Vous êtes sur la page 1sur 140

ISSN 1810-1127

FAO PRODUCTION ET SANT ANIMALES

NBOVBM

PRODUCTION EN
AVICULTURE FAMILIALE
un manuel technique
1
FAO PRODUCTION ET SANT ANIMALES
manuel

PRODUCTION EN
AVICULTURE FAMILIALE
un manuel technique

E.B. Sonaiya
Dept. des Sciences Animales,
Universit de Obafemi Awolowo, Ile-Ife Nigeria
et
S.E. J. Sw an
Consultant en aviculture familiale
Nouvelle Zelande

ORGANISATION DES NATIONS UNIES POUR L'ALIMENTATION ET L'AGRICULTURE


Rome, 2004
Les appellations employes dans cette publication et la prsentation des
donnes qui y figurent nimpliquent de la part de lOrganisation des
Nations Unies pour lalimentation et lagriculture aucune prise de position
quant au statut juridique ou au stade de dveloppement des pays,
territoires, villes ou zones ou de leurs autorits, ni quant au trac de leurs
frontires ou limites.

ISBN 92-5-205082-5

Tous droits rservs. Les informations ci-aprs peuvent tre reproduites ou


diffuses des fins ducatives et non commerciales sans autorisation
pralable du dtenteur des droits dauteur condition que la source des
informations soit clairement indique. Ces informations ne peuvent toutefois
pas tre reproduites pour la revente ou dautres fins commerciales sans
lautorisation crite du dtenteur des droits dauteur. Les demandes
dautorisation devront tre adresses au Chef du Service de la gestion des
publications, Division de linformation, FAO, Viale delle Terme di Caracalla,
00100 Rome, Italie ou, par courrier lectronique, copyright@fao.org

FAO 2004
TABLE DES MATIRES

Chapitre 1 1
INTRODUCTION1

Chapitre 2 8
ESPCES ET RACES8

Chapitre 3 16
RESSOURCES ALIMENTAIRES

Chapitre 4 29
CONDUITE GNRALE DE LLEVAGE

Chapitre 5 48
INCUBATION ET CLOSION

Chapitre 6 54
SANT

Chapitre 7 76
AMLIORATION DES RACES

Chapitre 8 82
CONOMIE DE LA PRODUCTION

Chapitre 9 87
COMMERCIALISATION

Chapitre 10 106
RECHERCHE ET DVELOPPEMENT

BIBLIOGRAPHIE 126
Chapitre 1
INTRODUCTION

IMPORTANCE SOCIOCONOMIQUE DE LAVICULTURE FAMILIALE

Laviculture familiale se dfinit comme la production de volaille petite chelle


pratique par des mnages utilisant la main-duvre familiale et, autant que faire se
peut, les disponibilits alimentaires localement disponibles. Les volailles peuvent
divaguer librement dans lexploitation et rechercher une grande partie de leur propre
nourriture, le supplment tant fourni par lexploitant. Les participants latelier tenu en
1989 Ile-Ife, Nigria, ont dfini comme volaille rurale un troupeau de moins de 100
oiseaux de race amliore ou non, lev dans des systmes fermiers de type extensif ou
intensif. Le travail nest pas rmunr, et est effectu par les membres de la famille
(Sonaiya, 1990 b). Cette dfinition a t ultrieurement clarifie comme de petits
troupeaux, exploits par des familles rurales individuelles aux fins de scurit
alimentaire, de revenu, et demploi rmunrateur pour les femmes et les enfants
(Branckaert, cit par Sonaiya 1990c). Laviculture familiale est donc distincte de
laviculture commerciale de moyenne grande chelle.

Laviculture familiale est rarement le seul moyen dexistence du mnage, mais


reprsente lune des nombreuses activits intgres et complmentaires du systme
fermier qui contribuent son bien-tre gnral.

Les volailles reprsentent une activit primordiale pour lobtention dun revenu
travers la vente dufs et doiseaux. La consommation occasionnelle de ces produits
intervient comme source prcieuse de protines dans la ration alimentaire. La volaille
joue galement un rle socioculturel important au sein de nombreuses socits. La
production avicole utilise le travail familial: les femmes qui, souvent, combinent
proprit et gestion du troupeau familial, en sont les bnficiaires principales. Les
femmes jouent galement un rle important dans le dveloppement de laviculture
familiale en tant que vulgarisatrices et vaccinatrices.

Pour les petits fermiers des pays en dveloppement (spcialement dans les pays
faible revenu et dficitaires en produits vivriers (PFRDPV), laviculture familiale
reprsente une des rares opportunits dpargne, dinvestissement et de protection
contre le risque. Dans certains de ces pays, laviculture familiale reprsente
approximativement 90 pour cent de la production avicole totale (Branckaert 1999). Au
Bangladesh, par exemple, laviculture familiale reprsente plus de 80 pour cent de la
production nationale et 90 pour cent des 18 millions de mnages ruraux lvent des
volailles. Les familles sans terre qui reprsentent 20 pour cent de la population (Fattah,
1999, citant le Bureau des Statistiques du Bangladesh, 1998) possdent 5 7 poulets par
mnage.

Dans les PFRDPV, les ufs et la viande de volaille produits lchelle familiale
contribuent selon les estimations de 20 30 pour cent de lapport total en protines
animales. (Alam, 1997 et Branckaert, 1999), venant en seconde place aprs les produits
laitiers (38 pour cent),qui, eux, sont majoritairement imports.
2 Introduction

De mme, au Nigria, laviculture familiale reprsente approximativement 94 pour


cent de llevage avicole total, et compte pour 4 pour cent environ de la valeur totale
estime des ressources animales du pays. Elle reprsente 83 pour cent de lensemble des
volailles nationales estim 82 millions de sujets. En Ethiopie, la volaille rurale
concourt 99 pour cent de la production nationale totale de viande de poulet et dufs
(Tadelle, et al. 2000).

La volaille est le plus faible investissement la porte d un mnage rural. Mme en


ce cas, le fermier confront la pauvret, a besoin de crdit pour obtenir le premier
investissement qui lui permettra de slever de sa modeste condition. Au Bangladesh,
les femmes reprsentent 20 30 pour cent de tous les chefs de mnage (Saleque, 1999);
elles sont le plus souvent dsavantages en termes doptions pour la gnration de
revenu. En Afrique sub-saharienne, 85 pour cent des mnages lvent des volailles, dont
la proprit dpend des femmes 70 pour cent (Gueye, 1998 et Branckaert, 1999, citant
World Poultry 14 [10] ).

Gnrer un revenu est le premier objectif dun levage avicole familial. Les ufs
peuvent procurer un revenu rgulier, quoique modeste. Alors que la vente doiseaux
vivants procure une source de liquidits plus flexible adapte aux besoins. En
Rpublique Dominicaine, par exemple, laviculture familiale contribue pour 23% du
revenu de la production animale (Rauen et al. 1990).

Limportance de la volaille pour les mnages ruraux est illustre dans lexemple ci-
dessous provenant de Tanzanie (tableau 1.1). En supposant quune poule locale ponde
30 ufs par an, dont 50 pour cent sont consomms et les autres closent 80 pour cent,
chaque femelle produira 12 poussins annuellement. Avec un taux de survie de 50 pour
cent et un sex-ratio de 50/50, la production totale dune poule au bout de 5 ans sera de
120 kg de viande et de 195 (6,8kg) ufs.

Tableau 1.1 Production projete dune poule en Tanzanie


_______________________________________________________________________
Temps Nombre Nombre Nombre Nombre Nombre Nombre
(mois) ufs clos coquelets poulettes coqs poules rforms
_______________________________________________________________________
0 - - 1 - - -
8 - - - - 1 -
20 15 3 3 - - 1
28 - - - 3 3 -
40 45 9 9 - - 6
48 - - - 9 9 -
60 135 27 27 - - 18
Total 195 39 40 12 13 25
_______________________________________________________________________
Source: Kabatange et Katule, 1989
Aviculture Familiale 3

Dans une tude sur la gnration de revenu dans les systmes fermiers migrateurs de
lEst Kalimantan, Indonsie (voir tableau 1.2.), il est apparu que laviculture familiale
gnrait 53 pour cent du revenu total, utiliss pour la nourriture, les frais scolaires et les
dpenses imprvues, telles que les mdicaments (Ramm et al. 1984).

Tableau 1.2 Budget annuel dune ferme familiale possdant 0,4 ha de paddy irrigu,
0,1 ha de potager, 100 canards et 2 buffles en Indonsie
_______________________________________________________________________
Unit Roupies
_______________________________________________________________________
Dpenses annuelles
Cultures 1 198 000
Animaux
- Buffles
- Canards 1 147 200
___________________________________
Sous total 2 345 200
Revenu annuel
Cultures
- Mas 240 kg 96 000
- Riz 4 000 kg 2 000 000
- Manioc 600 kg 60 000
- Arachide 60 kg 60 000
- Soja 60 kg 30 000
- Potager mixte 150 000
_________________________________________
Sous - total cultures 2 396 000
Animaux
- Buffles - viande 150 kg 300 000
- travail 30 jours 180 000
Sous - total buffles 480 000
- Canards - ufs 13 140 ufs 5 256 000
_________________________________________
Sous - total animaux 5 736 000
Recettes nettes annuelles des cultures en travail familial 1 198 000
(20,7 %)
Recettes nettes annuelles du btail en travail familial
- Buffles 480 000
(8,3%)
- Canards 4 108 800
(71,0 %)
_____________________________
Recettes totales annuelles de lagriculture en travail
familial 5 786 800
(100 %)
_______________________________________________________________________
4 Introduction

Source: Setioko, 1997

La composition du troupeau est fortement oriente vers les gallinacs en Afrique et en


Asie du Sud, vers les canards en Asie de lEst et en Amrique latine. La taille du
troupeau varie de 5 100 sujets en Afrique, 20 30 en Amrique latine et de 5 20 en
Asie. Elle est lie aux objectifs de laviculture fermire, savoir :
x consommation personnelle
x consommation personnelle et raisons culturelles
x consommation personnelle et revenu
x revenu seulement
x
Tableau 1.3 Taille du troupeau et objectifs de laviculture fermire au Nigria
_______________________________________________________________________
Objectifs Taille du troupeau % chantillon
_______________________________________________________________________
Consommation personnelle 1 10 30
Consommation personnelle et raisons culturelles 1 10
Consommation personnelle et revenu 11 30 44

Revenu seulement > 50 10,5


_______________________________________________________________________
Source : Sonaiya, 1990a.

Au Bangladesh (Jensen,1999), la production moyenne de 50 ufs/poule/an tait


considre comme faible par certains. Cependant, en considrant que 50 ufs/poule/an
reprsentent quatre closions successives provenant de quatre couves dufs pondus,
incubs et amens closion par poule, le revenu sera de 30 poulets annuellement (si
aucun uf nest vendu ni consomm, avec un taux dclosion de 80 pour cent et de
mortalit de 25 pour cent). Cela reprsente un taux de productivit remarquablement
lev.

SYSTEMES DE PRODUCTION

Laviculture familiale se pratique suivant un large ventail de conditions, qui peuvent


tre classes au sein de quatre systmes principaux de production (Bessei,1987) :
x extensif en libert
x extensif en basse cour
x semi intensif
x intensif

Les indicateurs de production pour les diffrents systmes sont rsums au tableau 1.4.

Systmes extensifs en libert (Systmes divagants)


En Afrique, Asie et Amrique latine, 80 pour cent des fermiers lvent leurs volailles en
systmes extensifs. En conditions de libert, les oiseaux ne sont pas confins et peuvent
divaguer la recherche de leur nourriture sur de larges tendues. Des abris lmentaires
Aviculture Familiale 5

peuvent tre installs, et utiliss ou non. Le troupeau renferme des oiseaux despces et
dges varis.

Systmes extensifs en basse cour


Les volailles sont loges pendant la nuit et libres de picorer pendant la journe. Matin et
soir, un supplment en grains leur est distribu.

Systmes semi-intensifs
Il sagit de combinaisons entre systmes extensifs et intensifs dans lesquelles les
oiseaux sont confins dans un espace dtermin avec accs un abri. On les rencontre
communment en milieu urbain et priurbain, mais aussi en milieu rural. Dans le
systme en parc, les oiseaux sont gards dans un espace cltur pendant la journe et
logs dans la maison pendant la nuit. Nourriture et eau sont distribus lintrieur pour
viter gaspillage et pollution par la pluie, le vent et les animaux sauvages.

En Europe, il existe deux autres types de logement: larche est une construction
lgre, monte sur rails ou patins afin de la dplacer aisment de parc en parc. La
volaille y est enferme la nuit pour la protger des prdateurs. Une arche standard de 2 x
2,5m. peut abriter environ 40 oiseaux.

Le second type est le poulailler colonie permettant une densit de 3 4 oiseaux


adultes par m2, la fois lintrieur et lextrieur du btiment. Celui-ci, de petites
dimensions, peut aisment tre transport par une personne.
Aucun de ces deux systmes nest commun dans les pays en dveloppement.

Systmes intensifs
Ces systmes sont pratiqus par des entreprises moyennes grandes, mais sont
galement utiliss au niveau familial. Les oiseaux vivent en complte claustration en
btiment ou en cages. La mise de fonds est plus leve et les oiseaux dpendent
entirement de lleveur pour la couverture de leurs besoins; la production est cependant
plus leve. Il existe trois types de systmes :
x Systme litire profonde : les oiseaux vivent en claustration complte ( une
densit de 3-4 animaux par m2) mais peuvent se dplacer librement. Le plancher
est couvert dune litire paisse (5 10 cm) compose de spathes de mas, de
balles de riz, de paille, de copeaux de bois ou dun matriau similaire absorbant
mais non toxique. Ce systme compltement confin protge les oiseaux des
voleurs et des prdateurs et convient llevage de souches commerciales
spcialement slectionnes pour la production dufs ou de viande (pondeuses,
reproducteurs, poulets de chair).
x Systme sur caillebotis ou claie de fer ou de bois : permettant daugmenter la
densit cinq oiseaux/m2 de plancher. Les oiseaux ont un contact rduit avec les
matires fcales et peuvent circuler modrment.
x Systme en batteries : ce sont des cages gnralement utilises pour les poules
pondeuses qui y demeurent pendant toute leur vie productive. Linvestissement de
dpart est lev pour ce systme habituellement rserv aux grandes units
commerciales de ponte.
6 Introduction

Les systmes intensifs destins llevage de volailles indignes sont peu communs. La
seule exception notable est signale en Malaisie, due la forte demande pour des
poulets autochtones dans les zones urbaines (Supramaniam, 1998). Il ne reprsente que
0,002 pour cent (2 pour 100 000) de la production de volaille autochtone.

Tableau 1.4 Paramtres de production et de reproduction par poule et par an selon


diffrents systmes.
_______________________________________________________________________
Systme de production Nombre Nombre
Nombre ufs
ufs Poule/an poussins/an
pour vente et
consommation
_______________________________________________________________________
Libert 20 - 30 2- 3 0
Libert amliore 1/ 40 - 60 4- 8 10 - 20
Semi intensif 100 10 - 12 30 - 50
Intensif (litire profonde) 160 - 180 25 - 30 50 - 60
Intensif (cage) 180 - 220 - 180 - 220
_______________________________________________________________________
1/ Logement et vaccination Newcastle.
Source: Bessei, 1997.

Les systmes ci-dessus se chevauchent frquemment. Le systme en libert est


quelquefois accompagn de supplmentation alimentaire ; la basse-cour par un
logement de nuit mais sans supplmentation, et les cages peuvent tre utilises pour de
petites oprations dans des espaces rduits. (Branckaert et Gueye,1999).

