA
TRMICAYLUMNICA

SECCINI
CONTAMINACINPORRUIDOYVIBRACIONES

ARTCULO222.Seconsiderancomofuentesartificialesdecontaminacinambientaloriginadapor
laemisinderuidolassiguientes:

I. FIJAS. Todo Tipo de industria, mquinas con motores de combustin, terminales y bases
de autobuses y ferrocarriles, aeropuertos, clubes cinegticos, polgonos de tiro, ferias,
tianguis,circosyotrossemejantes;y

II. MVILES. Aviones, helicpteros, ferrocarriles, tranvas, tractocamiones, autobuses,
camiones, automviles, motocicletas, embarcaciones, equipo y maquinaria con motores
decombustinysimilares.

ARTCULO223.Losresponsablesdelasfuentesemisorasdebernproporcionaralasautoridades
competenteslainformacinqueselesrequiera,respectoalaemisinderuido,laSecretaraylos
Municipios, en el mbito de su competencia se consideran auxiliares de la Secretara de Salud
Estatal.

ARTCULO 224. Los niveles mximos permitidos de emisiones de ruido, vibraciones, energa
trmicaylumnicasernlosquesedeterminenenlasNormasOficialesMexicanasaplicablesyla
Secretararealizarmedicionesenlasfuentesdejurisdiccinestatal.

ARTCULO225Elniveldeemisinderuidomximopermisibleenfuentesfijasesde68DB(A)de
lasseisalasveintidshoras,yde65DB(A)delasveintidsalasseishoras.

Estosnivelessemedirnenformacontinuaosemicontinuaenlascolindanciasdelprediodurante
un lapso no menor de quince minutos; conforme la(s) Normas Oficiales Mexicanas
correspondientes el grado de molestia producido por las emisiones de ruido mximo permisible
82
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ser de cinco en escala Likert modificada de 7 grados. Este grado de molestia ser evaluado
conformelasNormasOficialesMexicanascorrespondientes.

ARTCULO 226. Los establecimientos industriales, comerciales, de servicio pblico y toda
edificacin en general, debern construirse de tal forma que permitan un aislamiento acstico
suficiente para que el ruido generado en el interior, no rebase los niveles establecidos en el
artculo225,altrascenderalasconstruccionesadyacentes,predioscolindantesovapblica.

ARTCULO227.LaSecretaraylosMunicipiosenelmbitodesucompetencia,vigilarnqueenla
construccindeobraspblicasoprivadasnoserebaseelnivelmximopermitidodeemisinde
ruidoqueestableceesteReglamento.

ARTCULO 228. A efecto de cumplir con lo sealado en el artculo anterior, la Secretara o los
Municipios podrn solicitar a la Secretara de Salud Estatal informes sobre solicitudes de
autorizacionesparalafijacindenivelesespecficospermitidosodeconstruccin.

ARTCULO 229. nicamente se podr usar silbatos, sirenas, bocinas, campanas, magnavoces,
amplificadores de sonido, timbres o dispositivos para advertir el peligro en situaciones de
emergencia,ancuandorebasenlosnivelesmximospermitidosdeemisinderuido,duranteel
tiempoyconlaintensidadestrictamentenecesariosparalaadvertenciaosetratedevehculosde
bomberos, polica, trnsito y ambulancias en ejercicio de sus funciones, conforme las circulares
emitidasporlaSecretaradeSaludEstatal.

ARTCULO 230. Los circos, ferias y juegos mecnicos que se instalen en la cercana de centros
hospitalarios, guarderas, escuelas, asilos, lugares de descanso y otros sitios donde el ruido
entorpezca cualquier actividad se debern ajustar a un nivel mximo permisible de emisin de
ruidode55DB(A).Estenivelsemedirenformacontinuaysemicontinuaenlascolindanciasdel
predio afectado durante un lapso no menor de quince minutos, conforme las normas
correspondientes.

ARTCULO 231. La Secretara y los Municipios, sin perjuicio de las atribuciones que le
corresponden a la Secretara de Salud Estatal y otras autoridades, podrn sealar zonas de
restriccin temporal o permanente a la emisin de ruido en reas colindantes a centros
hospitalarios o similares, oyendo previamente a los interesados a fin de sealar su extensin y
nivelesmximospermitidosdeemisinderuidoconformelasnormastcnicasaplicables.

ARTCULO 232. Las Autoridades de Trnsito en coordinacin con la Secretara de Salud Estatal
fijarn las rutas, horarios y lmites de velocidad a los servicios pblicos de autotransporte, con
objetodeprevenirycontrolarlacontaminacinporruido.

ARTCULO 233. En caso de presuncin de que un vehculo automotor ha rebasado el lmite
mximo permisible de emisin de ruido, la autoridad de trnsito competente, detendr
momentneamente el mismo y efectuar la medicin del ruido por el mtodo esttico de
deteccin,deacuerdoconlanormatcnicaecolgicacorrespondiente.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 83


El conductor o responsable del vehculo deber repararlo y presentarlo dentro de los cinco das
hbilessiguientesauncentrodemedicinautorizadoafindequeprocedaalamedicindesus
emisionesporelmtododinmicoconformelasnormasaplicables.

Encasodenopresentarelvehculoeneltrminosealadoenelprrafoanterior,seordenarsu
detencin para que previa medicin, sea retirado de la circulacin, sin perjuicio de la sancin
administrativaquecorresponda,levantndoseelactacorrespondiente,debidamentemotivaday
fundamentada.

ARTCULO234.LasAutoridadesdeTrnsitodeacuerdoconlosresultadosobtenidosporelcentro
autorizadoconformeelartculoanteriorconcedernunplazodeterminadoalinteresadoparaque
ajustelasemisionesdelvehculocontaminantealoslmitesestablecidosenelreglamento.

ARTCULO 235. Queda prohibida la circulacin de vehculos con escape abierto y de los que
produzcanruidoporelarrastredepiezasmetlicasoporlacargaquetransporten.

ARTCULO236.Entodaoperacindecargaydescargademercancasuobjetosqueserealiceen
lavapblica,elresponsabledelaoperacinnodeberrebasarunnivelde90DB(A)delassietea
lasveintidshorasyde85DB(A)delasveintidshorasalassietehoras,medidosdeacuerdoalas
NormasOficialesMexicanas.

ARTCULO 237. Salvo lo dispuesto en el Artculo 114 de la Ley, el ruido producido en casa
habitacin por la actividad domstica no es objeto de sancin, la reiterada realizacin de
actividadesruidosasquemolestenalosvecinos,noseconsiderancomodomsticasyentalcaso,
la Secretara o los Municipios en el mbito de su competencia, probados los hechos de la
denuncia,aplicarnlasancincorrespondiente.

CAPTULOIII
PREVENCINYCONTROLDELASACTIVIDADESRIESGOSAS

SECCINNICA

ARTCULO 238. La Secretara clasificar y publicar en el Peridico Oficial del Estado, las
actividades industriales, comerciales y de servicios que se consideren riesgosas, en las que se
manejenmaterialesysustanciasqumicas,considerandosuscaractersticasyvolmenes.

Larealizacindeactividadesindustriales,comercialesodeserviciosriesgosas,sellevarnacabo
conapegoalodispuestoporestaLey,lasdisposicionesreglamentariasquedeellaemanenylas
normas oficiales mexicanas. Quienes realicen actividades riesgosas, en los trminos del
Reglamento correspondiente, debern formular y presentar a la Secretara un estudio de riesgo
ambiental,ascomosometeralaaprobacindedichadependenciaydelasSecretarasGeneral,
de Salud y del Trabajo y Previsin Social, los programas para la prevencin de accidentes en la
realizacindetalesactividades,quepuedancausargravesdesequilibriosecolgicos.
84
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


Quienesrealicenactividadesriesgosas,enlostrminosdelReglamentocorrespondiente,debern
contarconunseguroderiesgoambiental.

LasActividadesRiesgosasdecompetenciaEstatalsonaquellasactividadesindustrialesenlasque
se manejen materiales y substancias qumicas, que de acuerdo a sus caractersticas, volmenes,
sernclasificadasporlaSecretaraypublicadaenelPeridicoOficialdelEstado.

ARTCULO239.AdemsdelasactividadesriesgosasquehanquedadoestablecidasenelArtculo
cuarto de este Reglamento, se deber de considerar la ubicacin de los establecimientos, por la
gravedaddelosefectosquepuedegenerarenlosecosistemasoenelambiente.

ARTCULO 240. Quienes pretendan realizar actividades riesgosas que requieran contar con
autorizacinenmateriadeevaluacindelimpactoambiental,conformealoprevistoporlaLey,
debern incluir a la manifestacin del impacto ambiental el estudio de riesgo respectivo, el cual
debercontenerlainformacinprevistaenelartculo41delaley,seevaluardeacuerdoalas
disposiciones de este Reglamento. Quienes pretendan realizar actividades riesgosas que no
requierancontarconautorizacinenmateriadeimpactoambientaldeconformidadalartculo41
delaLeyyesteReglamentoenmateriadeEvaluacindelImpactoAmbiental,deconformidadal
artculo238delaLeydebernformularypresentarelestudioderiesgodeacuerdoaloprevisto
enelpresentereglamento.

ARTCULO 241. El estudio de anlisis de riesgo ambiental deber presentarse conforme a lo
establecidoporlaSecretara,apegndosealaguaparatalefectoseemite.

ARTCULO242.LaSecretaraanalizarelestudiodeanlisisderiesgoycomunicaralinteresado
siprocedeono.

ARTCULO 243. Los estudios de riesgo debern ser elaborados y firmados por un prestador de
servicioqueestinscritoenelRegistroEstataldePrestadoresdeServiciodelaSecretara.

ARTCULO 244. La Secretara podr requerir al interesado informacin adicional, cuando se
requiera para hacer posible la evaluacin del estudio de riesgo, as como solicitar los elementos
tcnicosquesirvierondebaseparadeterminarelnivelderiesgo.

CAPTULOIV
EXTRACCINDEMINERALES

SECCINNICA
DISPOSICIONESGENERALES

ARTCULO 245. Quienes pretendan realizar obras o actividades pblicas o privadas para el
aprovechamientodelosmineralesosustanciasnoreservadasalafederacin,deberncontarcon
autorizacindelaSecretara,enlostrminosdelosartculos123y124delaLey.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 85


ARTCULO246.Laspersonasfsicasomoralesautorizadasconformealartculoanterior,debern:

I. Presentar previo al inicio de sus operaciones un programa de regeneracin y/o
remediaciny/oreforestacindelasreasutilizadasparaaprobacindelaSecretara;

II. Una vez iniciadas las operaciones presentar a la Secretara informes de los avances del
programaautorizadoparalaregeneraciny/oremediaciny/oreforestacindelasreas
utilizadas,enlosplazosestablecidosenelmismo.

III. Llevar una bitcora diaria del aprovechamiento de los minerales o sustancias no
reservadas a la federacin, en la que se registren, entre otros datos: fecha, tipo de
material,procedencia,cantidadyautorizacin.

ARTCULO 247. Las persona fsicas o morales que realicen o pretendan realizar obras o
actividades pblicas o privadas para el aprovechamiento de los minerales o sustancias no
reservadasalafederacindeberncontarcon:laLicenciaAmbientalUnicaparaeldesarrollodesu
actividadproductiva,laLicenciadeFuncionamientoenbasealUsodeSuelo,elPermisoparaUso
de Explosivos de ser el caso, y la Licencia de Uso del Suelo, emitidos por las autoridades
competentes, sin perjuicio de las autorizaciones, permisos o cualquier otro trmite que deba
obtenerdelasautoridadesfederales,estataly/omunicipal.

CAPTULOV

REGISTRODEEMISIONESYTRANSFERENCIADECONTAMINANTES

ARTCULO 248. El Estado deber integrar un Registro de Emisiones y Transferencia de
ContaminantesydelassustanciasquedeterminelaSecretara;coninformacinsobreemisiones
alaire,agua,sueloysubsueloytransferenciasenresiduosyendescargasdeaguasresidualesde
sucompetencia,ascomodeaquellassustanciasquedeterminelaautoridadcorrespondiente.

La informacin de la base de datos del registro se integrar con los datos y documentos
contenidos en las autorizaciones, cdulas, informes, reportes, licencias, permisos y concesiones
queenmateriaambientalsetramitenantelaSecretara,oautoridadcompetentedelEstado.

Lainformacinqueseintegrealabasededatosdelregistroquepresentenlosestablecimientos
sujetos a reporte de competencia del Estado, ser actualizada con los datos correspondientes a
susemisionesytransferenciadecontaminantesysustanciassujetasareporte.

Labasededatosdelregistroseactualizarconlainformacinquepresentenlaspersonasfsicasy
morales responsables de los establecimientos sujetos a reporte, ante la Secretara, en el cual se
integrarnlosdatosdesagregadosporsustanciayporfuente.

86
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

La informacin registrada ser pblica y tendr efectos declarativos. La Secretara permitir el


accesoadichainformacinenlostrminosdelaLeyylasdemsdisposicionesjurdicasaplicables
yladifundirdemaneraproactiva.

Tambin se incluirn al RETC los datos sobre emisiones y transferencia de contaminantes de las
fuentesdifusasofuentesdereaqueselocalicenenelestado.

ARTCULO249.SeconsideranestablecimientossujetosareportedecompetenciadelEstadolas
fuentes fijas que no sean de competencia federal, conforme a lo establecido en el artculo 99
segundoprrafodelaLey,ascomoaquellasquegenerenresiduosdemanejoespecial.

ARTCULO 250. Para actualizar la Base de Datos del Registro, los establecimientos sujetos a
reporte de competencia estatal, debern presentar la informacin sobre sus emisiones y
transferenciadecontaminantes,alaire,agua,sueloysubsuelo,materialesyresiduosdemanejo
especial,conformealosealadoenlosartculos257y258delpresenteReglamento,ascomode
aquellassustanciasquedeterminelaSecretaracomosujetasareporte.

LainformacinaqueserefiereelprrafoanteriorseproporcionaratravsdelFREquealefecto
determinelaSecretaraycontendrlasiguienteinformacin:

I. Datos de identificacin y firma del promovente, nombre de la persona fsica, o
denominacinoraznsocialdelaempresa,registrofederaldecontribuyentes,ydomicilio
uotrosmediosparaoryrecibirnotificaciones;

II. Datos de identificacin del establecimiento sujeto a reporte de competencia estatal, los
cuales incluirn su domicilio y ubicacin geogrfica, expresada en Coordenadas
GeogrficasoUniversalTrasversadeMercator;

III. Datos administrativos, en los cuales se expresarn: fecha de inicio de operaciones,
participacin de capital, Cmara a la cual se encuentra afiliado, en su caso, datos de la
Compaa Matriz o Corporativo al cual pertenece, nmero de personal empleado, y
periodosdetrabajo;

IV. La informacin tcnica general del establecimiento, en la cual se incluirn los diagramas
de operacin y funcionamiento que describirn el o los procesos productivos desde la
entrada del insumo y su transformacin, hasta que se produzca la emisin, descarga,
generacin de residuos de manejo especial o transferencia total o parcial de
contaminantes, as como los datos de insumos, productos, subproductos y consumo
energticoempleados;

V. La relativa a las emisiones de contaminantes a la atmsfera, en la cual se incluirn las
caractersticasdelamaquinaria,equipooactividadquelasgenere,describiendoelpunto
degeneracinyeltipodeemisin,ascomolascaractersticasdelaschimeneasyductos
dedescargadedichasemisiones.Enelcasodecontaminantesatmosfricoscuyaemisin
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 87

estreguladaenNormasOficialesMexicanas,debernreportarseademslosresultados
delosmuestreosyanlisisrealizadosconformeadichasnormas.Lainformacinaquese
refiereestafraccinsereportartambinporcontaminante;

VI. La respectiva al aprovechamiento de agua, registro de descargas y transferencia de
contaminantesysustanciasalagua,enlacualsereportarnlasfuentesdeextraccinde
agua,losdatosgeneralesdelasdescargas,incluyendolasrealizadasacuerposreceptores
yalcantarillado,ascomolascaractersticasdedichasdescargas;

VII. La inherente a la generacin y transferencia de residuos de manejo especial, la cual
contendrelnmeroderegistrodelgenerador,losdatosdegeneracinytransferenciade
residuos de manejo especial, incluyendo los relativos a su almacenamiento dentro del
establecimiento,ascomosutratamientoydisposicinfinal;

VIII. La concerniente a la emisin y transferencia de aquellas sustancias que determine la
Secretara como sujetas a reporte, as como los datos relacionados a su produccin,
elaboracinouso;

IX. La referente para aquellas emisiones o transferencias derivadas de accidentes,
contingencias,fugasoderrames,iniciodeoperacionesyparosprogramados,mismaque
deber ser reportada por cada evento que se haya tenido, incluyendo la combustin a
cieloabierto,y

X. La relativa a la prevencin y manejo de la contaminacin, en la cual se describirn las
actividadesdeprevencinrealizadasenlafuenteysureadeaplicacin,ascomolasde
reutilizacin,reciclaje,obtencindeenerga,tratamiento,controlodisposicinfinaldelas
sustanciasaqueserefierelafraccinVIIIdelpresenteartculo.

ARTCULO251.ElFREdeberpresentarsealaSecretaradentrodelperiodocomprendidoentre
el1deeneroal30deabrildecadaao,enelformatoquedeterminedichaautoridad,debiendo
reportarse el periodo de operaciones realizadas por el establecimiento sujeto a reporte de
competenciaestatal,del1deeneroal31dediciembredelaoinmediatoanterior.

ARTCULO 252. El establecimiento sujeto a reporte de competencia estatal, presentar ante la
Secretara,laCdulaporcualquieradelossiguientesmedios:

I. En formato impreso, a la cual se deber anexar un disco magntico que contenga el
archivoelectrnicodedichaCdula;

II. En archivo electrnico, contenida en un disco magntico, anexando la impresin con la
informacindelapartadocorrespondienteaDatosdeRegistro,conformealformatodela
Cdula.

88
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

La Secretara pondr a disposicin de los interesados los formatos a que se refiere el presente
artculoparasulibrereproduccin.

ARTCULO 253. El FRE deber contar con la firma autgrafa del representante legal del
establecimientosujetoareporte,paralocualelpromoventedeberacreditarsupersonalidadal
momentodeiniciareltrmitederegistro.

ARTCULO254.LosFREqueserecibanporconductodelaSecretaradebernremitirsealRegistro
dentrodelos60dashbilessiguientesasuperiododerecepcin.

DentrodeesteperiodolaSecretara,contarconunplazode60dashbilespararevisarquela
informacincontenidaenlaCdulaseencuentredebidamenterequisitada,encasocontrario,se
requerir al promovente, que complemente, rectifique, aclare, o confirme la informacin
presentadaenunplazonomayora15dashbiles,contadosapartirdesunotificacin,lacualse
formularenlostrminosdelosordenamientosjurdicosaplicables.