CONCLUSIONS

Pendant la dernire dcennie, la consommation de produits avicoles a augment de 5,8


pour cent par an dans les pays en dveloppement, taux suprieur la croissance
dmographique; elle a ainsi cr une forte demande. Laviculture familiale possde le
potentiel de satisfaire celle-ci, du moins en partie, en augmentant sa productivit, et en
rduisant pertes et gaspillage, mme si elle reprsente toujours un systme faibles
intrants. Afin de demeurer durable, elle doit continuer donner priorit au travail
familial, utiliser des races adaptes, amliorer la situation sanitaire et lemploi des
ressources alimentaires localement disponibles. Cela nexclut pas lintroduction de
nouvelles technologies appropries qui nont nul besoin dtre sophistiques. Toutefois,
des technologies prconisant laugmentation substantielle de certains intrants coteux,
comme limportation daliments concentrs et de matriel gntique, devront tre vits.
Cela ne signifie pas quelles nauront pas leur place dans le secteur commercial grande
chelle, o leur utilisation est largement dtermine par des considrations
conomiques.

Par le pass, les initiatives proposes pour le dveloppement ont mis laccent sur
lamlioration gntique travers lintroduction systmatique de gnes exotiques, en
arguant quune alimentation amliore naurait pas deffet sur des volailles indignes
faible potentiel gntique. Actuellement, on est de plus en plus conscient quil convient
Aviculture Familiale 7

dquilibrer le niveau damlioration gntique avec celui de lamlioration des


disponibilits alimentaires, de la protection sanitaire et de la gestion. De plus, le
potentiel gntique des races autochtones et leur pouvoir de conversion des ressources
alimentaires localement disponibles en production durable est de plus en plus reconnus.

Ce manuel a pour objectif de procurer un guide pratique et une vision du potentiel de


laviculture familiale amliorer les moyens dexistence ruraux et satisfaire la
demande accrue en produits avicoles, pour tous ceux qui sont impliqus dans le
dveloppement avicole.
Chapitre 2
ESPCES ET RACES

VARITS DESPCES ET DE RACES DE VOLAILLES

Toutes les espces de volaille sont utilises dans le monde par les petits exploitants.
Sous les tropiques, les plus importantes sont : la poule, la pintade, le canard (y compris
le canard de Barbarie), le pigeon, la dinde et loie. Des souches locales sont utilises,
mais la plupart des espces ne sont pas autochtones. La pintade (Numididae) est
originaire dAfrique Occidentale, le canard de Barbarie (Cairina moschata) dAmrique
du Sud, le pigeon (Columba Livea) dEurope, le dindon (Meleagrididae) dAmrique
latine, le faisan (Phasianidae) dAsie, le canard commun (Anas) dEurope et loie
(Anser) dAsie.

La composition du troupeau rpond aux objectifs de lentreprise avicole (voir chapitre


1) Au Nigria, par exemple, une prfrence est donne au poulet local multicolore et
peu emplum ou au canard de Barbarie. Le plumage multicolore sert de camouflage aux
oiseaux picoreurs vis--vis des prdateurs, parmi lesquels les oiseaux de proie, mieux
mme de distinguer les couleurs brillantes spcialement le blanc. Le troupeau fondateur
sacquiert gnralement au march sous forme de poulettes en croissance et de
coquelets. Le sex-ratio de 5:1 est commun. Les animaux des deux sexes sont gards de
150 300 jours avant dtre rforms, vendus, auto-consomms ou donns sous forme
danimaux adultes.

Dans les dernires cinquante annes, le dveloppement de souches hybrides a t


largement encourag dans le secteur de laviculture commerciale intensive. Cette
tendance est particulirement perue pour les poules, dindons et canards. Ces nouveaux
hybrides, surtout poules et poulets, ont t largement diffuss et sont prsents dans tous
les pays tropicaux, jusque dans les villages les plus reculs. Ils ont t soigneusement
slectionns et spcialiss soit pour la production de viande, soit pour la production
dufs. Les souches finales ainsi obtenues sont inutilisables pour la reproduction,
spcialement lorsquelles sont croises avec les volailles villageoises car elles nont que
peu daptitudes maternelles et sont de pitres couveuses.

Pour les petits exploitants, lever des hybrides signifie des changements notables dans
la gestion. Ceux - ci sont coteux pour les raisons suivantes:
x Les poussins dun jour destins au remplacement doivent sacqurir lextrieur.
x Les poussins requirent incubation et leveuse artificielle et un aliment spcial de
dmarrage.
x Pour une production optimale de viande ou dufs, une alimentation quilibre de
haute qualit est indispensable.
x Une hygine vtrinaire et une gestion sanitaire soigneuses sont incontournables.
x Les poules pondeuses de souches hybrides ont besoin dun programme lumineux
artificiel, savoir une augmentation progressive de la dure quotidienne de
lumire jusqu un total de 17 heures par jour, pour une production optimale et
profitable.
Aviculture Familiale 9

Par ailleurs, viande et ufs produits partir de souches hybrides sont considrs par les
consommateurs traditionnels comme moins savoureux, avec de plus, une texture moins
ferme pour la viande. Par consquent les consommateurs payeront souvent un prix plus
lev pour des volailles et des ufs produits en milieu villageois. Pour les leveurs
familiaux en milieu rural, il est ainsi plus appropri de maintenir et amliorer les
volailles locales afin de satisfaire cette demande.

Gallinace
Poules et Poulets sont originaires dAsie du Sud Est et furent disperss dans le reste
du monde par marins et commerants. De nos jours, les volailles rurales indignes sont
le rsultat de sicles de croisements avec des races exotiques et de slection conduite au
hasard lintrieur du troupeau. Il en rsulte quil nest pas possible de standardiser les
caractristiques et les performances productives des poules et poulets indignes.

Il nexiste pas de liste exhaustive des races et varits des poules et poulets utiliss par
les petits exploitants ruraux, mais il existe une information considrable sur les
populations autochtones de diverses rgions. La majeure partie concerne la couleur du
plumage et autres caractres corporels aisment mesurables (caractristiques
gntiques) mais dautres donnes plus dtailles deviennent progressivement
disponibles. Des exemples rcolts dans diffrentes rgions tropicales en sont donns
dans les tableaux 2.1 2.3. ci-dessous. Les valuations ont habituellement t effectues
en conditions de gestion intensive dans des stations de recherches, car lobjectif tait
destimer le potentiel de productivit de ces races locales. Plus rcemment, de telles
donnes sont devenues disponibles sous gestion extensive ce qui permet de comparer
les performances selon les deux types de conduite (voir tableau 2.3)

Tableau 2.1 Performances de races locales en Asie du Sud (en logement intensif)
_______________________________________________________________________

Caractre/Race: Desi Counu Aseel


Kadak Bengale
-anath noir
_______________________________________________________________________
P.V.12 semaines 544 629 640 ND 433
Age 1eruf (jours) 208 ND 219 ND 200
ufs /poule / an 116 104 100 80 ND
Poids uf (g) 46 45 51 39 49
Fertilit (%) 81 80 55 90 86
Eclosabilit (%) 55 61 45 61 68
_______________________________________________________________________
Source: * Acharya et Kumar, 1984. Desi signifie local en Bengali.

Certains caractres tels le poids lge adulte ou celui des ufs peuvent
considrablement varier selon les populations de poules indignes, alors que les
caractres de reproduction, comme le nombre de saisons de ponte annuelles, le nombre
dufs par couve ou lclosabilit sont plus uniformes Les poules Desi du Bengladesh
pondent leur premier uf l ge de 190 200 jours (mesure commode pour valuer la
10 Espces Et Races

maturit sexuelle), et elles pondent 10 15 ufs par cycle de ponte avec 3 4 couves
par an, dont lclosabilit tourne autour de 84 87 pour cent (Haque, et al, 1999).

Tableau 2.2 Races locales de poules en Ethiopie


_______________________________________________________________________
Caractre\ Races: Tukur Melata Kei Gebsima Netch
_______________________________________________________________________
Poids 24 semaines 960 1000 940 950 1180
Age 1er uf (jours) 173 204 166 230 217
ufs /poule /an 64 82 54 58 64
Poids uf (g) 44 49 45 44 47
Fertilit (%) 56 60 57 53 56
Eclosabilit (%) 42 42 44 39 39
_______________________________________________________________________
Source: Shanawany et Banerjee,1991 cit par Forssido,1986.
*Australian Agric. Consulting & Mgt, 1984; Beker & Banerjee, 1990.

Les poules indignes villageoises thiopiennes atteignent la maturit sexuelle lge


moyen de sept mois (214 jours). Elles pondent environ 36 ufs par an en 3 couves de
12 13 ufs pondus en 16 jours Si la poule couve ses ufs pendant trois semaines et
lve ses poussins pendant douze semaines, le cycle reproductif compte un total de 17
semaines. En une anne, trois cycles peuvent ainsi se succder ce qui est efficace,
productif et essentiel la survie.
Aviculture Familiale 11

Tableau 2.3 Performance de races locales en systme de divagation et de gestion


intensive
________________________________________________________________________
Systme Pays RacePoids Nombre Poids
corporel ufs uf
________________________________________________________________________
Divagation
Afrique Burundi Local 1500 75 40
Mali Local 1170 35 34
Tanzanie Local 1200 70 41
Asie Indonsie Kampung 2000 35 -
Malaisie Kampung 1430 55 39
Bangladesh Local 1140 40 37
Thailande Thai 1400 40 48
Thailande Betong 1900 18 45
Thailande Samae 2300 70 -
Amrique
Latine Rp.Dom. Local 1500 100 38
Rp. Boliv. Local 1500 100 -

Intensive
Afrique Egypte Fayoumi 1354 150 43
Egypte Dandarawi - 140 45
Egypte Baladi 1330 151 40
Nigria Local 1500 125 36
Tanzanie Local 1652 109 46
Ouganda Local 1500 40 50
Zambie Local 1500 35 52

Asie Bangladesh Desi 1300 45 35


Inde Kadakanath 1125 80 40
Indonsie AyamNumukan 2000 150 48
Indonsie AyamKampun 1350 104 45
____________________________________________________________________
Source: Compil partir de Horst: 1989; Katule, 1991 Horst et al 1996, Haque, 1999.

Pintade
La pintade est originaire dAfrique de lOuest mais se rencontre actuellement dans
beaucoup de rgions tropicales et slve en grands effectifs sous systmes intensifs en
France, Italie, Hongrie et dans les anciennes rpubliques dUnion Sovitique. En Inde,
la pintade est leve sous forme de troupeaux de quelques centaines danimaux dans les
tats du Punjab, de lUttar Pradesh, de lAssam et du Madhya Pradesh. La pintade a une
reproduction saisonnire et, en systme de libert, pond uniquement en saison des
pluies. Elle est trs peureuse, perche dans les arbres pendant la nuit, vole trs peu mais
marche beaucoup.
12 Espces Et Races

La pintade prospre aussi bien en climat froid que chaud et son potentiel de
production de viande et dufs mrite dtre mieux reconnu. Le premier uf est
normalement pondu 18 semaines et la diffrence de beaucoup doiseaux indignes
qui ne produisent quune couve annuelle la pintade pond en continu jusqu ce que
sinstallent des conditions climatiques dfavorables. En Afrique Occidentale, la ponte
est troitement confine la saison des pluies. La pintade leve en semi-libert peut
pondre jusqu 60 ufs par saison mais des oiseaux levs en bonnes conditions
intensives produisent jusqu 200 ufs par an. La pintade a tendance couver mais
cette habitude peut facilement tre rprime en retirant les ufs une fois pondus. Une
couve de 15 20 ufs est commune; la priode dincubation dure 27 jours. Au
Nigria, il a t rapport que la pintade domestique leve en conditions extensives ou
semi-intensives pond 60 100 ufs avec un taux de fertilit de 40 60 pour cent.

Il existe trois varits principales de pintade domestique : Perle, Blanche et Lavande.


La Perle est de loin la plus commune. Elle possde un plumage violac parsem
rgulirement ou perl de taches blanches. La Blanche a un plumage uniformment
clair tandis que la Lavande a des plumes lgrement grises pointilles de blanc. Mle et
femelle diffrent si peu en apparence, tant en ce qui concerne le plumage que le poids
(1,4 - 1,6 Kg), que lleveur inexpriment peut sil ny prend garde, lever ensemble
tous les mles et femelles en troupeau de reproduction. En fait, les sexes peuvent tre
diffrencis huit semaines ou plus par leur cri caractristique.

En gestion intensive, la pintade domestique a une capacit de ponte plus leve. La


souche franaise Galor peut produire 170 ufs sur une priode de ponte de 36 semaines.
A titre dexemple, partir dune production de 155 ufs, un taux de fertilit de 88 pour
cent et une closabilit de 70-75 pour cent, il est possible dobtenir 115 pintadeaux par
femelle. En litire profonde ou en parc, il est possible dobtenir 50 75 pintadeaux
/femelle sur une priode de ponte de 24 semaines.
Tableau 2.4 Caractristiques de la reproduction et de luf de diffrentes varits de
pintade
_______________________________________________________________________
Varits: Perle Blanche Lavande
Caractres
_______________________________________________________________________
Age 1er uf 196 217 294
N/ufs/pintade/an 51 38 43
Poids oeuf 38 37 36
Dure ponte (jours) 155 114 92
Fertilit (%) 53 50 0,0
Eclosabilit (%) 87 81 0,0
_______________________________________________________________________
Source: Ayorinde, 1987 and Ayorinde et al, 1984.

Canard
Le canard prsente plusieurs avantages par rapport aux autres volailles, en particulier sa
rsistance aux maladies. Il est robuste, trs bon utilisateur de fourrage et facile
Aviculture Familiale 13

conduire en troupeau, particulirement dans les terrains humides. En Asie, la production


de canard est, en grande partie, associe la riziculture irrigue en zones tropicales
humides. Un autre avantage est le fait que la cane ponde la majorit de ses ufs dans les
trois heures suivant le lever du soleil, au lieu de cinq pour la poule. Ceci permet au
canard de dambuler dans les champs de riz pendant toute la journe, et de rester
enferm pendant la nuit. Compar aux autres volailles, le canard prsente le dsavantage
de gaspiller beaucoup de nourriture lorsquil est lev en claustration avec des aliments
composs quilibrs. Ceci provient de son bec en forme de pelle. Il est donc moins bon
transformateur ce qui augmente le prix de son uf et de sa viande par rapport aux
gallinacs. (Farrell, 1986). Les plumes et le duvet de canard peuvent positivement
contribuer au revenu.

Les diverses races de canards sont gnralement regroupes en 3 classes :


x viande ou plusieurs fins
x ufs
x ornementales

Ces dernires se retrouvent rarement en aviculture familiale. Les races viande


principales sont reprsentes par le Pekin, le Barbarie, le Rouen et lAylesbury. Les
races ufs comprennent le Tsaiya brun tawanais, le Grand Patero, le Coureur indien
de Malaisie et le Khaki Campbell anglais. Toutes ces races pondeuses proviennent du
Mallard tte verte (Anas platyrhynchos platyrhynchos). La production moyenne
dufs tourne autour de 70 pour cent (cane/jour). Le Coureur Indien, le Khaki
Campbell, Le Pkin et le Barbarie sont les races les plus importantes en aviculture
rurale.

Coureur indien
Race trs active, elle est originaire dAsie et est idale en parcours. Trs bonne
pondeuse, elle est peu exigeante en eau, nayant besoin que dimmerger son bec
jusquaux narines. Cest la plus gracieuse et la plus lgante des races de canards
terrestres avec son port altier et son corps mince. Elle se dresse un angle de 80 par
rapport au sol mais est quasiment perpendiculaire lorsquelle est effraye.

Khaki Campbell
Originaire dAngleterre, cette race drive de trois varits: Le Mallard sauvage, le
Rouen et le Coureur indien. La femelle a un plumage uniformment kaki, tandis que le
mle possde une tte vert bronz. La femelle est rpute pour sa ponte prolifique dune
moyenne de 90 pour cent, avec un uf dun poids moyen de 73 grammes.