En caso de que el promovente no presente la informacin requerida a que se refiere el prrafo
anterior, se tendr por no presentada la Cdula. Cuando dicha Cdula no sea presentada o sta
contenga datos falsos se aplicarn las sanciones administrativas establecidas en la Ley y dems
instrumentos jurdicos aplicables, sin perjuicio de las sanciones que resulten aplicables. En todo
caso,seconsideraralagravedaddelainfraccin.

Cuando el promovente detecte que el formato no est debidamente requisitado, deber
presentarenunplazonomayora20dashbilescontadosapartirdelaentregadelaCdula,la
documentacin que subsane los datos faltantes, o en su caso, los errores materiales o de
concepto.Unavezconcluidalarevisin,laSecretaraintegraralaBasededatosdelregistrola
informacincontenidaenlaCdulatalycomoseapresentadaporlospromoventes,quienessern
responsablesdesuveracidad.

ARTCULO255.Paralaorganizacinyconservacindelosarchivosdocumentalesyelectrnicos,
quecontenganlainformacinpresentadaporlosestablecimientossujetosareporte,seestaralo
dispuesto por los lineamientos y criterios que establecen la Ley de Transparencia y Acceso a la
InformacinPblicadelEstadodeChihuahua,suReglamentoydemsdisposicionesquedeella
deriven.

ARTCULO256.Lassustanciassujetasareportedecompetenciaestatal,losumbralesdereportey
loscriteriostcnicosyprocedimientosparaincluiryexcluirsustanciasserndeterminadosporla
Secretara.

ARTCULO257Lasemisionesytransferenciasdecontaminantesysustanciassujetasareportede
competencia estatal que estn reguladas por Normas Oficiales Mexicanas, debern medirse
utilizando los mtodos, equipos, procedimientos de muestreo y reportes especificados en las
NormasOficialesMexicanas,yenlasNormasMexicanasqueseanreferidasenestasltimas.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 89

ARTCULO 258. Para efectos del presente Reglamento, las emisiones y transferencia de
contaminantesysustanciassujetasareportedecompetenciaestatal,quenoestnreguladaspor
Normas Oficiales Mexicanas o cuya medicin est exenta, pueden estimarse a travs de
metodologascomnmenteutilizadas,talescomolaaplicacindefactoresdeemisin,estimacin
mediantedatoshistricos,balancedemateriales,clculosdeingenieraomodelosmatemticos.

ARTCULO 259. Los establecimientos sujetos a reporte de competencia estatal, debern
conservarduranteunperiododecincoaos,apartirdelapresentacindelaCdula,lasmemorias
de clculo y las mediciones relacionadas con las metodologas; dicha informacin estar a
disposicindelaSecretaraenelmomentoquelarequiera.

ARTCULO 260. Los Organismos Empresariales, las Cmaras, las Asociaciones Industriales,
Instituciones educativas y de Investigacin, los Colegios y Asociaciones Profesionales,
organizacionesNoGubernamentalesyexpertosenlamateria,podrnparticiparconlaSecretara
en el desarrollo de metodologas de medicin y estimacin de emisiones y transferencia de
contaminantes y sustancias cuando dichas metodologas y estimaciones no se encuentren
previstasenNormasOficialesMexicanas.

ARTCULO261.ElregistroestaracargodelaSecretarayseroperadoporeltitulardelaunidad
administrativaquecorrespondaconformealoestablecidoensuReglamentoInterior,quienpara
la integracin de la informacin de la Base de Datos se auxiliar de los servidores pblicos
adscritosadichaunidadadministrativa.

ARTCULO 262. Los servidores pblicos que integren la informacin a la Base de datos se
encargarnde:

I. Revisar e inscribir la informacin de emisiones y transferencia de contaminantes, y
sustancias sujetas a reporte de competencia estatal, contenidas en el FRE y la
concentrarnenlosarchivosqueparatalefectosedestinen;

II. Integrar al registro los datos que proporcionen las oficinas regionales y en su caso, los
Municipios;

III. Mantenerla actualizada, de acuerdo a la informacin que proporcionen los
establecimientos sujetos a reporte, y los datos que se obtengan de las fuentes difusas,
conformealosprocedimientosestablecidosenesteReglamento,y

IV. SistematizarlainformacinestadsticasobrelosdatosinscritosycontenidosenlaBasede
datos.

ARTCULO263.LainformacinambientaldecarcterpblicodelaBasededatosdelregistro,es
lasiguiente:

90
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

I. Nombre de la persona fsica, denominacin o razn social del establecimiento sujeto a


reporte;

II. Emisionesytransferenciadecontaminantesysustanciassujetasareportedecompetencia
estatal, conforme a lo establecido en el primer prrafo del artculo 250 del presente
Reglamento,y

III. Localizacingeogrficadelestablecimientosujetoareporte.

La informacin a que hace mencin este artculo ser integrado al registro de emisiones y
transferencia de contaminantes y al Sistema Nacional de Informacin Ambiental y de Recursos
NaturalesaqueserefierelaLeyGeneral.

ARTCULO264.LaSecretarapublicarunInformeAnualelcualdifundirpormedioselectrnicos
oimpresosysernicamenteconfinesdeinformacinyconsulta.

LaSecretaradaraconocerunaversinpreliminardelInformeAnualenunperiodonomayora
60 das naturales antes de la publicacin definitiva de dicho Informe, a efecto de que los
establecimientossujetosareporterevisenquelainformacinpreliminarcoincidaconloreportado
alaSecretara.Encasodehaberdiscrepancia,losinteresadospodrnsolicitarporescrito,enun
plazonomayora30dasnaturalesapartirdelapublicacindelaversinpreliminardelinforme
lasaclaracionesaquehayalugar.

ARTCULO265.CualquierinteresadoquedeseeobtenerinformacinrelativaalaBasedeDatos
del Registro, deber presentar su solicitud por escrito ante la Secretara, conforme al
procedimientoprevistoenlaLeydeTransparenciayAccesoalaInformacinPblicadelEstadode
Chihuahua.

La Secretara negar la informacin solicitada si se encuentra en alguno de los supuestos
contenidos en los artculos referentes a la informacin reservada o confidencial o si sta es
consideradadecarcterreservadooconfidencial,deconformidadconlodispuestoporlaLeyde
Transparencia y Acceso a la Informacin Pblica del Estado de Chihuahua, y su Reglamento,
debiendoencualquiercasosealarlasrazonesquemotivaronsunegativa.

ARTCULO266.LosservidorespblicosencargadosdelaintegracindelainformacinalaBase
deDatosdelRegistro,sernsujetosdesancinadministrativacuando:

I. Por negligencia, no se inscriba a la Base de datos del Registro en tiempo la informacin
proporcionadaporlosestablecimientossujetosareportedecompetenciaestatal,y

II. Pornegligencia,doloomalafe,sealteretotaloparcialmentelainformacin,secometan
inexactitudesuomisionesenlacapturadelainformacinyqueporellosecausendaosy
perjuiciosaterceros.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 91

Losservidorespblicosaqueserefiereelpresenteartculosernresponsablesdelmanejodela
informacin a que tengan acceso con motivo de la operacin del Registro y en su caso, sern
sancionados conforme a lo establecido en la Ley de Transparencia y Acceso a la Informacin
PblicadelEstadodeChihuahua,yalaLeydeResponsabilidadesdelosServidoresPblicosdel
EstadodeChihuahua,sinperjuiciodelaresponsabilidadcivilypenalaquehayalugar.

ARTCULO 267. La Secretara realizar actos de inspeccin y vigilancia en los establecimientos
sujetosareportedecompetenciaestatalparaverificarlainformacinproporcionada,ascomosu
entregaentiempoyforma.

ARTCULO268.Lainspeccinyvigilanciasellevaracaboporpersonalautorizadoatravsde:

I. Requerimientodeinformes,datosodocumentos,y

II. Visitasdeinspeccinalosestablecimientossujetosareportedecompetenciaestatal.

ARTCULO269.ElEstadodeberpromoverenlosMunicipioslaintegracindelRETCMunicipal,
parasuintegracinalRegistroEstatal.

ARTCULO270.ElEstadoylosMunicipios,podrnconvenirconlaFederacin,ladeterminacin
demecanismos,directricesyprincipiostcnicosparauniformaryhomologarlaintegracindelas
bases de datos de sus respectivas competencias para la integracin del registro de emisiones y
transferenciadecontaminantesaqueserefierelaLeyGeneral.

ARTCULO 271. Quienes presten servicios a terceros referente a estudios de emisiones de
contaminantes, y elaboracin de la Cdula de Operacin sobre Emisiones y Transferencia de
Contaminantesysustanciassujetasareportedecompetenciaestatal,debernestarinscritosenel
RegistroEstataldePrestadoresdeServiciodelaSecretaria.

Losinteresadosenrealizarlosestudiosaqueserefiereelprrafoanterior,debernpresentarala
Secretaraunasolicitud,conlainformacinydocumentossiguientes:

I. Nombre,nacionalidadydomicilio,

II. Documentos que acrediten la experiencia y capacidad tcnica del interesado en la
realizacindeestosestudios,y

III. OtrosquerequieralaSecretara.

ARTCULO 272. La Secretara promover la celebracin de acuerdos de coordinacin con la
FederacinylosMunicipios,respectodelasactividadesaqueserefiereelpresenteTitulo.

TTULOVII
MEDIDASDECONTROL,DESEGURIDADYSANCIONES
92
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


CAPTULONICO
INSPECCINYVIGILANCIA

ARTCULO 273. La Secretara, los Municipios y la Autoridad del Agua, respectivamente en el
mbito de su competencia, vigilarn el cumplimiento de la Ley, su Reglamento y dems
disposiciones aplicables relacionadas con el equilibrio ecolgico y la proteccin al ambiente,
conformealodispuestoenesteCapitulo.

En materia de agua, la Autoridad del Agua realizar los actos de inspeccin y vigilancia para
verificareldebidocumplimientodelodispuestoenlaLeydelAguadelEstadodeChihuahuaysu
Reglamento en materia de aguas asignadas o concesionadas al Estado, y dems disposiciones
legalesyreglamentariasaplicables,sinperjuiciodelasfacultadesdelaFederacinenmateriade
tratamiento,descarga,infiltracinyreusodeaguasresiduales.

En lo que las disposiciones del presente Titulo sean omisas, se aplicarn supletoriamente las
disposicionesdelCdigodeProcedimientosCivilesdelEstadodeChihuahua.

ARTCULO274.LasvisitasquelaAutoridadAmbientalrealiceparaverificarelcumplimientodela
normatividadenmateriaambiental,sedistinguendelasiguientemanera:

I. Sern de inspeccin cuando su objeto sea examinar el cabal cumplimiento de la
normatividadambientalvigente;

II. Serndeverificacincuandosuobjetoseaconstatarelcumplimientodelasdisposiciones
establecidas en las resoluciones que dicte la autoridad ambiental en los procedimientos
administrativosquesubstancien;

Asmismo,lasvisitasdeinspeccinoverificacin,sern:

III. Ordinarias, que se llevarn a cabo en das hbiles y horarios normales de operacin
establecidosyquepodrncomprenderdesdelas07:00hastalas19:00horas;y

IV. Extraordinarias, que se llevarn a cabo en das inhbiles y horarios no laborables, en las
que,atendiendolaclasificacindelasfraccionesIyIIdeesteArtculo,seespecificarael
carcterdelavisitayelhorarioenquesellevaracabo.

ARTCULO 275. El personal que practique la visita, deber entregar a la Autoridad Ambiental
ordenadora el acta correspondiente, en un plazo mximo de veinticuatro horas siguientes a la
conclusindelavisita.

ARTCULO276.Elderechodelvisitadoamanifestarloqueasuderechoconvengaenrelacincon
los hechos asentados en el Acta, a que se refiere el prrafo segundo del Artculo 202 de la Ley,
podrejercitarsealfinaldelavisita.
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 93


Alefecto,elvisitadopodrpresentarlasevidenciasconlasquesustenteeldichoaqueserefiere
elprrafoanterior.

ARTCULO277.Elemplazamientoaprocedimientoadministrativodependerentodomomento
de que del Acta que corresponda a la visita de inspeccin o verificacin segn sea el caso, se
desprendan omisiones o violaciones a la normatividad ambiental; debindose aplicar en lo
conducente los Artculos 205, 206 y 207 de la Ley, en caso contrario, se acordar el archivo del
expedientequesehayaformado.

ARTCULO 278. Las notificaciones de los actos administrativos dictados con motivo de la
aplicacindelaLey,serealizarn:

I. Personalmente o por correo certificado con acuse de recibo, cuando se trate de
emplazamientos y resoluciones administrativas definitivas, sin perjuicio de que la
notificacin de estos actos pueda efectuarse en las oficinas de las Unidades
Administrativas competentes de la Autoridad Ambiental, si las personas a quienes deba
notificarse se presentan en las mismas. En este ltimo caso, se asentar la razn
correspondiente;

II. Porrotuln,colocadoenlosestradosdelaUnidadAdministrativacompetente,cuandola
personaaquiendebanotificarsenopuedaserubicadadespusdeiniciadaslasfacultades
deinspeccin,vigilanciaoverificacinalasqueserefiereelpresenteTtulo,ocuandono
hubiera sealado domicilio en la poblacin donde se encuentre ubicada la sede de la
autoridadordenadora;

III. Por edicto, cuando se desconozca el domicilio del interesado o en su caso cuando la
personaaquiendebanotificarsehayadesaparecido,o seencuentreenelextranjerosin
haberdejadorepresentantelegaloautorizadoparatalesefectos.

Tratndose de actos distintos a los sealados en la fraccin I de este artculo, las notificaciones
podrnrealizarseporcorreoordinario,mensajeraopreviasolicitudporescritodelinteresado,a
travs de medios de comunicacin electrnica u otro similar o en las oficinas de las Unidades
Administrativas de la Autoridad Ambiental, si se presentan las personas que han de recibirlas a
mstardardentrodeltrminodecincodashbilessiguientescontadosapartirdeldaenquese
dictenlosactosquehandenotificarse.Loanterior,sinperjuiciodequelaAutoridadAmbientallo
haga por estrados, dentro del trmino de diez das hbiles contados a partir del da en que se
dicten los actos que han de notificarse, el cual se fijar en lugar visible de las oficinas de las
referidasUnidadesAdministrativas.

Silosinteresados,susrepresentanteslegalesolaspersonasautorizadasporellos,noocurrenalas
oficinas de las Unidades Administrativas de la Autoridad Ambiental, a notificarse dentro del
trmino sealado en el prrafo anterior, las notificaciones se darn por hechas, y surtirn sus
efectoseldahbilsiguientealdelafijacinenelestrado.
94
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


De toda notificacin por rotuln o estrado se agregar, al expediente, un tanto de aquel,
asentndoselarazncorrespondiente;y

IV. Por instructivo, solamente en el caso sealado en el tercer prrafo del artculo 279 del
presenteReglamento.

ARTCULO 279. Las notificaciones personales se harn en el domicilio del interesado o en el
ltimodomicilioquelapersonaaquiensedebanotificarhayasealadoenlapoblacindondese
encuentre la sede de las Unidades Administrativas de la Autoridad Ambiental, o bien,
personalmenteenelrecintooficialdestas,cuandocomparezcanvoluntariamentearecibirlas;en
losdosprimeroscasos,elnotificadordebercerciorarsequesetratadeldomiciliodelinteresado
odeldesignadoparaesosefectosydeberentregareloriginaldelactoquesenotifiqueycopiade
laconstanciadenotificacinrespectiva,ascomosealarlafechayhoraenquelanotificacinse
efecta,recabandoelnombreyfirmadelapersonaconquienseentiendaladiligencia.Sistase
niega,seharconstarenelactadenotificacin,sinqueelloafectesuvalidez.

Las notificaciones personales, se entendern con la persona que deba ser notificada o su
representantelegal;afaltadeambos,elnotificadordejarcitatorioconcualquierpersonaquese
encuentreeneldomicilio,paraqueelinteresadoespereaunahorafijadeldahbilsiguiente.Si
el domicilio se encontrare cerrado, el citatorio se dejar en un lugar visible del mismo, o con el
vecinomsinmediato.

Silapersonaaquienhayadenotificarsenoatendiereelcitatorio,lanotificacinseentendercon
cualquier persona que se encuentre en el domicilio en que se realice la diligencia y, de negarse
staarecibirlaoensucasodeencontrarsecerradoeldomicilio,serealizarporinstructivoquese
fijarenunlugarvisibledeldomicilio,oconelvecinomscercano,loqueseharconstarenel
actadenotificacin,sinqueelloafectesuvalidez.

Delasdiligenciasenqueconstelanotificacin,elnotificadortomarraznporescrito.

ARTCULO 280. Las notificaciones por edictos se realizarn haciendo publicaciones que
contendrn un resumen de los actos por notificar. Dichas publicaciones debern efectuarse dos
vecesdentrodeunperiododesietedasenelPeridicoOficialdelEstado.

ARTCULO 281. Las notificaciones personales surtirn sus efectos el da en que hubieren sido
realizadas.Losplazosempezarnacorrerapartirdeldahbilsiguienteaaquelenquesehaya
surtidoefectoslanotificacin.

Setendrcomofechadenotificacinporcorreocertificadolaqueconsteenelacusederecibo.

Enlasnotificacionesporedictossetendrcomofechadenotificacinladelaltimapublicacin
enelPeridicoOficialdelEstado.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 95

Lasnotificacionesporrotulnsurtirnsusefectosaldahbilsiguientealdelafijacindelmismo.

ARTCULO282.Todanotificacindeberefectuarseenunplazomximodequincedashbiles,
contados a partir de la emisin de la resolucin o acto que se notifique, y deber contener un
resumendelosactospornotificar,ascomoelfundamentolegalenqueseapoyeconlaindicacin
de si es o no definitivo en la va administrativa, y en su caso, la expresin del recurso
administrativoquecontralamismaproceda,rganoanteelcualhubieradepresentarseyplazo
parasuinterposicin.

TTULOVIII
AUTOREGULACIN

CAPTULOI
DISPOSICIONESGENERALES

ARTCULO283.Losresponsablesdelfuncionamientodeunaempresapodrnenformavoluntaria
realizarauditorasambientalesestatalesrespectodelacontaminacinyelriesgoquegeneran,as
comoelgradodecumplimientodelanormatividadambientalydelosparmetrosextranjerose
internacionalesydebuenasprcticasdeoperacineingenieraaplicables,conelobjetodedefinir
medidaspreventivasycorrectivasnecesariasparaprotegerelambiente.

ARTCULO284.Lasauditorasambientalesestatalestendrncomopropsitolarealizacindelos
principios de poltica ambiental contenidos en el artculo 26, fracciones III y VI, de la Ley. La
Secretara, con el apoyo del Consejo promover la ejecucin de dichas auditoras como un
incentivoaquienes,enformavoluntaria,asumancompromisosadicionalesalcumplimientodela
legislacin ambiental y sus disposiciones reglamentarias, con el fin de prevenir, minimizar,
restaurar, o compensar los daos al ambiente que puedan producirse o se hayan producido por
quienes realicen obras o actividades que generen efectos adversos al ambiente y los recursos
naturales.