Pekin
Originaire de Chine, cette race viande attractive est la prfre des producteurs
commerciaux travers le monde. Elle est grande et viandeuse avec un port noble et une
large tte ronde. Le plumage est blanc jaune citron et la peau est jaune. Elle est
robuste, pond raisonnablement et a une croissance rapide. Malgr sa timidit, elle est
docile et se garde facilement lintrieur de cltures basses. Elle convient aussi bien
de grandes fermes spcialises qu de petites exploitations : Elle reprsente la race
viande prdominante en Thalande, Malaisie, Philippines, Core et Chine.
14 Espces Et Races

Barbarie
Il ne sagit pas gntiquement parler dun canard ou dune oie, car il ressemble plus
cette dernire (Anseridae).Comme loie, il consomme de lherbe, et se caractrise par
une longue priode dincubation de 36 jours (compare celle de la cane qui est de 28
jours). Il est populaire dans les rgions o la production de riz irrigu est faible, car il ne
requiert pas deau pour se baigner ni pour se reproduire. La femelle est une excellente
couveuse et est frquemment utilise pour couver les ufs dautres espces, comme le
canard, la poule ou la pintade. Elle-mme pond assez peu : 30 40 ufs par an en
conditions extensives. Il existe un grand dimorphisme sexuel : les mles peuvent
atteindre un poids de 4,5 5,5 kg, tandis que le poids de la femelle adulte tourne autour
de 2,3 2,8 kg. Le plumage combine noir et blanc, avec toutes les gradations entre ces
deux couleurs. Le mle possde des excroissances charnues rouges autour des yeux : les
caroncules. Le Barbarie reprsente le palmipde le plus commun en Afrique et en
Amrique Latine, o il prospre en conditions de semi-libert. Ses effectifs
saccroissent en Asie o sa viande rouge et maigre est populaire (Han et al.1995), Son
croisement avec le canard domestique produit un hybride infertile, appel mulard.
Celui-ci reprsente la source principale de viande de canard Taiwan. Il est produit
travers un croisement trois voies : des mles Pkin sont croiss avec des femelles
Tsaiya afin de fournir une ligne femelle, appele Kaiya. Celle-ci est alors croise avec
de grands mles Barbarie de couleur blanche, gnralement par insmination artificielle.
Le produit est un mulard blanc, strile et croissance rapide. Il prsente une excellente
carcasse avec plus de viande et moins de graisse que le Pkin. Le croisement trois
voies prsente les avantages combins de la haute productivit en ufs du Tsaiya, la
croissance rapide du Pkin et lexcellente qualit de carcasse et de viande du Barbarie.
Ses plumes blanches sont prfres comme duvet celles des plumages sombres.

Tableau 2.5 Races de canards avec leurs caractristiques


_______________________________________________________________________
Caractristiques : Couleur P,V, Kg Couleur uf
Plumage mle / femelle
Race /
_______________________________________________________________________
Pkin blanc 4.1 3.6 blanc/ bleu vert
Barbarie blanc/noir 4.5 3.0 blanc/vert crme
Coureur Indien blanc 2.0 1.8 blanc/ blanc crme
Khaki Campbell brun/ khaki 2.0 1.8 blanc
Mallard 1.4 1.1 bleu-vert/tachet
_______________________________________________________________________
Source: non communique.

Dans la plupart des pays tropicaux, des races locales de canards ont t slectionnes
pour sadapter aux conditions rgionales. Elles peuvent ne pas tre aussi performantes
que les races amliores mais possdent la capacit de survivre et de bien produire en
systmes extensifs et semi-intensifs. Setioko (1987) a dcrit trois types de canards
indonsiens: Tegal, Alabio et Bali. Des gnotypes amliors ont t introduits et se sont
soit croiss avec des canards locaux, soit se sont maintenus relativement purs. La
question sest pose de savoir si les gnotypes amliors taient capables de survivre
Aviculture Familiale 15

dans des systmes fermiers traditionnels. Des essais conduits dans le Delta du Mekong
par Thebin (1996) ont mis en vidence que les canards hybrides viande, levs dans
les champs de riz, taient plus profitables que les canards locaux, mme sils
consommaient plus de nourriture et taient plus coteux lachat. Toutefois, levs
pour la production dufs dans les rizires et les canaux, les hybrides se rvlaient
moins performants que les canes locales.

Oies
Parmi les volailles leves en systme familial, loie semble moins importante, sauf
dans quelques pays dEurope de lEst (Pologne, Hongrie), du Proche et Moyen-Orient
(principalement chez les populations Kurdes de Turquie, dIrak et dIran), en Chine et
en Core. Ce sont principalement les races locales qui sont utilises, lexception de
quelques souches europennes importes fins de croisement, telles la Toulouse,
lEmbden et la Blanche Romaine. Dans les systmes de production les plus modestes
prfrs par la majorit des aviculteurs familiaux, les races de petite taille, pesant
environ 4 kg comme la Zie ou la Lingxhian chinoise, sont plus faciles lever. Loie est
trs bonne couveuse ce qui limite sa productivit en ufs : 30 40 destins
lincubation et pondus en 3 5 cycles annuels. Toutefois, il existe des races trs fertiles
produisant un nombre lev dufs quelles ne couvent pas. Elles sont plus petites et
slectionnes plus particulirement pour la reproduction. Telle est la Zie qui peut
pondre 70 100 ufs par an. En Chine, existe un trs large ventail gntique fort
intressant non seulement pour lAsie, mais aussi pour lensemble de la plante.

Pigeon
Dans la plupart des pays, les pigeons se nourrissent de rsidus et ne reoivent pas de
supplment alimentaire. Ils vivent sur les toits des maisons et sont traits comme des
animaux familiers nayant pas besoin dtre nourris. Ils semblent prfrer les cours des
maisons que la campagne. Dans certains pays, ils ne sont consomms que pour des
objectifs rituels. Ils pondent normalement deux ufs par couve et les jeunes
pigeonneaux closent aprs 16 17 jours. Ils sont nourris par leur mre base de lait
de jabot, produit dans ce rservoir digestif situ la base de lsophage. Cela leur
permet une croissance trs rapide, les amenant maturit en trois cinq mois un
poids de 200 300 g pour les mles et de 150 g pour les femelles. Les pigeons adultes
sont monogames vie. Les pigeons locaux sont spcifiques aux diffrentes rgions
tropicales. Il existe cinq races africaines, dont trois pour le Tchad. Cinq races sont
prsentes en Asie et au Pacifique, dont une race locale particulire aux Iles Cook. On ne
trouve quune seule race locale en Amrique Latine et aux Carabes. Il y en a six en
Europe, dont deux en Belgique.

Dindon
Cet oiseau est natif dAmrique latine. Les races leves par les producteurs ruraux
possdent un plumage noir, distinct des races plumage blanc habituellement utilises
en levage intensif. Il reprsente le volatile au plus grand format en systme fermier.
Son poids vif varie de 7 8 kg chez le mle, de 4 5 kg chez la femelle. Il a une
excellente conformation pour la viande. La femelle pond 90 ufs par an, avec une
closabilit moyenne bonne. Il est plus sensible aux maladies que la poule ou le
canard.
Chapitre 3
RESSOURCES ALIMENTAIRES

INTRODUCTION

Un apport rgulier de nourriture peu coteuse, suprieur aux simples besoins


dentretien, est essentiel pour amliorer la productivit au sein des trois systmes
utiliss en aviculture familiale:
x libert; la volaille perche dans les arbres durant la nuit;
x basse-cour; la volaille est enferme pendant la nuit;
x semi- intensif; la volaille volue pendant la journe dans un enclos relativement
limit o elle a loisir de picorer.

Lorsque les ressources alimentaires sont inadaptes, il vaut mieux ne possder que
quelques oiseaux productifs plutt quun effectif plus nombreux, maintenu lentretien,
mais nayant pas assez daliment sa disposition pour tre rentable.

Systmes extensifs
Les fermiers essayent dquilibrer leurs effectifs en rapport avec les ressources
rsiduelles saisonnires disponibles. Dans les systmes en libert et en basse-cour, les
apports alimentaires sont gnralement insuffisants en saison sche pour une
quelconque production au-del des simples besoins dentretien du troupeau. Quand la
vgtation est sche et fibreuse, les ressources rsiduelles picorables devront tre
complmentes par des apports minraux, vitaminiques, protiniques et nergtiques.
Dans la plupart des systmes traditionnels villageois, un supplment de grain est
distribu raison de 35 g par poule et par jour.

Il existe diffrentes approches destines utiliser une base plus large de ressources
alimentaires par le troupeau. Lune dentre elles est lutilisation dautres volailles que
les poules. Les palmipdes, spcialement les canards, peuvent tre diffuss dans les
rgions humides, o ils peuvent se nourrir daliments tels que les escargots et les plantes
aquatiques prsentes dans les tangs et les lagunes. Un autre systme consiste intgrer
la volaille avec dautres productions, telles le riz, les lgumes, le poisson ou un autre
btail. Un exemple est la combinaison de poulet avec le gros btail, telle que pratique
par les Peuls au Nigria, o la volaille se nourrit des asticots dans le fumier et des tiques
sur les animaux. Dans de telles conditions, les poulets levs lintrieur du corral
psent en moyenne 500g de plus que ceux levs lextrieur (Atteb, 1993).

Systme semi-intensif
Dans celui-ci, toutes les substances nutritives ncessaires aux oiseaux doivent tre
procures par les aliments, gnralement sous forme de composs quilibrs, fournis par
une provenderie. Comme ceux-ci sont coteux et difficiles obtenir, les petits
exploitants utilisent des aliments non conventionnels ou diluent les aliments
commerciaux en y ajoutant des sous-produits de grains qui les supplmentent en nergie
et partiellement en protines Un aliment bien quilibr est cependant difficile raliser
du fait que les grains et les sources protiques dorigine vgtale, savoir les sous-
produits de quelques graines olagineuses, sont de moins en moins disponibles pour le
Aviculture Familiale 17

btail, et que les prmlanges doligo-lments et de vitamines sont gnralement trop


onreux. Phosphore et calcium peuvent provenir dos calcins (brls et broys); le
calcium de coquilles descargot, de coquillages marins ou de dpts calcaires. Lapport
en sodium travers le sel, peut provenir de lvaporation deau de mer ou de roches
salines. Ces sources minrales sont rarement utilises. De sorte que la nourriture fournie
la volaille dans ce systme est de bien moindre qualit que dans les systmes
purement extensifs ou totalement intensifs.

RESSOURCES ALIMENTAIRES DISPONIBLES

La taille et la productivit du troupeau villageois dpendent en fin de compte de la


population humaine et de ses rsidus mnagers et culturaux, ainsi que de la disponibilit
en autres ressources alimentaires picorables. Il y a une relation vidente entre la
production dufs et la consommation alimentaire. Ceci est vrifiable au Bangladesh o
la production dufs, faible pendant les pluies daot et septembre, saccrot
significativement en janvier et fvrier lorsquune quantit importante descargots
devient accessible (Horst, 1986). Une liste des ressources alimentaires disponibles pour
les petits exploitants a t dresse partir denqutes effectues au Nigria (Sonaiya,
1995). Ces ingrdients taient majoritairement des rsidus de cuisine ou agro-industriels
et semblables aux autres aliments de ce type recenss en pays tropicaux.

La Base des Aliments Rsiduels Picorables ( BARP) comprend:


x les dchets de cuisine;
x les crales et leurs sous-produits;
x les racines et tubercules;
x les graines olagineuses;
x les arbres, les arbustes (incluant Leucoena, Calliandra et Sesbania) et les fruits;
x les protines animales;
x les plantes aquatiques (Lemna, Azolla et Ipomoea aquatica);
x les aliments commerciaux.
Ces ressources seront dcrites plus en dtail ci-aprs.

LA BASE DES ALIMENTS RSIDUELS PICORABLES

Roberts (1992, 1994 et 1999), Gunaratne. Chandrasiri, Hemelatha et Roberts (1993)


ainsi que Gunaratne, Chandrasiri, Wickramaratne et Roberts (1994) ont recherch et
classifi les disponibilits alimentaires accessibles pour les volailles en divagation en
Asie du Sud-Est et les ont regroupes dans une liste appele la Base daliments
rsiduels picorables (BARP). Celle-ci se dfinit comme lensemble des produits
alimentaires accessibles tous les animaux divaguant dans une zone dtermine. Elle
dpend du nombre de mnages, des types usuels de cultures vivrires, de leurs mthodes
de rcolte et de transformation ainsi que des conditions climatiques pouvant interfrer
sur le degr de dcomposition des rsidus alimentaires. Des fluctuations saisonnires de
la BARP sont lies aux priodes de jachre, dinondation, de culture, de rcolte, et de
transformation. La BARP inclut les termites, les escargots, les vers de terre, les insectes,
les grains des semailles, les rsidus de rcolte, les semences, lherbe, les feuilles
fourragres, les plantes aquatiques et les matriaux alimentaires non conventionnels.
Les composants de la BARP ne peuvent tre rcolts que par les animaux picoreurs,
18 Ressources Alimentaires

parmi lesquels la volaille se caractrise par sa grande adaptabilit ce type de collecte,


variable selon les espces. De plus, diffrents types de volailles picorant simultanment
utilisent plus efficacement ce type daliment.

Elever des volailles en libert ou en basse-cour dpend dans une large mesure de la
qualit des aliments picors. Il est, ds lors, indispensable de savoir quelles sont les
ressources alimentaires disponibles. Par exemple une bande de 12 poulets en croissance
et de cinq poules productrices a accs une BARP de 450g (matire sche) daliment
contenant neuf pour cent de protines et 2300 kcal dnergie mtabolisable.
Ceci pourra soutenir une ponte journalire de 22 pour cent avec trois ufs/ couve en
supposant que 80 pour cent de la BARP soient utiliss.

Mthodes destimation de la BARP


La valeur de la BARP peut tre estime comme suit. La quantit daliments disponibles
partir des rsidus mnagers produits par chaque famille, est pese et dfinie comme
paramtre H . Elle est alors divise par la proportion de ce type daliment rcolt dans
le jabot de loiseau en train de picorer, dfinie comme paramtre p (Roberts, 1992).
Le quotient H/p est alors multipli par le pourcentage de mnages propritaires de
volailles (paramtre c):
BARP = H/p (c)
Par exemple, une BARP mesure suivant la mthode ci-dessus en Asie du Sud-Est
stale entre 300 600g. de matire sche (M.S.). contenant huit dix pour cent de
protine vgtale et de 8.8 10.4 megajoules (M.J.) dnergie mtabolisable (E.M.) par
kg. ( 2100 2500 kilocalories (Kcal) E.M. par Kg ) (Prawirokosomo, 1988; Gunaratne
et al, 1993 et * 1994c). Le contenu en protines et en E.M. de la BRAP fut dtermine
par analyse du contenu du jabot: au Sri Lanka, la BRAP annuelle disponible pour
chaque famille a t estime 23kg de protine brute (MPB) et 1959 MJ de EM (468
Kcal de EM) (Gunaratne et al. 1993).

Dans le cas de ltude conduite au Sri Lanka, la collecte de rsidus alimentaires


quotidiens fut effectue dans 34 mnages 14 reprises (Gunaratne et al., 1993). Ces
chantillons furent pess, examins et analyss. Quinze oiseaux picoreurs furent
rassembls et abattus en fin de matine; le contenu de leurs jabots et gsiers fut pes et
examin.

Les rsultats indiquent un poids frais moyen de 460 +/- 210 g/jour de rsidus par
mnage, consistant en:
x 26% de riz cuit;
x 30% rsidus de noix de coco;
x 8% brisures de riz;
x 36% divers (pluchures de lgumes, coquilles dufs, pain, poisson sch et
dchets de repas).
Le contenu des jabots est repris sous le tableau 3.1
Aviculture Familiale 19

Tableau 3.1 Valeurs de BARP calcules pour des troupeaux familiaux dans diffrents
pays sud-asiatiques
_______________________________________________________________________
Pays BARP en kg Source
M.S. / an
_______________________________________________________________________
Indonsie 475 Kingston et Creswell, 1982
Thalande 390 Janviriyasopak et al., 1989
Sri Lanka 195 Gunaratne et al., 1993
Sri Lanka 197 Gunaratne et al., 1994.
_______________________________________________________________________
Source: Etudes de Cas: Dtermination de la Base dAliments Rsiduels Picorables dans
quelques villages Sri lankai

Les contenus de jabot comprenaient:


x 72% de dchets mnagers;
x 13% dherbe;
x 8% de matriel animal (vers de terre, escargots, fourmis et mouches);
x 7% de riz paddy.
La composition des contenus de jabot et des produits alimentaires/ dchets mnagers
sont dtaills dans le tableau 3.2.

Chaque troupeau familial avait accs aux dchets de deux mnages voisins, de sorte
que le total de M.S. disponible par troupeau tait de 550g par jour. La production
dufs moyenne stalait entre 11 et 57 pour cent, avec une moyenne de 30 pour cent.
Ceci na pas vari significativement durant les 12 mois de ltude. Le poids du poulet
20 jours variait de 41 100 grammes, et 70 jours de 142 492 grammes. La mortalit
70 jours tait de 65 pour cent. Les pertes taient attribues aux prdateurs,
particulirement les chiens, chats, mangoustes, corneilles et autres oiseaux de proie .
Plus de 90 pour cent du temps journalier de la poule tait consacr fouiller la
recherche de nourriture dans un rayon de 110 175 m. Les endroits privilgis cet
effet taient les enclos bovins et chvres.

Tableau 3.2 Composition moyenne des aliments principaux et du contenu des jabots
des poules picoreuses au Sri Lanka
_______________________________________________________________________
Composant Matire M.P.B. M.G. F.B. Cendres Ca P
sche
_______________________________________________________________________
Pour cent mg/g
Aliment /
Dchets mnagers 43.2 10.3 7.2 2.2 1.4 0.8 4.0
Rsidu 24.1 6.9 38.1 8.9 1.1 1.1 6.0
Brisures riz 89.9 9.0 1.3 1.5 3.2 0.5 1.4
Contenu jabot 34.4 9.4 9.2 5.4 16.0 0.8 0.9
20 Ressources Alimentaires

________________________________________________________________________
Source: Gunaratne et al, 1993 et 1994.

Facteurs affectant la BARP


Parmi les facteurs dterminant lapport en BARP, on citera: le climat, le nombre de
mnages, les effectifs et les types de btail prsents, les cultures, la religion du mnage.
Ceci a t clairement mis en vidence dans une tude srilankaise (*Gunaratne et al,
1994 a, b, et c.) dans laquelle il a t dmontr que la biomasse totale de la population
picoreuse tait proportionnelle la BARP. Si la BARP disponible est dpasse, la
production chute (les oiseaux meurent et les poules pondent moins dufs). Sil y a un
excdent de BARP ( du une bonne moisson ou une diminution des effectifs doiseaux
par maladie ou vente ), la production augmente (avec une survivance plus importante
des poussins et des animaux en croissance et une ponte plus leve). Par consquent, la
BARP disponible au sein dune communaut dtermine le potentiel productif de la
volaille. Si cette BARP est connue, dautres facteurs affectant la production pourront
tre identifis et les bnfices provenant de la fourniture dintrants supplmentaires
pourront tre valus.

Tableau 3.3 Quantits de dchets mnagers, calcul de la BARP et biomasse moyenne


du troupeau
_______________________________________________________________________
Location Mois Dchets BARP Biomasse
(nom village) mnages M.P.B.
en matire (g) (g) M.P.B.(g)
sche (g)
_______________________________________________________________________
Galgamuwa I mars 143 260 20 91
Galgamuwa I sept. 267 834 78 75
Galgamuwa II mars 543 639 63 83
Galgamuwa II sept. 549 603 49 36
Ibbagamuwa juin 414 575 56 57
Ibbagamuwa aot 307 365 43 48
_______________________________________________________________________
Source: * Gunaratne et al, 1994c.

La taille maximale productive du troupeau dpend de la BARP. Afin de garder la taille


du troupeau en quilibre avec la BARP disponible, il est ncessaire dincuber moins
dufs, de rformer les oiseaux improductifs et de vendre les animaux des quils ont
atteint le poids ou lge de vente. La capacit productive doit galement tre ajuste en
fonction des variations saisonnires de la BARP. Par exemple, lpoque des moissons,
lorsque la BARP augmente, il est possible dlever des poussins et des poulets en
surnombre, tandis quen fin de saison sche, des oiseaux doivent tre rforms, vendus
ou consomms. Supplmenter la BARP avec dautres ressources alimentaires permet
damliorer la situation nutritionnelle gnrale du troupeau et rduire la mortalit des
poussins. Ceci peut alors se concrtiser en poulets plus nombreux et plus gros; le
Aviculture Familiale 21

troupeau en expansion peut alors excder la BARP. Si ceci arrive, la production va de


nouveau chuter jusqu ce que lquilibre soit rtabli. La supplmentation alimentaire
nest bnficiaire que si elle rsulte en une augmentation des prlvements danimaux et
non des effectifs.

INGRDIENTS ALIMENTAIRES

La base de donnes FAO sur Les aliments du btail, disponible en ligne et en CD-
ROM fournissent une information complte sur ce thme pour toutes les espces de
btail, y compris la volaille. Les descriptions ci-dessous fournissent quelques
renseignements complmentaires.

Crales et leurs sous-produits


Les grains communment utiliss pour la supplmentation de la volaille incluent le mil,
le sorgho, le mas et le riz sous forme entire ou de brisures.

Les quantits distribues sont inadquates si lon prend en compte les 35g/oiseau/jour
comptabilis dans lenqute de Obi et Sonaiya de 1995. Cette observation, de mme que
le contenu important en tannins du sorgho ont conduit rechercher des types alternatifs
de crales et valuer lusage des sous-produits agro- industriels.

Riz dcortiqu
Peut tre employ en association avec des sources protiques vgtales et animales pour
tous les types de volaille. Le riz paddy ou cargo ainsi que les brisures de riz ont t
utiliss jusqu 20 30 pour cent des rations. Le son de riz est modrment riche en
protines (10 14 pour cent); il titre environ 10,4 M.J. de E.M./kg (2500Kcal.) et 11
pour cent de fibre brute. Il est riche en phosphore et en vitamines du complexe B. Du
son taux lev en graisses (14 18 pour cent), il a tendance rancir facilement. Pour
cette raison on ne linclut pas plus de 25 pour cent de la ration. Cela sapplique
galement aux polissures ou farines basses de cnes qui dailleurs sont souvent
prsentes dan le son. Le son est souvent adultr par les balles de riz, trs riches en fibre
et silice et pauvres sur le plan nutritif. Le son de riz reste nanmoins une importante
ressource alimentaire.

Rsidus damidon de mas


Il sagit dun sous-produit de lextraction damidon partir de mas humide moulu et
ferment, utilis comme petit djeuner en Afrique de lOuest. Il contient plus de 16% de
M.P.B., quoique ce taux varie en fonction de la varit de mas et de la mthode de
prparation.

Sous-produits de brasserie
Drches et levures sont devenus des ingrdients communs des rations pour volailles,
mais le processus de schage du produit humide peut savrer trs onreux.

Les lgumineuses et leurs sous-produits


Certaines lgumineuses traditionnelles, telles le haricot ou pois sabre (Canavalia
ensiforms et gladitra) peuvent, bouillis, tre distribues aux poules pondeuses un
taux maximum de 10 pour cent car la valeur nutritive en est faible (Udedibie, 1991). Le
22 Ressources Alimentaires

haricot ail ou pois carr (Phosphocarpus tetragonolobus L.) contient environ 40 pour
cent M.P.B. et 14 pour cent M.G. et sa valeur nutritive est trs similaire celle des
tourteaux darachide et de soja pour la production de poulet de chair. Son fourrage est
galement accept par la poule pondeuse. A moins que la plante ne soit tuteurise, la
production est faible ce qui en fait une culture peu conomique grande chelle. Elle est
toutefois intressante comme aliment et comme fourrage pour le petit producteur
avicole.

Soja (Glycine max)


Cette plante est de plus en plus rpandue pour la consommation humaine, Si les graines
sont utilises avant maturit pour lalimentation humaine, les cosses sont distribues la
volaille. Le soja cru, trait leau bouillante pendant trente minutes avec dtre
distribu aux oiseaux jusqu 35 pour cent de la ration, donne des performances
satisfaisantes tant chez les poulets de chair que chez les poules pondeuses. Sil nest pas
trait pralablement par la chaleur il en rsulte une dpression significative dans le
poids des poulets 20 semaines ainsi quun retard de quatre jours dans lapparition de la
maturit sexuelle (mesure par lge ou la poule atteint 50 pour cent de sa production
dufs). Cela est du la prsence dune antitrypsine dans la graine crue, dtruite par la
chaleur.

Nib(Vigna unguiculata L.)


Cette lgumineuse nest cultive en Afrique que pour la consommation humaine. Ses
sous- produits, spcialement les cosses, sont utiliss comme fourrage pour les petits
ruminants et sont galement distribus la volaille (Sonaiya, 1995). Elles reprsentent
environ six pour cent du poids total de la plante mais sont gnralement jetes aprs que
les graines soient transformes en pure destines fabriquer un gteau frit trs
apprci. Avec un taux de MPB de 17 pour cent, une nergie mtabolisable apparente
(ENA) de 4,2M.J./Kg (1005kcal. EMA/kg) et son contenu minral (44g cendres/kg, 9,0
mg Ca/g, 0,9mg P/g) les cosses de nib pourraient reprsenter une bonne ressource
alimentaire mais la prsence de tannins (53mg/g) et dune antitrypsine ( 12,4 units/mg)
limite son utilisation. De ce fait, les cosses de nib ne devraient pas reprsenter plus de
dix pour cent du total dune ration pour volaille.

RACINES ET TUBERCULES

Manioc (Manihot esculenta)


Cette plante racine est cultive en grande quantits en Afrique, Asie, Amrique latine,
la fois pour lalimentation humaine et comme aliment du btail. Le manioc et ses sous-
produits (feuilles, cossettes, pluchures, tapioca, chikwangue, fcule, grsillons,
farine sche, ensilage) sont utiliss cet effet. Les cossettes sont riches en nergie et en
fibre brute mais pauvres en protines. Dans les rgions o le manioc est employ pour
lalimentation humaine, les pluchures reprsentent la part la plus commune de la plante
pour la nourriture du btail. Des taux dincorporation de farine d pluchures de 20 45
pour cent ont t utilises dans lalimentation du poulet; toutefois cette pratique est
limite du fait de la quantit importante dacide cyanhydrique (HCN), de fibre brute et
de poussire, et du faible contenu en protines. Il existe des variations considrables
dans le taux dHCN en relation avec les varits de manioc. Si on remplace
compltement les graines dune ration par du manioc, il en rsulte une rduction
Aviculture Familiale 23

srieuse du poids de luf et un changement de couleur du jaune. Limpact sur la


fertilit et lclosabilit de luf ne sont pas connus. La farine de manioc donne de bons
rsultats chez le poulet de chair, sous condition dquilibrer soigneusement la teneur en
protines et autres composants. La mlasse ou le sucre peuvent tre utiliss pour
attnuer lamertume du cyanure et augmenter lapptibilit. Des graines olagineuses,
telles le soja entier, peuvent compenser la haute teneur en fibre brute, le faible taux en
protine et rabattre la poussire. Pour dnaturer le cyanure, sont utiliss diffrents
procds de dtoxification, tels lensilage, le schage au soleil, le schage lair, la
cuisson, lbullition ou le rouissage,. Pour les petits exploitants, le schage lair
reprsente la mthode la plus commode (Sonaiya et Omole, 1977). Lhuile de palme
peut galement attnuer les effets du cyanure chez la volaille. Certaines varits
douces de manioc, ne contenant pas dacide cyanhydrique, sont utilises dans
lalimentation humaine. Elles sont souvent distribues la volaille, particulirement au
canard.

Patate douce (Ipomoea batatas)


La patate douce sche a t incorpore avec succs jusqu 35 pour cent de la ration
des poulets de chair et des pondeuses. Les tubercules ont t bouillis avant usage, afin
dliminer les problmes de poussire et de contamination fongique dus au stockage.

GRAINES OLAGINEUSES

Ces produits ltat brut ou partiellement dshuils reprsentent une source la fois
nergique et protique tant dans les systmes avicoles extensifs quintensifs.

Coton (Gossypium spp.)


Le tourteau de graines de coton est fortement recherch pour lalimentation des
ruminants. Sil existe une disponibilit, il peut tre distribu dans lalimentation des
poules pondeuses ou des poulets de chair jusqu 25 pour cent de la ration sans effets
dfavorables sur la ponte ou la croissance (Branckaert, 1968). La chaleur utilise pour
lextraction de lhuile de coton dnature en effet le gossypol, principe toxique prsent
dans les graines. Il semble en outre que la volaille soit relativement tolrante au
gossypol. Toutefois, il peut provoquer une coloration olive du jaune duf. Laddition
de 0,25 pour cent de sulfate de fer des rations pour poules pondeuses contenant plus
de dix pour cent de tourteau de coton est recommande pour attnuer cet effet.

Ssame (Sesamum indicum)


La consommation alimentaire et le taux de conversion doiseaux nourris de graines de
ssame non traites et non dcortiques ont t reconnus meilleurs que pour les oiseaux
nourris de graines entires dcortiques. Cela confirme la pratique des petits exploitants
qui utilisent les graines entires de ssame comme supplmentation leurs volailles en
libert. Ces graines doivent tre utilises entre 20 et 35 pour cent de la ration.

Arachide (Arachis hypogaea)


Utilis sous forme de tourteau aprs extraction de lhuile raison de 8 24 pour cent de
la ration. Les arachides moisies peuvent contenir des principes toxiques, le plus
dangereux tant laflatoxine.
24 Ressources Alimentaires

Coprah (Cocos nucifera)


La farine de coprah peut tre utilise raison de 50 pour cent de la ration, spcialement
lorsquon la combine une source riche en nergie, comme la farine de manioc. Elle est
pauvre en lysine, leucine, isoleucine et methionine.

Tournesol (Helianthus Annuus)


Les graines de tournesol peuvent tre distribues entires; la farine de graines
dcortiques peut tre utilise pour remplacer le tourteau darachide et la farine de soja
et jusqu deux tiers de la farine de poisson. De toutes les graines olagineuses, cest
celle qui possde le taux le plus lev dacides amins sulfurs.

Fruits de palme (Elaeis guineensis)


Les fruits de palme sont, dans leur majorit, transforms localement. Les sous- produits
sont les amandes palmistes et une solution aqueuse dhuile, de fibres et de matires
solides. Cette solution peut alors tre filtre pour en retirer la fibre utilise comme
combustible. Le rsidu aqueux appel boue dhuile de palme est riche en nergie et
acides gras, La boue provenant de lextraction par solvants chimiques ne doit pas tre
utilise comme aliment, du fait de sa toxicit pour les oiseaux. Le produit artisanal peut
tre ferment et utilis en aviculture rurale ou sch et incorpor jusqu 40 pour cent
dans les aliments composs commerciaux (Hutagalang, 1981). Les amandes palmistes
sont traites localement par la chaleur. Ou par extraction leau froide afin de produire
lhuile de palmiste. Le rsidu par le traitement la chaleur nest plus que de la cendre et
na pas dusage pour la volaille, alors que le rsidu par le traitement leau est trs
nutritif et apptible; son utilisation est comparable celle du tourteau darachide. Il peut
tre incorpor raison de 30 pour cent de la ration. Toutefois, ce produit est pauvre en
acide amin soufr.