A fin de cubrir todos los efectos ambientales que puede provocar una empresa, las medidas
derivadasdelasauditorasambientalesestatalesdeberngarantizarnosloelcumplimientode
lasdisposicionesvigentesenlasmateriasquetenganopuedantenerincidenciaenelambienteo
los recursos naturales, sino adems la adopcin de parmetros extranjeros e internacionales y
buenas prcticas de operacin e ingeniera, en los aspectos no regulados por aqullas. Dichas
medidasdebernestarincorporadasenlasBasesdelProgramadeAutorregulacinsealadosen
elartculo289deesteordenamiento.

ARTCULO 285. Con el propsito de que los resultados que se obtengan de la realizacin de
auditoras ambientales sean reconocidos por las dependencias y entidades de los gobiernos
Federales, Estatales y Municipales, de acuerdo con la competencia que a cada una de ellas
corresponda,laSecretarapromoverlacelebracindelosacuerdosdecoordinacinrespectivos.

96
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO 286. La Secretara promover acciones de concertacin con asociaciones, cmaras


industriales,ramasdeactividadcomercialascomodeservicioylasconfederacionesdestas,con
objetodepromoverlarealizacindeauditorasambientalesestatalesentresusmiembrosyllevar
acaboactividadesdecapacitacinenlamateria.

Asimismo,promoverlasaccionesdeconcertacinnecesariasconcmaras,sindicatosyempresas,
conobjetodeincluirenlostemasatratarseenelsenodelascomisionesdeseguridadehigieney
de adiestramiento y capacitacin, captulos relativos a la proteccin ambiental, para crear y
fortalecerunaconcienciaecolgicaentrelosfactoresdelaproduccin.

ARTCULO 287. Cuando una empresa que pretenda ser sometida a una auditora ambiental
estatalhubierasidoinspeccionadaporlaautoridadambiental,nopodrnmodificarselosplazos,
condiciones y medidas impuestas en las autorizaciones ambientales o aquellas que se hubieran
ordenado durante el desahogo del procedimiento respectivo, salvo que dichos trminos y
condiciones tengan que ajustarse para la realizacin de actividades que produzcan mayores
beneficiosalambiente,losecosistemasoalasaludpblica.

ARTCULO288.Cuandoelresponsabledeunaempresaasumaenformavoluntarialarealizacin
deunaauditoraambientalestatal,ascomoeldesarrollodelasmedidaspreventivasycorrectivas
quederivendelamismaenlostrminosdelpresenteReglamento,laSecretarapodrconsiderar
ello como una inversin del interesado en la adquisicin e instalacin de equipo para evitar la
contaminacinambientaloenaccionesdeproteccin,preservacinorestauracindelambiente,
siemprequenoexistariesgoinminentededesequilibrioecolgico,odedaoodeteriorogravea
losrecursosnaturales,casosdecontaminacinconrepercusionespeligrosasparalosecosistemas,
sus componentes o no se hubiera presentado denuncia popular en los trminos previstos en la
Ley, por medio de la cual se acredite que la operacin de la empresa ha ocasionado daos a la
saludpblica.

CAPTULOII
DESARROLLODELPROCESOVOLUNTARIODEAUTOREGULACIN

ARTCULO 289.Las auditoras ambientales estatales sern voluntarias y se llevarn a cabo de
conformidad con las Bases del Programa de Autorregulacin que para tal efecto expedida la
Secretara.

LasBasesdelProgramadeAutorregulacindebernincluir,porlomenos,previsionesrelativasa
lossiguientesaspectos:

I. Planeacinydesarrollodelostrabajosdecampoydegabinetequecorrespondan;

II. Formulacindelosreportesderivadosdelasauditorasambientalesestatales;

III. Contenidodelprogramadeadministracinambiental;y

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 97

IV. Formulacin,instrumentacinyseguimientodelplandeaccinderivadodelasauditoras
ambientalesestatales,

ARTCULO290.Laspersonasinteresadasenquelasempresasdelascualessonresponsablesse
sometanalarealizacindeunaauditoraambientalestatal,debernmanifestarloporescritoala
Secretara,mediantelapresentacindelavisodeincorporacinalprogramadeautoregulacin,el
cualcontendrlasiguienteinformacin:

I. Nombredelauditadoy,ensucaso,delrepresentantelegal,objetosocial,girooactividad
preponderante,domiciliolegal,ascomocopiadelosregistrosFederaldeContribuyentes,
del Instituto del Fondo Nacional de la Vivienda para los Trabajadores y del Instituto
MexicanodelSeguroSocial;

II. Domiciliodelaolasinstalaciones,sitiosyrutasquesernauditados;

III. Nombre del auditor ambiental estatal coordinador y, en su caso, de los auditores
especialistaselegidospararealizarlaauditora,ascomolosdatosdesuregistro;

IV. Referencia a la documentacin ambiental que exista en el caso concreto, tal como
informesalaautoridad;laderivadadeinspeccionesprevias,verificacionesoauditoras,y
engeneralaquellaqueexpreseeltrabajoprevioenlamateria,silohubiere;

V. PlandeauditoraqueintegreloselementosqueseestablezcanlasBasesdelProgramade
Autorregulacin a que se refiere el artculo 289 de este Reglamento, el cual deber
contenerporlomenosunadescripcindelprocesorespectivo,calendariodeactividades,
programadetalladodeactividades,listasdeverificacinyprocedimientos,programasde
anlisis y pruebas, organigrama y currcula del personal de la empresa que apoyar los
trabajosdeauditoraambientalestatal;

VI. Manifestacin por escrito del auditor coordinador y de los auditores especializados, en
donde se haga constar su compromiso de mantener la confidencialidad respecto de la
informacin a que tengan acceso a travs de la auditora ambiental estatal, as como la
obligacindecumplirconlasdisposicioneslegalesyreglamentariasenlamateria;

VII. Manifestacin por escrito de que se aplicarn las recomendaciones resultantes de la
auditora ambiental estatal conforme al convenio de concertacin que al respecto se
suscriba;y

VIII. UnadonacinalFondoEstataldeProteccinalAmbiente,conunmontodeterminadapor
laDireccin,confundamentoenlodispuestoenlosartculos174y175delaLey.

ARTCULO291.Loscostosdelostrabajosdeauditora,ascomolosgeneradosparalaejecucin
delplandeaccincorrernporcuentadelresponsabledelainstitucindequesetrate.

98
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO292.LaSecretara,enuntrminodequincedashbilesapartirdelapresentacindel
aviso de incorporacin, deber informar a la empresa las observaciones u objeciones para el
desarrollodelaauditoray,ensucaso,quehaprocedidoaregistrarlacomoauditoraambiental
Estatalendesarrollo.

Si la auditora ambiental estatal no inicia en el plazo fijado en el aviso por causas imputables al
interesado,steperderlasprerrogativasaqueserefiereelpresenteReglamento.

ARTCULO293.LaSecretaraporsmismaoporconductodeunauditorambientalestatalpodr
supervisarencualquiermomentolaformaenqueseestrealizandounaauditoraambientalen
unainstalacinespecfica.

ARTCULO 294. Una vez concluida la realizacin de una auditora ambiental estatal, el auditor
estatal responsable proceder a elaborar el reporte respectivo, el cual deber contener, por lo
menos,lasiguienteinformacin:

I. Lasmedidaspreventivas,decontrolyparaevitarominimizarriesgosodaosambientales,
incluyendoelequipo,obrasyactividadesquedebernrealizarse;

II. Lasmedidascorrectivasyurgentes,justificandosurealizacin;

III. La definicin y programacin para la realizacin de estudios de evaluacin de daos al
ambiente;

IV. Lasaccionesdecapacitacinylasdeordenadministrativoqueprocedan;

V. Las opiniones tcnicas relativas al reuso o tratamiento de residuos y materiales que
generelaempresaauditada;y

VI. Una propuesta de plan de accin para la ejecucin de las medidas sealadas en las
fracciones anteriores, indicando plazos e inversiones para su realizacin, mismos que
debernserpriorizadosenrazndesusefectossobreelambiente.

ARTCULO295.LapropuestadeplandeaccinaqueserefierelafraccinVIdelartculoanterior,
incorporarlasmedidaspreventivasycorrectivasreferidasalassiguientesmateriasenelmbito
decompetenciadelEstado,segncorresponda:

I. Aire;

II. Agua;

III. Sueloysubsuelo;

IV. Residuosdemanejoespecial;
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 99


V. Ruido;

VI. Seguridadehigieneindustrial;

VII. Energa;

VIII. Instalacionescivilesyelctricas;

IX. Recursosnaturales;

X. Riesgoambiental;

XI. Administracinambiental,y

XII. Cualquier otra que se relacione con los efectos adversos al ambiente y los recursos
naturalesquegenerelainstalacinauditada.

ARTCULO 296. Dentro de los veinte das hbiles siguientes a la conclusin de los trabajos de
campo de la auditora ambiental estatal, la empresa auditada deber entregar a la Secretara el
reporte a que se hace referencia en el Artculo 294, as como el diagnstico bsico
correspondiente, que deber contener un resumen ejecutivo de los resultados obtenidos de la
auditoraambientalestatal,queincluirporlomenosunadescripcingeneraldelasituacindel
establecimientoencuantoasuoperacinyefectossobreelambienteylosrecursosnaturales,las
propuestas para el desarrollo de medidas preventivas y correctivas derivadas de la auditora
ambiental estatal, as como las inversiones y plazos estimados para su ejecucin y sus anexos
tcnicosyfotogrficos.

Unavezrecibidaladocumentacinaquesehacereferenciaenelprrafoanterior,laSecretara
proceder a la revisin de la misma a efecto de que se emitan las observaciones que considere
procedentes,lascualesseharndelconocimientodelaempresaauditada.

ARTCULO297.Encasodeexistircontroversiasentreelauditadoyelauditorambientalrespecto
del diagnstico bsico o cualquiera de las medidas, definiciones, programacin, acciones o
propuestasaqueserefiereelArtculo294deesteReglamento,elsujetoauditado,dentrodelos
diez das hbiles siguientes a la conclusin de los trabajos de campo de la auditora ambiental
estatal,podrproponeralaSecretara,parasuaprobacin,laaplicacindeotrasalternativasque
considere ms adecuadas. En todo caso la Secretara deber escuchar al auditor y emitir su
dictamendebidamentesustentado,dentrodeunplazodeveintedashbiles.

CAPTULOIII
PLANDEACCIN

100
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO298.LaSecretaraylaempresaauditadasuscribirnunconveniodeconcertacinenel
quesesealarnloscompromisosdeestaltimaparallevaracaboelplandeaccinderivadode
la auditora ambiental estatal que se realiz en sus instalaciones, en un plazo de cuarenta das
hbiles siguientes a la recepcin del reporte de auditora ambiental que le entregue la empresa
auditadaalaSecretara.

En caso de no formalizarse la suscripcin del convenio de concertacin dentro del plazo arriba
sealado por causas injustificadas imputables al interesado, ste perder los beneficios y
prerrogativasderivadasdeesteReglamento.

nicamenteenaquelloscasosenquesejustifiquedebidamenteelcasofortuitoolafuerzamayor
quemotivenlapeticincorrespondiente,laSecretarapodrotorgaralosinteresadosprrrogas
paraelcumplimientodelPlandeAccin.

Silaempresaauditadanorealizalasmedidaspreventivasycorrectivasresultantesdelaauditora
ambientalEstatal,unavezexpiradoelplazodeprrrogaotorgado,staperderlasprerrogativasa
queserefiereelpresenteReglamento.

ARTCULO299.LaSecretara,porsmismaoporconductodeunauditorambientalestatal,podr
realizarelseguimientodelosplanesdeaccin,ascomoverificarelcumplimientodetodasycada
una de las medidas preventivas y correctivas que en l se incluyan. El auditor que realice las
accionesaqueserefiereelpresenteartculodeberserdistintodeaquellosqueparticiparonen
lostrabajosdecampodelaauditoraambientalrespectiva.

CAPTULOIV
CERTIFICADODECUMPLIMIENTO

ARTCULO 300. Una vez realizadas las medidas preventivas y correctivas resultantes de la
auditoraambientalEstatal,elauditado,dentrodelosveintedashbilessiguientes,deberhacer
del conocimiento de la Secretara la terminacin de los trabajos respectivos, acompaando el
dictamen respectivo del auditor coordinador. La Secretara, por s o a travs de un auditor
ambientalEstatal,podrverificarelcumplimientodelplandeaccin,dentrodelplazodeveinte
dashbilescontadosapartirdelafechaenquerecibaelavisocorrespondiente.

EncasodequelaSecretaranonotifiqueporescritoalinteresadoalgunaobservacinrespectodel
cumplimientodelasmedidaspreventivasycorrectivasderivadasdelaauditoraambientalEstatal,
seentenderquenotieneobjecinalgunaparaotorgarelcertificadodecumplimiento.

Cuando en cualquiera de los supuestos antes sealados se acredite el cumplimiento del plan de
accin, la Secretara deber otorgar al interesado el certificado de cumplimiento dentro de los
treinta das hbiles siguientes a la fecha en que le fue presentado el aviso a que se refiere este
precepto.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 101

ARTCULO301.Atravsdelcertificadodecumplimiento,laSecretarareconocequealmomento
desuexpedicin,lainstalacinoperaenplenocumplimientodelalegislacinambientalvigente
Estatal,ybuenasprcticasdeoperacineingenieraqueresultenaplicables.

ARTCULO302.Elcertificadodecumplimientotendrvigenciadeunaoypodrserprorrogado
por el mismo periodo, a peticin del interesado siempre y cuando un auditor ambiental Estatal
acredite,enlostrminosestablecidosenesteReglamento,quelainstalacinoperaconformealos
alcancesprevistosenlosinstrumentosaqueserefiereelartculoanterior.

ARTCULO303.Cuandoelresponsabledelaoperacindeunaempresaquehubiererecibidoel
certificadodecumplimiento,pretendaquesteseaprorrogadoporlaSecretara,deberremitirle
por lo menos con 2 meses previos al trmino de la vigencia del certificado, la siguiente
informacin:

I. Fecha de inicio y trmino de los trabajos de diagnstico ambiental para obtener la
prrroga;

II. Nombredelauditorcoordinadorresponsable;

III. Elprogramacalendarizadodeactividades;

IV. Constancia de estar o no sujeto a un procedimiento administrativo instaurado por la
Secretara;enelprimercaso,laempresadeberacordarconlaautoridadordenadoralos
trminosparasuresolucindefinitivayanexarunacopiadeesteacuerdoaldiagnstico
ambientaldeprrroga;y

V. Cartasdeconfidencialidadyresponsabilidadfirmadasporelauditorestatalcoordinador

Paralosefectosaqueserefiereesteprecepto,todoslostrabajosyrequisitosnecesariosparaque
laSecretaraotorguelaprrrogacorrespondiente,debernserrealizadosporelinteresadoantes
dequeconcluyalavigenciadelcertificadodecumplimientorespectivo.

ARTCULO 304. La Secretara en el plazo de veinticinco das hbiles contados a partir de la
recepcindelainformacinaqueserefiereelartculoanterior,procederanotificaralaempresa
la aceptacin y registro de su solicitud, as como de los trabajos a realizar para obtener la
prrroga.

ElinteresadodeberinformaralaSecretaralafechadeiniciodelostrabajosrespectivos,porlo
menosconcincodashbilesdeanticipacinaello.

ARTCULO 305. Una vez terminados los trabajos para obtener la prrroga del certificado de
cumplimiento, la empresa auditada deber notificarlo a la Secretara remitiendo el informe del
diagnsticoambientalelaboradoyfirmadoporelauditorcoordinadorrespectivo.

102
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO306.LaSecretaraprocederenunplazodeveinticincodashbilescontadosapartir
de la fecha en que se reciba la informacin referida en el artculo anterior, a resolver sobre la
prrroga del certificado de cumplimiento. La Secretara podr notificar al interesado las
observaciones que considere necesarias respecto de la informacin recibida, a fin de que ste
lleveacabolasaccionesquecorrespondan.

En caso de que la Secretara no notifique al interesado, en el trmino indicado la resolucin
respectiva, se entender que dicha dependencia no tiene objecin alguna para prorrogar el
certificadodecumplimientocorrespondiente.

ARTCULO 307. Cuando la empresa interesada en obtener la prrroga del certificado de
cumplimiento, hubiera realizado modificaciones en sus procesos, actividades o instalaciones que
produzcanimplicacionesenelambiente,losrecursosnaturalesolasaludpblica,deberrealizar
una auditora ambiental Estatal a dichas reas, procesos o actividades, de conformidad con las
BasesdelProgramadeAutoregulacin.

Lo anterior, sin perjuicio de cumplir con los requisitos a que se refiere el Artculo 303 de este
ordenamiento.

ARTCULO308.Eldiagnsticoambientalnecesarioparaprorrogarelcertificadodecumplimiento
se realizar de conformidad con lo dispuesto en los lineamientos que para tal efecto expida la
Secretara.

ARTCULO 309. La Secretara podr negar la expedicin o la prrroga del certificado de
cumplimiento cuando el responsable de la operacin de la instalacin que corresponda haya
ocultado o intentado ocultar informacin a la secretara, a otras autoridades ambientales o al
auditor ambiental o se demuestre que se ha conducido con dolo o mala fe respecto del
funcionamientoambientaldesuempresa.

ARTCULO 310. Cuando se trate de instalaciones que fueron auditadas y se hubiere otorgado o
prorrogadoelcertificadodecumplimientoentrminosdeesteReglamento,elresponsabledesu
operacin deber dar aviso a la Secretara, por lo menos con cinco das hbiles previos a su
realizacin, cualquier modificacin de sus procesos, actividades o instalaciones que tengan
implicacionesenelambiente,losrecursosnaturalesolasaludpblica.

El interesado deber presentar a la Secretara, dentro de los diez das hbiles siguientes a la
realizacindeloscambiosomodificacionesantessealados,dictamenelaboradoporunauditor
ambiental Estatal, en donde se haga constar que la empresa opera en condiciones ambientales
igualesomejoresalasexistentesalmomentoenquefueotorgadooprorrogadoelcertificadode
cumplimiento.

ARTCULO 311. La empresa auditada que no mantenga la operacin de sus instalaciones en las
condiciones existentes al momento en que le fue otorgado o prorrogado el certificado de
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 103

cumplimiento, no tendr derecho a utilizarlo, en cuyo caso la Secretara proceder a cancelar el


certificadoyselerequeriralinteresadosudevolucin.

Paralosefectosaqueserefiereesteprecepto,laSecretaradeberemitirundictamentcnicoen
el que haga constar las causas que motivan su determinacin y notificarlo por escrito al
interesado, quien tendr un plazo de quince das hbiles para manifestar lo que a su derecho
convenga.

La Secretara resolver lo que corresponda en un plazo de veinticinco das hbiles contados a
partirdelarecepcindelescritorespectivo.EncasodequelaSecretaranoemitalaresolucinse
entenderqueestdeacuerdoconlasapreciacionesdelparticular.