Soja voir lgumineuses


Autres graines olagineuses
Parmi ces dernires qui ont t utilises en conditions de recherche, citons lHva,
lAmaranthe, le Niger ou Nueg (Guizotia oleifera), le fruit de larbre pain (Artocarpus
Altilis), la caroube (Ceratonia siliqua), le karit, le melon, la mangue et le ricin. Le
gombo ou okra (Hibiscus esculentus) na pas encore t valu comme source
protinique pour la volaille et quoique sa richesse en cet lment soit moindre que celle
du soja, il peut cependant y tre favorablement compar pour ce qui concerne les autres
nutriments. Comme le gombo est largement cultiv par les petits exploitants et ses
graines stockes pour la mise en culture, il pourrait reprsenter une source potentielle en
protines pour laviculture familiale.

Pois bambara ou Voandzou (Voandzeia subterranea L.)


Reprsente une excellente source protinique avec un contenu lev en lysine. La noix
ntant par largement consomme, la plante est surtout cultive comme paillage et son
feuillage consomm par la volaille en libert.

Arbres, arbustes et fruits


Feuilles de Neem (Azadirichta indica)
Aviculture Familiale 25

Une tude a t mene sur lutilisation de feuilles de Neem par trois groupes de
pondeuses. Le premier groupe a reu une ration contenant dix pour cent de feuilles
fraches, le second dix pour cent de feuilles sches, le troisime a servi de tmoin et na
pas reu de feuilles. Le groupe nourri aux feuilles fraches a extrioris une
consommation alimentaire, une production dufs et un poids de luf plus levs,
compars aux deux autres. Il semble que les feuilles de Neem fraches contiennent un
principe lipidique favorisant la production et le poids des ufs. (Siddiqui, 1986)

Pulpe de caf
Riche en fibre, elle prsente un contenu en acides amins semblable celui du soja. De
ce fait elle peut tre utilise en quantits limites.

Pulpe de citron
A ne pas inclure plus de deux pour cent afin dviter un ralentissement de croissance
et une altration de la couleur du jaune de luf.

Bananes et Plantains matures


Beaucoup plus apptibles pour la volaille que les fruits verts qui contiennent des tannins
libres ou actifs.

Cannes sucre dfibres et mlasses


Le jus de canne peut reprsenter jusqu 25 pour cent de la ration, et les mlasses
jusqu 30%, mais, au del de dix pour cent, on note une liqufaction des matires
fcales. Toutefois, le sucre brut peut tre utilis jusqu 50 pour cent sans liqufaction
des fces. En combinant un quart de mlasses avec trois quarts de sucre, on obtient une
bonne production sans problmes digestifs. La mlasse est souvent ajoute aux rations
en faible proportion afin den amliorer lapptibilit quoiquil puisse en rsulter des
difficults de mlange ainsi que des contaminations fongiques toxiques, favorises par
la teneur en sucre, pendant le stockage.

Tableau 3.4 Taux dincorporation optimale de certains ingrdients dans les rations
pour volailles
_______________________________________________________________________
Aliment Taux optimum en %
_______________________________________________________________________
Farine banane 5 10
Mlasse citron 5 10
Pulpe citron 1 2
Rsidu fve cacao 2 7
Coques cacao 6 15
Cabosse cacao 5 15
Farine/tourteau coprah 5 15
Parche caf 3 5
Pulpe caf 3 5
Tourteau graine kapokier 5 10
Farine feuilles leucoena 2 5
Boue fruit de palme, sche 10 30
Boue fruit de palme, fermente 20 40
26 Ressources Alimentaires

Farine amande palmiste 10 40


Huile de palme 2 8
Farine graine heva 10 30
Mlasse canne sucre 10 30
Sucre brut 40 50
Jus de canne sucre 10 25
________________________________________________________________________
Source (Hutagalung, 1981)

PROTINES ANIMALES

Farine de sang
Il sagit dune ressource riche en protine brute mais relativement dsquilibre en
acides amins. La manipulation et le traitement du sang sont difficile en situation de
technologie limite. Pour transformer de petites quantits, il faut pralablement absorber
le sang sur un support vgtal, tels la pulpe de citron, les drches de brasserie, la farine
de palmiste, le mas moulu, la paille de riz ou le son de bl. Le matriel est ensuite tal
sur des plateaux chauffs par-dessous ou placs au soleil (Sonaiya, 1989). A la ferme, le
sang peut provenir de labattage de btail. Les abattoirs et les tueries procurent de
grandes quantits de sang pouvant servir la fabrication daliments commerciaux.

Termites
Farina, et al (1991) ont dcrit une technique pour lever des termites lintention des
volailles rurales. On rassemble dans un pot dargile ou une calebasse de la paille hache
de sorgho, de mil ou de mas, quon humidifie ensuite. Louverture du rcipient est
place sur le trou dune termitire en construction. Le rcipient est alors couvert dun
sac de jute pour maintenir lhumidit et il est bloqu avec une lourde pierre. Au bout de
trois quatre semaines, une nouvelle colonie de termites sest tablie lintrieur du
rcipient. Les ufs et les larves sont particulirement apprcis des poussins,
pintadeaux et canetons, tandis que les insectes sont consomms par les oiseaux adultes.
Du fumier de bovin peut tre utilis pour remplacer la paille.

Asticots
Alao et Sonaiya (1991, non publi) ont lev des asticots sur des cosses de nib et en
ont contrl la composition chimique pendant dix jours. Les cosses de nib ont t
entasses dans un panier proximit dune fosse latrines afin dattirer les mouches pour
y effectuer leur ponte. Tous les deux jours, un chantillon a t plac dans leau
bouillante afin de tuer les asticots. Ils ont ensuite t schs au soleil et moulus avant
dtre analyss. Les rsultats ont dmontr que le contenu en fibre brute du produit
doublait ds le deuxime jour. Soukossi (1992) a produit des asticots en les levant sur
un support base de matriel vgtal fibreux et de djections de volaille . La mthode
fut mise au point pour la pisciculture mais peut facilement sadapter pour laviculture
familiale. Un rservoir dune capacit dun mtre cube est rempli deau jusqu 15cms
de sa partie suprieure. Des tiges et chaumes schs de mas, amarante, arachide, soja et
autres lgumineuses sont tremps dans leau et des djections de volailles sont ajoutes.
Les mouches et dautres insectes sont attirs par ce support humide et y pondent leurs
ufs. Aprs cinq sept jours, les ufs ont clos et produit des larves suffisamment
dveloppes pour nourrir le poisson. Au-del de cette priode, les asticots se
Aviculture Familiale 27

dveloppent en insectes adultes. Il a t observ que 50 pour-cent des larves mouraient


si elles taient exposes au soleil pendant plusieurs heures. Do la ncessit dune
couverture, du moins pendant les heures les plus chaudes de la journe. Des essais
similaires ont t poursuivis avec succs au Burkina-Faso.

Vers de terre
Vorster, Adjovi et Demey (Intervertebrates Farming CTA/IMT/IFS Philippines,
Nov.1992 ) ont lev des vers de terre comme source de protine pour lalimentation de
poulets. Ils ont ainsi produit un Kg de vers frais quotidiennement sur une surface de
25m2. Cette quantit de biomasse suffit supplmenter un minimum de 50 poulets en
protine de haute qualit. Il faut toutefois prendre en compte le rle de vecteur jou par
le ver de terre dans la transmission de certains cestodes comme Davainea et Raillietina
(il en est de mme pour la transmission de trmatodes par certains escargots). De plus
ltat frais, le ver de terre contient un principe inhibiteur de croissance qui peut tre
dnatur par schage au soleil.

Autres produits animaux


Plusieurs produits aquatiques reprsentent de bonnes sources minrales. On y inclut les
coquilles dhutres et les bigorneaux de mangrove (Ostrea tulipa et Tympanostomus
fuscatus), ainsi que les praires. Les coquillages sont abondants et disponibles dans les
rgions ctires. Dans les zones forestires, peuvent se rcolter les escargots dont les
coquilles reprsentent galement une bonne source de calcium. Les escargots peuvent
galement se dvelopper en captivit. Une escargotire dun mtre cube peut produire
quarante escargots par an. Dautre part, certains escargots, tels le Golden Snail peut
reprsenter une peste pour les rizires (Philippines, Bangla- Desh, Vietnam) et les
canards qui, en sont friands, peuvent reprsenter un excellent moyen de contrle
biologique. Dautres sous-produits marins telles les farines de ttes de crevettes roses et
grises reprsentent un supplment la fois minrales et protique.

CONCLUSIONS
Des ressources alimentaires disponibles pour la volaille existent tous les niveaux de
production. Les petits producteurs utilisant un systme semi-intensif en fabriquant eux
mmes leur aliment doivent baser leurs rations sur les ressources produites sur
lexploitation ou se procurer localement les ingrdients ncessaires. En systme de
basse-cour, les ressources disponibles seront supplmentes avec les ingrdients
appropris, selon le besoin. Les dchets alimentaires mnagers distribus aux oiseaux
divaguant en libert seront galement complments. Des substituts potentiels aux
coteux aliments du commerce sont le manioc, la patate douce, la colocase, lamarante,
les rsidus et lhuile de coprah, lhuile de palme et dautres sources nergtiques non
traditionnelles. Pour remplacer les farines de poisson, de soja et darachide, peuvent tre
utiliss des aliments non conventionnels tels les farines de vers de terre ou dasticot, les
haricots ail et sabre, le pois cajan, les diffrentes espces dAzolla (A. pinnata,
A.caroliniana, A. microphylla), les farines et les concentrs de feuilles.

Selon les rgions, limportance de ces ressources alimentaires pour laviculture


familiale dpend de leur disponibilit en quantits suffisantes lchelle de la ferme
pour une prparation et une transformation commodes, ainsi que de la connaissance de
28 Ressources Alimentaires

leur valeur nutritive potentielle, par comparaison celle des aliments commerciaux
conventionnels et au prix et la disponibilit de ceux-ci.

En situation dun troupeau familial en divagation, le systme cafeteria peut procurer la


solution pour rquilibrer les rations alimentaires des diffrentes classes dges. Il
consiste fournir en libre choix trois concentrs diffrents dans des mangeoires
spares, lun riche en protines, le second en nergie, le troisime fournissant les
minraux et vitamines. La volaille possde en effet un instinct trs sr pour slectionner
les lments dficients et ne consommera pas en excs les diffrents types de concentr
mis ainsi sa disposition. Les jeunes oiseaux de moins de deux mois auront accs leur
nourriture dans un enclos spar des adultes afin quil ne puisse avoir concurrence entre
les classes dge. (creep systme)
Chapitre 4
CONDUITE GNRALE DE LLEVAGE

LOGEMENT ET PARCOURS

En conditions naturelles, la volaille pond dans des nids simples, perche dans les arbres et
passe une grande partie de la journe chercher sa nourriture. Les poulets dpensent
beaucoup de temps gratter le sol afin de dterrer les lments enfouis. Dans les
systmes basse-cour et semi-intensif, la volaille est gnralement enferme la nuit pour la
mettre labri des prdateurs et voleurs, tandis quen systme intensif, elle est totalement
confine jour et nuit. Certains aviculteurs ruraux gardent leurs volailles lintrieur de
leurs maisons, ventuellement sous leur lit, pendant la nuit, afin de se prmunir contre le
vol.

Si on lui laisse le choix pour pondre, la poule choisira comme litire une base douillette
et elle prfrera un nid sombre de taille adquate, environ 30 cm cubes, qui lui mnage
une certaine intimit. Avant de pondre, la poule explore un certain nombre dendroits
avant de pntrer dans le nid. Elle extriorise alors un comportement nidificateur, dont un
gloussement spcial protecteur; elle sassied ensuite et finalement pond. Aprs la ponte,
elle met un nouveau cri pour, en quelque sorte, exprimer sa fiert. Ces cris peuvent
galement tre perus dans un poulailler batterie. Si des perchoirs sont prsents, la poule
perchera la majeure partie du temps plutt que de rester sur des planchers grillags; dans
lobscurit, la plupart des oiseaux sont juchs sur les perchoirs. Il sagit probablement de
la survivance dune habitude permettant dchapper aux prdateurs nocturnes.

Les besoins principaux pour le logement de la volaille sont:


x lespace;
x la ventilation;
x la lumire;
x la protection vis--vis du climat et des prdateurs.

Espace: Densit doiseaux par unit de surface


Il sagit du principe de base essentiel pour le logement, car lespace disponible dtermine
le nombre et le type doiseaux pouvant tre entretenus. Par exemple, un poulailler litire
profonde de 6 x 11m peut accueillir 200 poules pondeuses une densit de 3 oiseaux/m2.

Lespace linaire des perchoirs se mesure en centimtres. Les densits au sol et


longueurs de perchoir recommandes pour les trois principaux types de volailles sont
reprises dans le tableau 4.1
30 Conduite Gnrale de Llevage

Tableau 4.1 Densits au sol et longueurs de perchoir pour les volailles


_______________________________________________________________________
Type Densit (oiseaux/m2)Longueur de perchoir
(par oiseau en cm)
_______________________________________________________________________
Pondeuse 3 25
Deux fins 4 20
Chair 4-5 15-20
_______________________________________________________________________

Le confort des poules vivant en groupe est assur une densit de 3-4 oiseaux par mtre
carr. Si davantage despace est accord, des attitudes diversifies peuvent sextrioriser.
Un espace plus rduit conduit un comportement de stress, ouvrant la porte une
vulnrabilit suprieure aux maladies et au cannibalisme; les animaux les plus faibles
sont galement privs de nourriture et despace pour se percher. Pris individuellement, les
oiseaux exigent plus de place pour un comportement normal et des possibilits dexercice
que la norme de 22 oiseaux/m2 couramment utilise en cages de ponte de type
commercial. Ces dernires dcennies, les proccupations concernant le bien-tre animal
ont encourag la recherche sur les cages de ponte afin de produire des modles mieux
adapts aux besoins des poules, tout en prenant en compte lefficacit des cots pour une
production conomique.

Ventilation: circulation de lair


La ventilation reprsente un facteur important du logement. Un btiment pans ouverts
est idal. Autrement, une ventilation croise sera installe sous forme darrives dair au
niveau du sol. Celles-ci seront amnages de sorte que le vent dominant souffle dans le
sens de la largeur du btiment. La masse dair prsente entre les murs dun poulailler
rsiste au dplacement mme si les murs sont largement ouverts. Plus large est le
btiment, plus cette masse dair est rsistante. Les btiments de plus de huit mtres de
large prsentent des problmes significativement plus importants dus aux proprits
inhrentes de lair et sa rsistance au mouvement. Il est ainsi recommand que la
largeur des btiments dpendant dune ventilation naturelle nexcde pas huit mtres,

Le stress thermique reprsente une contrainte significative pour une production russie
et peut conduire la mort. Si les oiseaux peuvent rsister plusieurs degrs sous zro, ils
ne supportent pas de tempratures suprieures 40C, mais cette tolrance dpend de
lhumidit relative prvalantes au temps considr. La volaille ne possde pas de glandes
sudoripares et doit assurer la thermorgulation par haltement afin daugmenter
lvaporation pulmonaire. Si lhumidit est trop leve, le mcanisme de refroidissement
ne peut fonctionner correctement. Pour la majorit des poules, la temprature ltale se
situe 46C, avec un svre stress apparaissant partir de 40C. Dans les rgions
tempres, le poulailler peut tre orient vers le sud afin de rcuprer de la chaleur. Sous
les tropiques, une orientation Est - Ouest permettra plutt de minimiser lexposition au
rayonnement solaire direct. Des matriaux de construction particulirement absorbants
comme certains mtaux seront vits, et il faut se souvenir que la peinture blanche
rflchit jusqu 70 pour cent des radiations solaires. Les problmes de ventilation lis
Aviculture Familiale 31

lalignement des btiments peuvent prvaloir sur le contrle de la chaleur, car la


ventilation croise suppose lorientation du btiment face au vent dominant.