CAPTULOV
REGISTROYAUTORIZACIONDEPRESTADORESDESERVICIODEAUTOREGULACIN

ARTCULO 312. Las personas fsicas interesadas en obtener la acreditacin como auditor
ambientaldeberncumplir,entreotrosrequisitos,conlossiguientes:

I. Contar con ttulo profesional otorgado por una institucin reconocida o, en su caso, con
cdulaprofesional;

II. Demostrar,segncorresponda,experienciaprofesionalmnimadecincoaosparaauditor
coordinadorydedosaosparalasdemsreasaqueserefiereesteReglamento,enlos
aspectosquecomprendeunaauditoraambiental;y

III. Comprobarhaberparticipadoenlarealizacindeporlomenostresauditorasregistradas
antelasautoridadesambientalescompetentes,obiendemostrarfehacientementehaber
realizado actividades equivalentes a las que comprenden las auditoras ambientales,
conformealasBasesdelProgramadeAutorregulacinaqueserefiereelartculo289de
esteReglamento.

ARTCULO313.Sonobligacionesdelosauditoresambientales,entreotras,lassiguientes:

I. Evaluar y determinar el cumplimiento de la normatividad ambiental Estatal y de buenas
prcticas de operacin e ingeniera aplicables a las operaciones industriales en materia
ambiental;

II. Apegarse a las reglas, procedimientos y mtodos que se establezcan en las Normas
OficialesMexicanas,lasNormasMexicanas,lasNormasTcnicasEcolgicasy,ensucaso,
lasextranjeraseinternacionalesenmateriaambiental;

III. Abstenerse de participar en el desarrollo de auditoras ambientales estatales o en los
dems actos a que se refiere este Reglamento, cuando exista conflicto de intereses
personales,comercialesoprofesionales;
104
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016


IV. PermitirlasupervisinoverificacindesusactividadesporpartedelaSecretara;

V. Abstenersededivulgarlainformacinaquetenganaccesoenlosprocedimientosaquese
refiereesteReglamento;

VI. Informar inmediatamente a la Secretara y a la empresa auditada, cuando durante la
realizacin de sus actividades detecte en algn sitio o instalacin que existe riesgo
inminente de desequilibrio ecolgico o de dao o deterioro graves a los recursos
naturales,casosdecontaminacinconrepercusionespeligrosasparalosecosistemas,sus
componentesoparalasaludpblica;

VII. Realizar las auditoras ambientales estatales conforme a lo establecido en el presente
Reglamento;y

VIII. Las dems que se deriven de la realizacin de auditoras ambientales en los trminos
previstosenesteReglamento.

ARTCULO314.Lasmodalidadesquepodrnasumirlosprofesionalesqueactencomoauditores
ambientalesestatalessern:

I. Auditorestatalcoordinador;

II. Auditorestatalenmateriadecontaminacindelagua;

III. Auditorestatalenmateriadecontaminacindelaireyruido;

IV. Auditorestatalenmateriadecontaminacindelsueloysubsuelo;

V. Auditorestatalenresiduosdemanejoespecialy/oderesiduosslidosurbanos;

VI. Auditorestatalenriesgoyrespuestaaemergenciasambientales;

VII. Auditorestatalenrecursosnaturales;

VIII. Auditorestatalenlegislacinambiental;y

IX. LasdemsquedeterminelaSecretara.

ARTCULO 315. La Secretara, deber promover un programa permanente de capacitacin y
actualizacinparaauditoresambientalesestatalesyquienespretendanserlo.

TTULOIX

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 105

CAPTULOI
MEDIDASDESEGURIDAD

ARTCULO 316. En los casos de flagrancia que contravengan las disposiciones ambientales
aplicables, siempre y cuando medie una situacin de emergencia o urgencia, el personal de
inspeccinyvigilanciadelaAutoridadAmbientalseidentificarcondocumentooficialyproceder
adictarlasmedidasdeseguridadnecesariasyasentardichascircunstanciasenunactaespecfica.

ARTCULO317.Paralaaplicacindemedidasdeseguridad,laAutoridadAmbientalatenderlas
estipulacionesdelArtculo211delaLey,ytambinlosiguiente:

I. La retencin de sustancias o materiales contaminantes, importa que tambin sean
asegurados: los bienes, vehculos, utensilios e instrumentos directamente relacionados
conlaconductaquedelugaralaimposicindedichamedidadeseguridad;y

II. Laclausuratemporal,parcialototaldefuentescontaminantesimplicatambinladelas
instalacionesenlasquesedesarrollenlasactividadesquedenlugaralossupuestosaque
serefiereelArtculo211delaLey.

AsmismolaAutoridadAmbientalpodraplicarcomomedidadeseguridadlaneutralizacindelas
sustanciasysusefectosorealizarcualquieraccindenaturalezasimilar,sobreaquellosresiduos
reguladosporlaLeyparalaPrevencinyGestinIntegraldelosResiduosdelEstadodeChihuahua
siemprequeenalgunadelasetapasdelmanejointegralqueselesd,existariesgodecausarun
desequilibrioecolgico.

ARTCULO 318. Cuando la Autoridad Ambiental ordene alguna de las medidas de seguridad
previstasenesteReglamento,indicaralinteresadocuandoproceda,lasaccionesquedebellevar
acaboparasubsanarlasirregularidadesquemotivaronlaimposicindedichasmedidas,ascomo
losplazosparasurealizacin,afindequeunavezcumplidas,seordeneelretirodelasmedidasde
seguridadquehubierensidoimpuestas.

ARTCULO 319. En caso de que como medida de seguridad se ordene la clausura del
establecimientoenlostrminosdelafraccinIIdelArtculo317deesteReglamento,laAutoridad
Ambientalmedianteordenexpresadesignarelpersonalquedebadesahogarladiligencia,misma
quedeberllevarseacaboenunplazonomayoralasveinticuatrohorassiguientes;unavezque
taldesignacinseadesuconocimientoseguirelprocedimientodeinspeccinestablecido.

Enesecaso,dentrodelostresdashbilesposterioresalaconclusindeladiligencia,elinfractor
podrsolicitaralaAutoridadAmbientallareaperturadelasinstalacionesclausuradasatravsde
unacartacompromisoenlaqueestablezcaadetalleelcompromisodecumplirlasaccionesquese
hayan indicado para subsanar las irregularidades que motivaron la clausura como medida de
seguridad.

106
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

LaAutoridadAmbientalvalorarlacartacompromisopresentadaydeberemitirsuresolucinen
plazo mximo de tres das hbiles posteriores a la recepcin de la peticin. En caso de resolver
favorablemente la peticin del infractor, la Autoridad Ambiental podr requerir el otorgamiento
de una garanta a su favor, por el monto que sea pertinente segn el caso especfico; dicha
garanta podr ser otorgada en alguno de los modos que para garantizar los crditos fiscales
estableceelCdigoFiscaldelEstado.

Unavezacreditadoelotorgamientodelagaranta,laAutoridadAmbientalordenarlacancelacin
de los sellos de clausura, realizando dentro de las veinticuatro horas siguientes la diligencia
correspondiente, levantando el acta y entregando una copia de la misma al responsable de la
fuente.

Siempre que las irregularidades que motivaron la imposicin de la clausura como medida de
seguridad,seansubsanadasenelplazoordenadoporlaAutoridad,estaautorizarladevolucin
delagarantaotorgada;encasocontrariodichagarantaseharefectivaafavordelerarioestatal
sinperjuiciodelassancionesalasquehayalugar.

CAPTULOII
SANCIONESADMINISTRATIVAS

ARTCULO 320. Por las violaciones a la normatividad ambiental, adems de las sanciones
establecidasenelArtculo212delaLey,laAutoridadAmbientalpodrimponerlassiguientes:

I. Eldecomisodelosproductosoimplementosutilizadosenlacomisindelasinfracciones;
y

II. Lasuspensinorevocacindelasconcesiones,licencias,permisosoautorizacionesqueen
ejerciciodesusfacultadeshubiereotorgado.

Siempre que sea posible, se deber obligar al infractor a restaurar el ambiente afectado con la
infraccincometida,alestadoqueguardabaantesdequesecometieradichainfraccin.

LastreintayseishorasdearrestoadministrativoaqueserefierelafraccinIIIdelcitadoArtculo
212delaLey,soninconmutables.

ARTCULO321.Sidelactaquecorrespondaalavisitadeverificacin,sedesprendequenoseha
dadocumplimientoalasmedidascorrectivasordenadasporlaAutoridadAmbiental,seproceder
porpartedeladelaSecretarasiguientemanera:

a) Impondr una multa cuyo monto ser equivalente a la misma cantidad de salarios
mnimos que hubiese impuesto por la infraccin o infracciones que motivaron las
medidascorrectivasordenadaseincumplidas;e

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 107

b) Impondr multas adicionales por cada uno de los das que transcurran hasta que la
medida correctiva se tenga por cumplida, teniendo como limite la multa mxima
indicada en la fraccin I del Articulo 212 de la Ley. En el cmputo de los das de
incumplimientoseconsiderarntodoslosdastranscurridosapartirdeldasiguientea
aquel en que concluya el plazo otorgado para el cumplimiento de las medidas
correctivas.

ARTCULO322.Enlaproteccinalosnofumadores,lospropietarios,responsablesoencargados
deloslugares,establecimientosyvehculosenlosqueseprohibefumar,estnobligadosallamar
alapolicapreventivaparaquesepongaalinfractoradisposicindelaAutoridadcompetentey
previaacreditacindelainfraccin.

ARTCULO 323. La Autoridad Ambiental dar a los bienes decomisados alguno de los siguientes
destinos:

I. Venta directa en aquellos casos en que el valor de lo decomisado no exceda de 5 mil
unidadesdesalario;

II. Remateensubastapblicacuandoelvalordelodecomisadoexcedaellmitesealadoen
lafraccinanterior;y

III. Donacin a organismos pblicos e instituciones cientficas o de enseanza superior o de
beneficencia pblica, segn la naturaleza del bien decomisado y de acuerdo a las
funcionesyactividadesquerealiceeldonatario,siempreycuandonoseanlucrativas.

ARTCULO324.ParaefectosdeloprevistoenlasfraccionesIyIIdelartculoanterior,nicamente
sern procedentes dichos supuestos cuando los bienes decomisados sean susceptibles de
apropiacinconformealasdisposicionesjurdicasaplicables.

Enladeterminacindelvalordelosbienessujetosaremateoventa,laAutoridadAmbiental,en
coordinacinconlaSecretaradeHaciendaEstatal,considerarelprecioquerespectodedichos
bienescorraenelmercado,almomentoderealizarselaoperacin.

En ningn caso los responsables de la infraccin que hubiera dado lugar al decomiso, ni sus
parientes consanguneos hasta el cuarto grado, civiles o por afinidad, podrn participar ni
beneficiarsedelosactossealadosenelartculoanterior,medianteloscualesselleveacabola
enajenacindelosbienesdecomisados.

ARTCULO325.Lasautoridadesambientales,promovernantequiencorrespondauordenarn,
ensucaso,conbaseenlosestudiosquerealicenparaeseefecto,lalimitacinosuspensindelas
obras, instalaciones o funcionamiento de industrias, comercios, servicios, desarrollos urbanos o
cualquier actividad que afecte o pueda afectar el ambiente o cause desequilibrio ecolgico o
prdidadelabiodiversidad.

1
108
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

ARTCULO326.Lasmultasalasquesehaganacreedoreslosinfractoresdelasdisposicionesdela
Ley, de este Reglamento, o dems disposiciones aplicables, por ningn motivo podrn ser
condonadasoreducidas.

TodamultaimpuestaporlaSecretaradebesersatisfechaenunperiodonomayoraquincedas
hbilesposterioresalanotificacindelaResolucinquelaordene.

Sitranscurridoeseperiodo,laSecretaranotieneevidenciasqueacreditenelpagodelamisma,
turnar lo necesario a la Secretara de Hacienda Estatal para que sea esa Autoridad quien en
ejerciciodesusfacultadesrealicelosactosnecesariosparaobtenerelpagodeloscrditosfiscales,
siendoestosrecursosutilizadosnicamenteparaelfortalecimientodeacciones,infraestructuray
programasencaminadasalaProteccindelMedioAmbienteenelEstadodeChihuahua.

ARTCULO327.ParalosefectosdelltimoprrafodelArtculo215delaLey,elinfractordeber
presentarlasolicituddeconmutacindelamultaenunperiodonomayoraquincedashbiles
posteriores a la notificacin de la Resolucin que la ordene, para lo cual deber someter a
consideracindelaAutoridadordenadoraunproyectodetalladodelasinversionesquepretende
realizarensuestablecimientoconelfindequesedetermineloconducente.

Conjuntamente con su solicitud de conmutacin, el infractor deber garantizar el monto de la
multaenalgunadelasformasestablecidasenelCdigoFiscaldelEstado.

Lasolicituddeconmutacindelamultaylaresolucinquerecaigaalrespecto,esindependiente
delasmedidascorrectivasodeseguridadquehayansidoordenadas,lascualesdeberncumplirse
en el tiempo y la forma indicados en la Resolucin correspondiente, salvo que la Autoridad
determinelocontrario.

CAPTULOIII
RECURSODEINCONFORMIDAD

ARTCULO 328. Los acuerdos, medidas de seguridad y resoluciones administrativas que pongan
fin a los procedimientos que se dicten con motivo de la aplicacin de la Ley, sus reglamentos y
disposicionesquedeellosemanen,podrnserrecurridosporlosinteresadosmedianteelrecurso
de inconformidad, ante la autoridad que emiti la resolucin impugnada, quien en su caso,
acordarlaadmisin,yelotorgamientoodenegacindelasuspensindelactorecurridoyledar
tramiteconformealoestablecidoenelArticulo220delaLey.

ARTCULO329.TratndosedeobrasoactividadesquecontravenganlasdisposicionesdelaLey,
los programas de ordenamiento ecolgico y territorial, las declaratorias de reas de valor
ambientalyreasnaturalesprotegidasolosreglamentos,NormasTcnicasEcolgicasEstatalesy
Normas Oficiales Mexicanas aplicables, las personas fsicas y morales de las comunidades
afectadasestarnlegitimadasparainterponerelrecursoaqueserefiereesteCaptulo,ascomoa
exigir que se lleven a cabo las acciones necesarias para que sean observadas las disposiciones
jurdicasaplicables,siemprequedemuestrenenelprocedimientoquedichasobrasoactividades
Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 109

originanopuedenoriginarundaoalosrecursosnaturales,lafloraolafaunasilvestre,lasalud
pblicaolacalidaddevida.

ARTCULO 330.Adems de lo indicado en el Artculo 221 de la Ley, el escrito en el que se
interpongaelrecursoinconformidaddeberindicarse:

I. El domicilio para recibir notificaciones, as como el nombre de los autorizados para
recibirlas.

II. Lafechaenlaqueselenotificelactoqueseimpugna,olafechaenlaquebajoprotesta
dedecirverdad,tuvoconocimientodelmismo.

III. Tratndosedeactosquepornohaberseresueltoentiemposeentiendannegados,deber
acompaarseelescritodeiniciacindelprocedimiento.

ARTCULO331.Lainterposicindelrecursosuspenderlaejecucindelactoimpugnado,siempre
ycuandosecumplanlasdisposicionesdelArtculo223delaLeyyadems:

I. Seaprocedenteelrecurso;

II. No se ocasionen daos o perjuicios a terceros, a menos que se garanticen stos para el
caso de no obtener resolucin favorable con alguna de las modalidades previstas en la
Ley;y

III. Tratndose del decomiso, se cumplan los requisitos del artculo 332 y no se est en los
supuestosdelartculo333,ambosdeesteReglamento.

Laautoridaddeberacordar,ensucaso,lasuspensinolanegacindelasuspensindentrode
los 5 das hbiles siguientes a su interposicin, en cuyo defecto se entender otorgada la
suspensin.

ARTCULO332.Cuandoconlainterposicindelrecurso,elpromoventesolicitelasuspensindel
decomiso, la autoridad podr ordenar la devolucin de los bienes respectivos al interesado,
siempreycuando:

I. Seaprocedenteelrecurso;y

II. Seexhibagarantaporelmontodelvalordelodecomisado,elcualserdeterminadopor
la Secretaria de Hacienda del Estado en conjunto con la dependencia ambiental
competente,deacuerdoconelprecioquecorraenelmercadoalmomentoenquedeba
otorgarsedichagaranta.

ARTCULO333.Elrecursosetendrpornointerpuestoysedesecharcuando:

110
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016

I. Sepresentefueradelplazoestablecido;

II. Nosehayaacompaadoladocumentacinqueacreditelapersonalidaddelrecurrente;y

III. Noaparezcasuscritoporquiendebahacerlo,amenosquesefirmeantesdelvencimiento
delplazoparainterponerlo.

ARTCULO334.Laresolucindelrecursosefundarenderechoyexaminartodosycadaunode
los agravios hechos valer por el recurrente teniendo la autoridad la facultad de invocar hechos
notorios; pero cuando uno de los agravios sea suficiente para desvirtuar la validez del acto
impugnado,bastarconelexamendedichopunto.

Laautoridad,enbeneficiodelrecurrente,podrcorregirloserroresqueadviertaenlacitadelos
preceptosqueseconsiderenvioladosyexaminarensuconjuntolosagravios,ascomolosdems
razonamientos del recurrente, a fin de resolver la cuestin efectivamente planteada, pero sin
cambiarloshechosexpuestosenelrecurso.

Igualmente, deber dejar sin efectos legales los actos administrativos cuando advierta una
ilegalidad manifiesta y los agravios sean insuficientes, pero deber fundar cuidadosamente los
motivosporlosqueconsiderilegalelactoyprecisarelalcanceenlaresolucin.

Si la resolucin ordena realizar un determinado acto o iniciar la reposicin del procedimiento,
debercumplirseenunplazonomayordetresmeses.

ARTCULO 335. No se podrn revocar o modificar los actos administrativos en la parte no
impugnadaporelrecurrente.

Laresolucinexpresarconclaridadlosactosquesemodifiquenorevoquensilamodificacines
parcial,seprecisarsta.

ARTCULO336.Laautoridadpodrdejarsinefectosunrequerimientoounasancin,deoficiooa
peticindeparteinteresada,cuandosetratedeunerrormanifiestooelparticulardemuestreque
yahabadadocumplimientoconanterioridad.

Latramitacindeladeclaracinnoconstituirrecurso,nisuspenderelplazoparalainterposicin
desteytampocosuspenderlaejecucindelacto.

ARTCULO337.Cuandohayandetenerseencuentanuevoshechosodocumentosquenoobren
enelexpedienteoriginalderivadodelactoimpugnado,sehardeconocimientoalosinteresados
para que, en un plazo no inferior a 5 das hbiles ni superior a 10, formulen sus alegatos y
presentenlosdocumentosqueestimenprocedentes.

Sbado
______________________________________________________________________________________________________
01 de octubre de 2016 ANEXO AL PERIDICO OFICIAL 111
112
______________________________________________________________________________________________________
ANEXO AL PERDICO OFICIAL Sbado 01 de octubre de 2016