La couverture du sol peut galement rduire la chaleur rflchie. Un ombrage sera


install, surtout si le mouvement de lair est rduit et lhumidit leve. Sans ombre ou
lorsquelle est confine en tempratures leves, la volaille est stresse par la chaleur; elle
devient irritable et peut se livrer au picage. Lorsque le plumage sinstalle,
particulirement chez les jeunes sujets, lanimal saigne facilement ce qui peut susciter du
cannibalisme. Les effets de stress thermique sont:
x Une rduction progressive de lingestion daliment lorsque la temprature ambiante
slve;
x Une augmentation de la consommation deau pour essayer de diminuer la
temprature;
x Un ralentissement progressif de la croissance;
x Des troubles de la reproduction (diminution du poids de luf, poussins plus petits,
une baisse de la concentration du sperme avec augmentation de formes anormales
de spermatozodes).

Lumire: dure et intensit


Un bon clairage est essentiel. Un poulailler sombre gnre des oiseaux lthargiques,
inactifs, non productifs. La lumire est importante pour lalimentation car la volaille
trouve sa nourriture grce la vision. Ceci est spcialement important pour les poussins
dun jour conduits en levage intensif qui ont besoin dune lumire brillante 24 heures
par jour pendant leur premire semaine.

La lumire reprsente galement un facteur important pour la maturation sexuelle. Un


accroissement de la lumire diurne ainsi que cela apparat naturellement ds la moiti
de lhiver jusqu la moiti de lt en pays temprs va acclrer la maturit sexuelle
chez les poulettes en croissance et leur permettre de commencer la ponte plus
prcocement. Si les poules sont dj en ponte, laccroissement de luminosit va
augmenter la production dufs. Leffet contraire se vrifie galement: si la luminosit
diurne diminue comme cela se produit naturellement ds la moiti de lt jusqu la
moiti de lhiver alors la maturit sexuelle est retarde chez les poulettes et la
production diminue chez les poules en ponte. Ces effets diminuent au fur et mesure que
lon se rapproche de lquateur du fait de la contraction des diffrences nycthmrales.

Cette caractristique physiologique est importante pour maintenir la production dufs


dans les troupeaux commerciaux et implique lexistence de programmes dclairement
artificiel. A cet effet, il est ncessaire davoir accs des sources fiables en
approvisionnement lectrique, autrement les coupures de courant peuvent entraner des
consquences extrmement dommageables. Un programme daccroissement lent et
progressif de la luminosit maximise le taux de production. Cependant, des programmes
dclairement suprieur 17 heures par jour peuvent avoir un effet ngatif. Un
programme de scurit procurant 24 heures dclairement a un effet similaire sur la
production dufs.

Les oiseaux sont les plus performants lorsque lclairement est maximal sans que la
temprature du poulailler soit trop leve. La lumire naturelle est prfrable moins que
32 Conduite Gnrale de Llevage

soit disponible une source de lumire artificielle rgulire, fiable et uniformment


distribue. Il est recommand que lintrieur du poulailler soit blanchi afin de rflchir la
lumire. Lintensit ou brillance de la lumire est galement importante. La production
dufs diminue lorsque lintensit lumineuse est infrieure cinq lux (le lux est lunit
mtrique de luminosit pouvant tre calcule par une cellule semblable celle installe
dans les appareils de photos); par contre, le poulet de chair poursuit une croissance
optimale une intensit lumineuse aussi basse que deux lux (intensit insuffisante pour
lire un journal). Les intensits sont enregistres au niveau de lil de loiseau, et non
ct de la source lumineuse. A moins que le supplment de lumire soit uniformment
rparti, il peut y avoir des endroits insuffisamment clairs travers le btiment qui ne
permette ni production dufs ni croissance optimale. Les schmas dagencement
supposent que les ampoules ou les tubes dclairage soient maintenus propres, car la
poussire rduit lclairement.

Protection: Abri, Hangars, Btiments


Beaucoup de facteurs influencent le type et le choix du logement pour protger la volaille
des effets du climat et des prdateurs. Ils comprennent les conditions mtorologiques
locales, lespace disponible, la taille du troupeau et le systme de gestion. En systme
extensif, les oiseaux doivent tre protgs des maladies et des prdateurs mais doivent
galement avoir la possibilit de picorer. Les cltures traditionnelles de plantes vivaces
pour grands animaux ne procurent pas une protection suffisante contre les prdateurs, tels
serpents, oiseaux de proie, rats et autres animaux nuisibles.

Un moyen simple et efficace pour dcourager les oiseaux de proie est de tirer travers
la surface principale de picorage des lignes de corde parallles, dont les intervalles sont
infrieurs lenvergure des prdateurs; alternativement, un filet de pche peut tre
dploy sur des poteaux afin de couvrir les parcours vers lesquels sabattent les
prdateurs sur les poussins en train de picorer.

Des piges et collets peuvent tre installs pour les grands prdateurs. Il nest pas
ncessaire den installer autour de tous les enclos, car ces animaux ont tendance revenir
sur le lieu de leur attaque. Les piges en acier peuvent tre enduits de brou de noix ou
dune dcoction de cabosses de cacao, la fois pour les camoufler et les prserver de la
rouille. Les piges seront plus efficaces sils ne sont pas touchs main nue car la plupart
des prdateurs ont un odorat trs fin. Ils seront manipuls avec des btons, des gants de
caoutchouc ou des pinces,

Les rats, mangoustes et serpents ne reprsentent un problme que pour les oiseaux de
petite taille. Les rats pntrent souvent travers les sols en terre. Les premiers signes
dune attaque de rats est le regroupement inusuel de poussins apeurs blottis en dessous
de lleveuse ou dans un coin ou la prsence de cadavres de poussins portant des griffures
sanguinolentes dans le cou. Les serpents tueront les poussins sils peuvent pntrer dans
le local dlevage. Un hameon trois crochets install dans le cadavre dun poussin peut
servir dappt; le serpent en ingurgitant loiseau va avaler lhameon et succomber. Les
ouvertures dans et autour des portes et fentres, au travers desquelles les rats et serpents
pourraient pntrer seront obtures.
Aviculture Familiale 33

Des cages ou des paniers peuvent tre utiliss pour abriter les mres poules et leurs
poussins et ainsi rduire la mortalit due aux prdateurs, aux voleurs et la pluie. Ces
dispositifs permettent galement de fournir sparment des complments deau et
daliments quoique les aliments habituellement dsquilibrs ainsi fournis supposent le
maintien ncessaire du picorage.

Tableau 4.2 Modes dattaque et mthodes de contrle des prdateurs


_______________________________________________________________________
Prdateurs Modes dattaque Mthodes de contrle
_______________________________________________________________________
Faucon Enlve les oiseaux gars Chasse; mettre les poussins
et faibles. Des traces de bec lcart des surfaces
et de doigts sont visibles sur propices la descente des
le dos. Dplume souvent oiseaux.
ses proies

Rat, habituellement prlvent plus Poison pour rats, si autoris


mangouste que pour leurs besoins et
enfouissent les poussins pour
les consommer ultrieurement

Serpent Avale ufs et poussins Hameons

Chien, chat Destruction gnrale Essayer de les attraper.


Les chats peuvent contrler
les rats. Chiens et chats
sauvages reprsentent un
problme.

Renard, Arrachent les plumes du dos Vagabondent au petit matin,


chacal et entre les ailes, consomment chassent pour leur progni-
les entrailles et le brchet, ture. Pigeage recommand.
emportent les cadavres dans
leur tanire.

Raton laveur Arrache la tte et mange les crtes.


Protg dans certains pays:
Emporte les oiseaux. Un permis de destruction
doit tre demand.
_______________________________________________________________________

LOGEMENT DANS LES SYSTMES EN LIBERT

Dans ce type de systmes, sera procur un abri pour la nuit, vaste, propre et ventil. Le
refuge pourra tre fixe ou mobile. Si lespace le permet, prfrence sera donne un
modle mobile, et afin daugmenter la production dufs, des units transportables seront
amnages pour les poules pondeuses. Ces units pourront tre dplaces lintrieur des
34 Conduite Gnrale de Llevage

parcours. Quoique ce type de logement soit moins coteux et requiert moins daliment
quilibr, il laisse les animaux exposs au soleil et aux infestations parasitaires.

La densit de stockage sur parcours sera calcule en fonction du type de sol et de la


gestion du pturage. Un abri pour 20 oiseaux conduits en libert peut tre tabli partir
de toute structure dj existante, telle une dpendance, une cuisine ou une habitation.
Avec une litire profonde, la densit maximale sera 3 - 4 oiseaux au mtre carr. Dans les
rgions fortes pluies, le plancher sera surlev avec un important surplomb
particulirement lentre. Ce parquet pourra tre en terre ou se prsenter sous forme
dune plate-forme en bambou qui prsente lavantage de fournir une ventilation sous la
volaille. Ceci maintient la fracheur en priode chaude et met les animaux labri des
eaux en priode de mousson. Les murs de labri peuvent tre en boue sche ou en
bambou, les portes et fentres en lamelles de bambou. Ce type de logement, qui peut tre
constitu de murs auto portants, pourra galement tre utilis dans des systmes semi-
intensifs ou intensifs.

LOGEMENT EN SYSTMES SEMI-INTENSIFS ET INTENSIFS

Planification
La claustration complte est recommande si:
x la conduite de llevage est correcte;
x la reproduction est rpartie tout au long de lanne;
x le terrain est rduit ou inaccessible toute lanne durant;
x un aliment quilibr est disponible;
x la fourniture de poussins dun jour de souche hybride est possible;
x la main duvre est chre;
x le contrle des maladies et des parasites est ais;
x lobjectif de llevage est la production commerciale.

La justification du confinement est:


x rduire la mortalit par prdateur des jeunes poussins de moins de deux mois;
x raliser un gain moyen plus lev et une meilleure conversion alimentaire chez les
sujets en croissance;
x permettre un meilleur contrle de la production chez les poules pondeuses.

Dans tous les systmes en claustration, lemplacement et la conception du btiment


doivent tre soigneusement considrs. Les abords du logement seront fauchs ou
pturs. Un bon emplacement suppose les critres suivants:
x facile accessibilit;
x disponibilit permanente et fiable en eau;
x bon drainage du sol;
x distance optimale des quartiers rsidentiels: suffisamment loigns pour viter des
problmes de sant publique; assez proches pour procurer une scurit suffisante;
x eloignement des zones forestires.

La conversion de btiments existants peut fournir le logement sous condition dobtenir


les autorisations pralables ncessaires. A titre dexemple, une cuisine extrieure
Aviculture Familiale 35

abandonne peut tre transforme en poulailler. En cas de conversion, un usage rationnel


maximal de lespace disponible sera soigneusement prvu:
x en dressant un plan lchelle du btiment;
x en utilisant, si possible, les murs et plancher existants;
x en prenant en compte les besoins despaces des oiseaux et la manutention du
fumier;
x en effectuant une tude de faisabilit considrant les futurs objectifs et besoins ainsi
que les avantages conomiques dune telle conversion.

Construction
Le plancher et extrmement important. Pour une litire profonde, le plancher sera bien
drain et construit en dur, sur une couche de gravier pais ou de treillis afin dviter
laccs aux rats. Ce type de sol est gnralement coteux. Le bois, le bambou, des briques
ou de larges pierres plates, suivant les disponibilits, peuvent tre employs mais sont
difficiles nettoyer. Les sols dargile sont meilleur march mais requirent dtre
renouvels entre chaque bande doiseaux ou, au moins, annuellement. Dans les rgions
o les matriaux de construction sont moins coteux quune litire profonde et
particulirement dans les rgions humides o les matriaux pour litire ne sont pas
disponibles, des planchers surlevs peuvent tre installs. Ceux-ci peuvent tre fabriqus
en grillage, mtal expans, lamelles de bois ou bambou fendu, afin de permettre la
collecte des djections par dessous; ils seront installs un mtre audessus du niveau du
sol afin de faciliter nettoyage et ventilation. Ce type de plancher peut conduire
linstabilit du btiment. Il faut le renforcer par des piliers qui seront soit faits de
matriaux rsistants la pourriture soit constitus par des soubassements en dur. Ils
seront fabriqus en bois, bambous, fts huile, et blocs de ciment. Les btiments avec
des planchers surlevs poss sur pilotis peuvent tre protgs des rats par des dflecteurs
Ceux-ci sont fabriqus partir dun collier de mtal, dune bote de conserve enroule en
forme dentonnoir renvers ou une bande de mtal fixe troitement autour du pilier afin
dviter la monte des rongeurs de petite taille.

Toits et murs peuvent tre construits partir de tous matriaux locaux bon march, tels
que lamelles de bambou, tiges de sorgho, boue sche, lamelles de bois, feuilles de
palmiers, pour autant que la structure soit rsistante la dent des rats. Dans les rgions
plus froides, les murs seront plus pais ou isolants; dans les rgions chaudes, le chaume
peut tre utilis quoiquil faille le remplacer frquemment pour viter infections et
infestations. Lintrieur des murs sera aussi lisse que possible afin dviter linfestation
par les tiques et autres acariens et pour faciliter le nettoyage. Linstallation de cloisons
intrieures nest pas conseille car elle rduit la ventilation croise.

Le toit sera impermable et dbordera les murs dun bon mtre si les fentres ne sont
pas pourvues de volets. Le toit pourra tre fait en chaume, en feuilles mtalliques ou en
tuiles. Le chaume est gnralement loption la meilleure et procure la meilleure isolation.
Il devra probablement tre remplac tous les trois ans ou immdiatement aprs que les
tiques sy soient installes. Il sera entrelac avec du bambou ou des lamelles de bois afin
dempcher laccs aux prdateurs. Les feuilles de mtal sont dhabitude trop coteuses
et, dans les climats chauds, doivent tre peintes en blanc ou revtues daluminium afin de
rflchir la chaleur solaire. Elles sont cependant aisment nettoyes ce qui reprsente un
important avantage lorsque le problme de tiques se pose. Linstallation dune feuille de
36 Conduite Gnrale de Llevage

plastic entre les lamelles de bambou protge efficacement contre la pluie et la vermine.
Des fts dhuile dploys et aplatis peuvent tre utiliss moindre cot. Quoique
gnralement plus coteuses que le chaume, les tuiles sches au soleil ou au four durent
plus longtemps. Du fait du poids, la charpente dun toit en tuiles doit tre plus solide que
pour les autres options.

La structure des fentres dpend du climat local. Les poulets ont besoin de plus de
ventilation que les humains et doivent tre protgs du vent, de la poussire et de la pluie.
Pendant les orages, des volets de bambou ou de bois monts sur charnires ou des rideaux
fait de sacs daliment peuvent couvrir les ouvertures situes sur les cts du btiment
exposs au vent. Dans les climats humides, la conformation des fentres tiendra compte
autant que possible de la direction du vent, afin de rduire le taux dhumidit.
Louverture des fentres sera couverte de prfrence par du grillage ou du mtal dploy.
Des lamelles de bois ou de bambou peuvent galement tre utilises en fonction des
disponibilits. Toutefois, plus le matriau est pais, plus la ventilation sera contrarie. Les
portes seront faites de mtal, bois ou bambou. La moiti suprieure de la porte peut tre
en grillage. Les portes seront suffisamment rsistantes pour pouvoir tre ouvertes et
refermes de multiples reprises tout au long de lanne.

Les toits pignons diminuent la chaleur solaire par rapport aux toits plats ou aux toits
avec combles. Langle dinclinaison dun pignon est important pour plusieurs raisons.
Les toits villageois traditionnels de chaume pignon sont gnralement construits avec
du bois de brousse et prsentent une inclinaison trs importante de plus de 42, ce qui
permet au toit de rsister des vents temptueux. Des toits pignon moins inclins sont
plus sujets tre souffls par vents forts, particulirement si langle se situe entre 15 et
20. Les toits pignon aplati prsentent moins de surface, ce qui rduit le cot des
matriaux mais comme ils sont plus sensibles aux vents, ils ncessitent une infrastructure
plus solide ce qui, en dfinitive, rend leur prix plus lev. Un angle de 42 reprsente le
meilleur compromis entre le prix des matriaux de couverture et les matriaux de support.

La largeur maximale pour un poulailler pans ouverts, dans des conditions de brise
lgres, est de 8 mtres pour permettre le mouvement de lair travers le btiment la
hauteur de loiseau. Pour maximiser le volume et la vitesse de circulation de lair
travers la largeur du btiment, les murs terminaux seront aveugles. Ainsi, lair sera forc
de circuler latralement mme si le vent ne vient pas de ct. Une ventilation centrale
nest pas recommande car elle ne favorise pas un courant dair transversal. Lair pntre
du ct du vent dominant, est pouss vers le centre et sort par le fate, en ngligeant
lautre moiti du btiment.

Nids
Pour viter une concurrence excessive et rduire le nombre dufs pondus sur le sol, il
faut prvoir un nid pour cinq poules. Si lon utilise des nids communautaires plus
spacieux, un minimum dun mtre carr sera ncessaire pour 50 oiseaux. Des paniers,
pots ou botes en carton peuvent tre utiliss comme nids. Les dimensions ncessaires
pour un panier ou pot sont 25 cm de diamtre la base, 18 cm de hauteur, et 40 cm de
diamtre douverture au sommet. Les nids seront placs dans un endroit abrit, lombre,
garnis de litire frache et maintenue propres. Les nids individuels seront construits sous
forme de groupes multiples pour de plus grands effectifs de poules. Ils seront construits
Aviculture Familiale 37

habituellement en bois et mesureront 30cms dans toutes les dimensions, avec une surface
au sol denviron 0,1 m2.

Perchoirs
Pendant la nuit la volaille prfre se jucher sur des perchoirs, rf. Ketelaars, E.H.(Editor)
1990, CTA Agridok 4, p.17 Fig 10. Small Scale poultry production in the tropics). Une
longueur de perchoir de 15 20cm sera prvue pour chaque oiseau. Les oiseaux classs
infrieurement dans la hirarchie sociale pourront galement utiliser les perchoirs
pendant la journe. Chaque perchoir aura une section de 23cm. La longueur totale
dpendra du nombre doiseaux prsents. Les perches seront installes dans un
quadrilatre et alignes horizontalement et paralllement au mur, avec un plateau a
djection amovible situ 20cm en dessous. La premire ligne de perchoirs sera place
20 - 25cm du mur, les suivantes intervalle de 30 40cm. Le plateau djections
jouxtera le mur du fond et stendra 30cms au-del de la partie frontale des perchoirs, ce
qui permettra aux oiseaux deffectuer une pause lorsquils voudront slever du sol pour
se percher. Les plateaux djection seront situs une hauteur maximale de 75cm au-
dessus du sol et les perchoirs 20cm au-dessus des plateaux, afin de faciliter leur
nettoyage. Les volailles dposent plus de la moiti de leurs djections pendant la nuit et
lusage des plateaux djection facilite ainsi la propret du sol. Le fumier peut tre
facilement collect, sch et emball dans des sacs aliments vides avant dtre utilis
comme un excellent fertilisant azot organique pour les vgtaux. La surface situe sous
les plateaux peut, par la suite, tre idalement transforme en un nid communautaire.

Distribution daliment
Dans les systmes intensifs et semi-intensifs, les poules pondeuses doivent avoir accs en
permanence leau et la nourriture, et les mangeoires doivent tre rparties
uniformment travers le poulailler. Dans le systme semi-intensif, les volailles
vagabondent pendant la journe la recherche de leur nourriture, principalement la
recherche de protines (avec comme sources les insectes, les vers et les larves), minraux
(pierres, gravillons et coquillages) et vitamines (feuilles vertes, fruits de palme, noix)
tandis que les complments nergtiques, tels mas, sorgho et mil sont importants pour
une productivit plus leve et doivent tre distribus. Au chapitre 3 traitant des
Ressources Alimentaires, les composants et systmes de nutrition sont passs en revue.

Mangeoires-nourrisseurs
Un bon nourrisseur devra tre:
x suffisamment solide pour supporter un nettoyage rgulier;
x bien stable pour viter dtre renvers;
x de bonne hauteur et profondeur;
x a labri de lentre et du perchage des oiseaux;
x equip dun rebord pour empcher les oiseaux de rpandre la nourriture sur le sol.

La hauteur de la nourriture lintrieur du nourrisseur qui, jamais, ne sera rempli plus


quaux deux tiers, sera au niveau du garrot des oiseaux afin que ces derniers ne puissent
souiller les mangeoires avec de la litire contamine et afin de limiter le gaspillage de
nourriture. Ceci est ralis en ajustant la hauteur du nourrisseur. Afin dviter le
gaspillage et les problmes de moisissure, laliment sera distribu au lever du jour et aux
environs de 14 heures (ou plus frquemment ds que les mangeoires sont vides). Toute la
38 Conduite Gnrale de Llevage

nourriture doit tre consomme au coucher du soleil. Les mangeoires peuvent tre
fabriques en bois, feuille de mtal ou bambou. Il est meilleur de les suspendre au toit
afin dcarter les rats. La hauteur du nourrisseur sera ajustable. Un complment de
verdure sera fourni hauteur du bec, soit en le suspendant au plafond soit en le dposant
dans un filet ou une trmie dispose sur le sol dont les cts sont en grillage ou en
lamelles. Il ne sera pas jet sur le sol.

Lespace de mangeoire se dfinit comme la distance linaire de rebord disponible par


oiseau. Ceci est reprsent soit par la circonfrence du plateau circulaire dun nourrisseur
tubulaire, soit par deux fois la longueur dune mangeoire linaire double accs. Si cette
dernire est utilise, un espace de 10cms sera accessible chaque oiseau. Pour les
nourrisseurs circulaires, 4cms sont requis au minimum.

Tableau 4.3 Besoins en nourriture et en espace mangeoire pour 100 poulets


_______________________________________________________________________
Age Consommation Profondeur de Espace
(semaines) journalire (kg) mangeoire suggre (cm) mangeoire (m)
_______________________________________________________________________
1-4 1.4 - 5.0 5 2.5
4-6 3.2 - 7.3 8 3.8
6-9 5.0 - 9.5 9 6.1
10 -14 7.3 - 15.9 12.5 9.6
15 et plus 9.1 - 11.4 15 12.7
_______________________________________________________________________

Creep feeders
Ce type de nourrisseur permet aux poussins davoir accs (en rampant [creeping] par un
petit orifice) un aliment de haute qualit (nergie et protines) alors que les oiseaux de
plus grande taille, spcialement les mres, ne peuvent y accder. Ce dispositif en forme
de cne tronqu (ouvert au sommet et la base) peut tre fabriqu en tiges de bambou de
0,5 1 cm de large, attaches par du fil de fer ou de la corde. Le nourrisseur a un
diamtre de 75 cm la base, et une hauteur de 70 cm. Il a une ouverture daccs de 20 cm
au sommet, qui est renforce de faon former une anse pour le transport. Les espaces
entre les lamelles sont de 2-3 cm la base et denviron 1 cm. au sommet. La flexibilit
des tiges de bambou permet dlargir les espaces dentre au fur et mesure de la
croissance des poussins. Si les poussins rechignent quitter leur mre, une tresse plus
paisse les empche de sortir ds quon les introduit dans le dispositif par louverture
suprieure. Le bambou peut tre protg des insectes par un enduit ou de lhuile de
vidange usage.

Une meilleure nutrition des jeunes renforce leur rponse immunitaire face aux maladies
ou aprs la vaccination en dveloppant une rsistance intgrale. Gunaratne et al (1994b)
ont not que les taux de mortalit des poussins taient rduits par lemploi de ce type de
nourrisseur mais que leur croissance ntait pas amliore. Toutefois, si les dchets
mnagers habituellement distribus taient supplments en protines, on constatait la
fois une amlioration de la croissance et du taux de survie des poussins (Roberts, 1994).
Aviculture Familiale 39

Le tableau 4.4 dmontre que la ponte annuelle peut tre double du fait de
laugmentation de temps disponible pour les poules pondeuses lorsque les poussins sont
disposs dans un creep feeder aprs lclosion (Pratseyo, Subiharta and Sabrani, 1985).
Si les espaces dans le nourrisseur sont ajusts, il peut galement tre utilis par les sujets
en croissance au-del de huit semaines. Sils ne reoivent pas une ration complte, ils
vont apprendre rivaliser pour la nourriture avec leurs congnres.

Tableau 4.4 Effets du creep feeding sur la production en ufs du troupeau


_______________________________________________________________________
Systme utilis Priode
_______________________________________________________________________
juin juillet aot sept. oct. nov.
Seulement creep 31.5 28.7 27.3 21.8 21.4 33.0
Creep +
Supplment pauvre 21.2 18.8 22.9 26.9 30.7 31.1
Creep +
Supplment riche 24.3 24.5 32.5 34.1 27.4 31.1
_______________________________________________________________________
Source: Gunaratne et al, 1993.

Distribution deau
La fourniture deau propre reprsente une priorit souvent nglige. La quantit deau, le
type adquat dquipement et son emplacement sont dimportants facteurs. Le tableau 4.5
indique les taux de consommation deau en conditions chaudes et sches. Les quantits
peuvent tre divises par moiti en rgions tempres.

Tableau 4.5 Quantits deau minimales et espace dabreuvement pour 100 oiseaux en
conditions chaudes et sches.
_______________________________________________________________________
Age (semaines) Consommation journalire Espace
(litre) dabreuvement (m)
_______________________________________________________________________
0-1 3 0.7
2-4 10 1.0
4-9 20 1.5
9 et plus 25 2.0
Pondeuse 50 2.5
_______________________________________________________________________

Dans les pays o les ressources en eau sont importantes, comme le Bangladesh, le
Vietnam, lIndonsie, la Gambie, la Sierra Leone, le Congo ou lOuganda, le facteur
prioritaire est la propret de celle-ci. Dans dautres rgions, spcialement au Sahel et
dautres pays secs, rcolter et transporter leau reprsente une tche cruciale,
gnralement dvolue aux femmes et aux enfants. En saison des pluies, leau propre et la
nourriture doivent tre distribues lintrieur du btiment, car les poules couveuses sont
40 Conduite Gnrale de Llevage

confines afin dviter une faible closabilit rsultant de la contamination par la boue et
la salet.

Lquipement le plus simple consiste en une bote de conserve renverse sur une
assiette soupe ou sur le fond dune bote conserve plus large. Un trou est perc
environ 2 cm au-dessus de fond ouvert de la bote. Celle-ci est remplie deau, recouverte
par lassiette et rapidement retourne. La position du trou et le vide produit dans la bote
vont rgulariser le niveau de leau dans lassiette. Cet abreuvoir rustique fonctionne bien
mais se rouille assez vite, surtout en rgions tropicales humides. Un canari dargile ou
une gourde percs de trous sur les cts et enfoncs dans le sol fin de stabilit peuvent
tre utiliss comme abreuvoirs pour oiseaux adultes. Des pots dargile de toutes
dimensions peuvent tre commands auprs des potiers locaux. Du fait de leur
permabilit, ils refroidissent leau dun demi degr Celsius par rapport aux autres
abreuvoirs, du fait de la chaleur perdue par vaporation. Ceci suppose galement une
perte apprciable deau au cours du temps, spcialement dans les rgions chaudes et
sches. De sorte quil est conseill de vernir les pots pour les impermabiliser. Si des
abreuvoirs permanents sont utiliss, il faut prvoir 5 cm despace par oiseau.
Alternativement, en cas dutilisation dabreuvoirs sucette ou coupelles, il faut prvoir une
unit par 10 oiseaux.

CONDUITE DES POUSSINS 1er GE

Les jeunes poussins doivent tre gards au chaud et au sec. Le nid quils partagent la nuit
avec leur mre doit rester propre. Dans les climats froids (moins de 20C. pendant la
nuit), le nid doit rester tide; on le remplira de paille et on le maintiendra prs dune
source de chaleur. Les poussins resteront prs de leur mre pendant neuf dix semaines
afin dapprendre rechercher leur nourriture et se mettre labri des prdateurs et
autres dangers potentiels. Une eau de boisson claire et un aliment frais distribu dans un
rcipient propre seront fournis en supplment du picorage. Voir chapitre 3 Ressources
alimentaires pour plus de dtails. Il existe une relation troite entre le poids du poussin
et les taux de croissance et de mortalit. Dans un essai conduit sur lutilisation du creep
feeder pour supplmenter les jeunes poussins (Roberts et al, 1994), il a t dmontr
quun complment protique avait un effet significatif sur les taux de croissance et de
mortalit. Les poussins spars de leur mre pendant la journe entre trois et dix semaines
et complments avec un aliment dmarrage poussin ad libitum, prsentaient un taux de
mortalit de 20 pour cent et un poids vif de 319 g dix semaines, compars 30 pour
cent et 242 g pour les sujets du groupe de contrle qui demeuraient avec leurs mres en
permanence. Voir plus de dtails ci-dessus dans la section consacre la technique du
creep feeding. En consquence, une stratgie approprie dlevage des poussins
pourrait se dfinir comme suit:

x Les poussins seront confins pendant les premires semaines et nourris avec un
aliment quilibr;
x Un programme de vaccination sera pratiqu;
x Un supplment alimentaire sera distribu en suffisance pendant la priode
dlevage restant courir afin de permettre aux poussins dextrioriser leur
potentiel gntique;
Aviculture Familiale 41

x Des complments alimentaires et une protection approprie seront procurs aux


poussins couvs naturellement pendant les quatre huit premires semaines.

La composition du complment alimentaire dpendra des ressources picorables


disponibles. Cependant un systme caftria de libre choix fournissant protines, nergie
et calcium dans trois rcipients diffrents peut reprsenter la solution de choix.

Le taux de mortalit des poussins couvs naturellement dont la seule source de


nourriture est reprsente par le picorage en divagation est trs lev et dpasse souvent
plus de 50 pour cent jusqu lge de huit semaines. Wickramenratne et al (1994) notent
que les prdateurs interviennent pour 88 pour cent de la mortalit avec un taux de
survivance plus lev pour les sujets colors. Le taux de mortalit lev et le grand
nombre dufs requis pour lincubation reprsentent les causes principales du faible taux
de prlvement observ dans les effectifs de volailles en systme de divagation. Smith
(1990) rapporte un taux de prlvement (vente et consommation) de seulement 0,3 poulet
(te) par poule/an dans une enqute effectue au Nigria. Ce faible taux a galement t
constat en Inde et au Bangladesh.

Un moyen efficace de rduire ce taux de mortalit est denfermer et de vacciner les


poussins pendant la priode dlevage. Cependant, ceci reprsente galement une
mthode coteuse car le cot de laliment augmente fortement les cots de production.
Une mthode utilise pendant les dix dernires annes dans plusieurs projets de
dveloppement avicole au Bangladesh comporte le confinement des poussins pendant les
huit premires semaines de vie. Il leur est distribu environ 2kg daliment quilibr
pendant cette priode. Ils sont ensuite levs en conditions de semi-libert. A huit
semaines, ils sont moins susceptibles aux attaques des prdateurs et plus rsistants aux
maladies, du fait de leur poids corporel plus important et de leur immunisation vaccinale
plus efficace, lie leur meilleure conversion alimentaire.

HYGINE

Traitement du fumier
Quel que soit le type de confinement, une attention correcte sera apporte au traitement
du fumier. Une volaille adulte produit 500g de fumier frais 70% dhumidit par an
et par Kg de poids vif. Pour prserver son pouvoir fertilisant, le fumier sera sch avant
stockage afin de rduire son taux dhumidit 1012 pour cent. Ceci permettra de
prserver le maximum dazote car celui-ci sous forme dure est le compos le plus
volatil du fumier et schappe sous forme dammoniaque si lhumidit des djections est
trop leve. Dans ce cas de figure, le fumier laisse chapper de lammoniaque, du
dioxyde de carbone, de lhydrogne sulfur et du mthane, tous produits pouvant affecter
la sant humaine. Certains de ces composants interviennent galement dans leffet de
serre et contribuent ainsi au rchauffement du climat ambiant. Le fumier de volaille se
rvle un excellent fertilisant organique, un bon aliment pour llevage et la pisciculture
et un combustible de choix pour la production mnagre de biogaz.
42 Conduite Gnrale de Llevage

Autres mesures dhygine


Une bonne ventilation empche la dissmination des maladies et infections. Dans les
abris de nuit, la fourniture de perches ou de nattes de bambou lchement tresses telles
celles utilises comme tamis - permettent de garder le sol sec.

Si les oiseaux sont gards lintrieur, le sol sera nettoy quotidiennement. Un abri
pour volailles devra tre nettoy chaque semaine afin de rompre le cycle de reproduction
de la mouche domestique. Celui-ci demande sept jours depuis la ponte jusqu la
mtamorphose adulte. De la cendre de bois ou du sable vers sur le sol empche la
multiplication des poux. Les boules de naphtaline mlanges de la cendre peuvent
galement tre dposes sur les plumes ou les ailes des oiseaux ou incorpores dans les
bains de poussire. Si les oiseaux sont dj infests, il convient denfumer le logement
(aprs avoir sorti les animaux) au moyen dun chiffon port combustion dans du
ptrole. Les poux survivent sur les oiseaux, et les bains de poussire avec de la naphtaline
mlange de la cendre sont ainsi plus efficaces que la poussire seule.

Elever ensemble poulets et canards nest pas recommand. Cela entrane


lhumidification des sols, qui peut dvelopper certaines maladies comme le cholra
aviaire. Les canards sont galement beaucoup plus tolrants la maladie de Newcastle
que les poulets, et, de ce fait, souvent porteurs du virus. Adultes et jeunes de toutes
espces seront logs sparment afin dviter des infections croises ainsi que les
blessures par agression.

CONDUITE DE LLEVAGE EN LIBERT

La conduite de la volaille en systme de libert reprsente souvent un problme. Elle


divague souvent dans les terrains et les jardins voisins, et est constamment en danger face
aux prdateurs. La claustration nest souvent pas pratique, vu le prix de la nourriture et
des cltures, tandis que la surveillance nest possible que si des membres de la famille
trs gs ou trs jeunes disposent de temps libre cet effet. Clturer les potagers
reprsente dans beaucoup de cas la meilleure option. Introduire plus de coqs au niveau du
village peut rduire les mouvements de volailles, car les poules et coqs dune mme
bande sont plus attachs leur propre territoire. Les coqs bougent dans une zone de dix
douze maisons, les poules entre deux ou trois habitations.

Dans le systme en libert, la diffrence enregistre entre la quantit de nourriture


rcolte par picorage et celle ncessaire une production maximale sera rquilibre par
un aliment complmentaire. Pour prparer celui-ci, il convient de connatre en pralable
la B.A.R.P. et la composition du contenu des jabots. (voir Chapitre.3). Si cette dernire
nest pas quantifie, il est recommand que la volaille ait accs par un systme caftria
de libre choix trois rcipients (ou trois compartiments dun nourrisseur en bambou)
contenant un concentr protique, une source dhydrates de carbone (nergie) et une
source minrale (principalement pour le carbonate de calcium ncessaire la coquille de
luf). La volaille aura libre accs ce dispositif pendant deux ou trois heures durant la
soire afin de complter le picorage diurne.

Du point de vue des ressources alimentaires, cette recommandation nest seulement


conomiquement rentable que si la consommation daliment complmentaire nexcde
Aviculture Familiale 43

pas 180 g par uf produit. Une consommation dpassant 150 g ne se justifie que si cet
aliment est moins cher que celui trouv dans le commerce utilis en aviculture intensive.
En gnral, les complments de ce type sont utiliss raison de 50 80g par jour et par
oiseau, ce qui les rend rentables. Les variations saisonnires de la BARP. ont un effet
substantiel sur la production. Pendant la saison sche, la nourriture picore dans les
jardins, les cultures cralires et les terrains vagues samenuise alors que la qualit et la
quantit de dchets mnagers se rduisent. Le complment alimentaire devrait ainsi tre
ajust selon la saison afin de maintenir une production optimale ou, alternativement, la
population de volailles devra tre ajuste au montant de la BARP et au complment
alimentaire.

Les poules en claustration nourries avec un aliment quilibr ont un taux de conversion
habituel de 2,8 soit 2,8 grammes par gramme duf produit.

Des changements uniquement dans le mode dlevage peuvent accrotre la productivit


des volailles villageoises picoreuses, sans ncessit dintrants supplmentaires. Dans un
verger, une densit de 120 180 oiseaux/ha va la fois nettoyer les fruits tombs par le
vent et fertiliser les arbres. Dans cet exemple, la quantit de fertilisant produite lhectare
par 150 poules de 2 kg se calcule sur la base de 500 g de fumier frais 70 pour cent
dhumidit produit annuellement par kg de poids vif. Ceci correspond 330 g de fumier
sec 10 pour cent dhumidit par poule et par an. Les 150 poules produiront ainsi 49,5 kg
de fumier sec annuellement. La valeur fertilisante quivaut un engrais 13 pour cent de
nitrate dammonium, 8,6 pour cent de superphosphate et 2,9 pour cent de potasse. Les
150 poules produiront donc lquivalent de 6,4kg de nitrate dammonium, de 4,3 kg de
superphosphate et de 1,4 kg de potasse par hectare et par an.

Planification de la production et de la taille du troupeau


Les productions avicoles sont reprsentes par la viande et les ufs. Pour chacune dentre
elles, le nombre de sujets reprsente le facteur le plus important. La configuration du
troupeau change constamment en fonction de lclosion des ufs et de la vente ou de la
consommation de poules. La cause la plus importante de la rduction du troupeau est la
mortalit, particulirement chez les poussins. La maladie reprsente le facteur de
mortalit le plus courant, spcialement pendant la saison des pluies ainsi quaux priodes
de forte humidit caractrisant les changements de saison. Durant lt, tout comme en
saison des pluies, les prdateurs contribuent galement rduire la taille des troupeaux
dans les terrains cultivs. Les races locales produisent en moyenne 3 ou 4 couves de 12
15 ufs par an, dont la majorit en priode de rcoltes du fait dune plus grande
disponibilit en nourriture. Dans la plupart des systmes fermiers traditionnels, il est
ncessaire pour maintenir un effectif constant de garder 8 10 ufs pour la reproduction
ce qui laisse en moyenne 35 40 ufs pour la vente ou la consommation. Du fait quavec
une meilleure conduite de llevage, le nombre dufs ncessaire au remplacement va
diminuer, il en rsultera un surcrot dufs pouvant tre vendu ou mang.

La majorit des ufs sont pondus pendant la premire moiti de la matine. Pendant les
mois de ponte, la situation du nid ne sera pas modifie, car cela pourrait perturber les
habitudes de ponte.
44 Conduite Gnrale de Llevage

Dans les troupeaux villageois, le revenu provient de la vente dufs et doiseaux


vivants. A titre dexemple, un troupeau dun coq et de 15 poules pondant chacune 30
ufs par an, produisent 450 ufs. 120 de ceux-ci seront incubs en 10 couves de 12
ufs. 100 poussins peuvent clore et 30 ufs fls peuvent tre consomms, ce qui
laisse 300 ufs pour la vente. Parmi les 100 poussins dun jour, 30 peuvent atteindre la
maturit (70 pour cent de pertes) dont 15 poulettes et 15 coquelets. Les 15 poulettes
remplaceront les vieilles poules, dont 10 seront rformes et vendues de mme que le coq
qui sera remplac par un coquelet. Le revenu annuel sera donc:

300 ufs + 10 poules de rformes + un coq de rforme + 14 coquelets.

Pour amliorer la productivit, une rforme rationnelle est importante et les oiseaux les
plus productifs seront soigneusement slectionns. Pour raison de simplicit, lexemple
ci-dessus ne prvoit pas de mortalit adulte.

TUDES DE CAS DE CONDUITE DAVICULTURE FAMILIALE

Systme en libert au Ghana


Dans ce systme en libert traditionnel pratiqu par la tribu Mamprusi au nord du Ghana
(van Veluw, 1987), le fermier relche chaque matin ses 19 poules et six pintades de
lespace amnag sous le grenier grains. Des grains sont jets au sol pour nourrir les
oiseaux. Pendant la journe, un jeune garon prend soin de ceux-ci et protge les cultures
de leur divagation. Eventuellement, le garon distribuera un morceau de termitire et le
soir, aprs avoir ramen le troupeau, il lenfermera sous le grenier.

Les poules pondent tout au long de lanne, les pintades seulement en saison des pluies.
Les poules produisent 20 40 ufs par an et les pintades 50. La plupart des ufs sont
destins lincubation. Comme les pintades ne sont pas bonnes mres, ce sont les poules
qui couvent leurs ufs. La couvaison se poursuit tout au long de lanne quoique la
majorit des poules couvent plutt en saison pluvieuse. Un cycle de reproduction (ponte,
couvaison, closion, soin des poussins et repos) dure environ 20 semaines. La mortalit
des jeunes poussins est leve et avoisine les 75 pour cent. Elle est due principalement
aux maladies, prdateurs et accidents de la route. Deux poussins seulement sur dix
atteignent lge adulte. La maladie de Newcastle dcime une grande partie des volailles
en saison sche. Les vers, parasites internes, reprsentent un grave problme car ils
affaiblissent les oiseaux. Les prdateurs comprennent les serpents, les oiseaux de proie,
les chats et les chiens. La mortalit jusqu deux mois est de 50 pour cent, avec 25 pour
cent supplmentaires avant la maturit sexuelle.

Lclosabilit des ufs de pintades est trs faible (45 pour cent) compare celle des
poules (72 pour cent). Les fermiers gardent leurs pintades jusqu deux ans. La
productivit dcrot ensuite considrablement et les animaux sont rforms.
Aviculture Familiale 45

Tableau 4.6 Production totale annuelle dun troupeau avicole Mamprusi


________________________________________________________________________
Poules Pintades Production totale
________________________________________________________________________
Troupeau Production Troupeau Production
_______________________________________________________________________
Coqs 3 1 2 1 2
Poules 9 3 4 2 5
Coquelets 2 22 - - 35
Poulettes 5 19 - 13 30
ufs /femelles - 45(20) - 65(50) 110(380)
________________________________________________________________________

Poules pondeuses hybrides commerciales en divagation au Sri-Lanka


Dans une tude mene par Roberts et Senarathe (1992), les villageois srilankais ont lev
des poules pondeuses de souche hybride dans un systme de semidivagation. Les
poussins dun jour taient levs la chaleur dune petite lampe au krosne. Les
poussins taient livrs avec un peu daliment compos base de sous-produits locaux,
comprenant 40 pour cent de polissures de riz, 50 pour cent de farine de tourteau de
coprah, et 10 pour cent de brisures de riz. Lanalyse chimique de ce complment rvlait
16 pour cent de protine brute, 8 pour cent de matire grasse, 7 pour cent de fibre brute et
7 pour cent de cendres.

La quantit de complment distribu sest lev de 8 60 g/oiseau/jour de 0 12


semaines pour stablir ensuite 60 grammes journaliers. Le gain de crot quotidien
moyen tait de 38g jusqu 20 semaines et le taux de mortalit seulement de 4 pour cent,
compar 68 pour cent jusqu 6 semaines en Indonsie (Kingston et Kreswell, 1982) et
25 pour cent jusqu 8 semaines en Thalande (Thitisak et al, 1989) chez des poussins
couvs et levs par des poules villageoises. Lavantage comparatif du systme srilankais
a t attribu la complmentation alimentaire et la protection contre les prdateurs,
fournies dans le systme semiintensif. Il est probable que les poussins ont galement
profit dun systme simple de creepfeeding pour la distribution des restes de cuisine.
Dans lexemple srilankais, le taux de mortalit sest accru aprs le huitime mois et a
atteint prs de 60 pour cent de pertes cumules 12 mois. Ceci est peut-tre du au fait
dune plus grande propension des animaux vagabonder la recherche de leur
nourriture. Parmi les 142 pertes enregistres 13 mois, des donnes ont t rcoltes pour
92 sujets. Les causes de mortalit furent:
x 32% prdateurs (chiens, chats, mangoustes, putois, serpents);
x 26% disparitions;
x 15% maladie de Newcastle;
x 15% infection intestinale;
x 5% vols;
x 4% accidents (vhicules, chutes de noix de coco);
x 2% agressions humaines.

Les poules pondent leurs premiers ufs lge de 21 semaines (146 jours), quoique 40
pour cent de la production (sur la base poule/jour) ne soient pas atteints avant 30
46 Conduite Gnrale de Llevage

semaines. Le pic de production a dpass de peu les 60 pour cent. Une chute svre de la
production, qui a dbut au moment o les poules atteignaient huit mois, a concid avec
un pisode de maladie de Newcastle sur les volailles locales villageoises et le dbut de la
longue priode dinter- mousson. La production a chut jusqu moins de 30 pour cent
alors que les poules avaient 10 mois et a progressivement remont jusqu plus de 60
pour cent 13 mois. La rcupration de la production a dbut en saison sche et sest
maintenue jusqu la saison suivante. La production dufs sest rvle comparable
celle de pondeuses de souches hybrides, introduites sous forme de poulettes, avec
fourniture dun supplment alimentaire et autorises picorer.

La production tait nettement meilleure que les 12 21 pour cent enregistrs dans les
volailles villageoises indonsiennes (Kingston and Creswell, 1982) et thalandaises
(Janviriyasopaki et al, 1989) and (Creswell and Gunawane, 1982). Le poids des ufs
enregistr par Roberts et Senaratne (1992) tait de 60 g, compar aux 40 g des volailles
villageoises. (Kinston et Crerswell, 1982)

Systme en libert au Sngal


Dans une tude mene en milieu fermier au Sngal (Sall,1990), la taille des troupeaux a
vari de 5 plus de 15 oiseaux, avec une moyenne de 10 sujets. 7 pour cent des effectifs
taient infrieurs 10 oiseaux, 41 pour cent entre 10 15 et 14 pour cent, plus de 15
animaux,

Les troupeaux de moins de 5 sujets avaient rcemment enregistr des pertes ou


comprenaient des poules qui navaient pas fini de couver leurs ufs. La taille a vari
considrablement au long de lanne soit positivement (closions, achats et dons) soit par
ventes ou pertes de poussins par maladie ou prdateurs. Les oiseaux taient autoriss
divaguer pendant la journe et, pendant la nuit, taient enferms dans des cages de bois
(ngounou) labri des prdateurs. Ces cages taient fabriques la ferme partir de
matriaux disponibles (briques, feuilles de fer galvanis et bois). Les portes du local
taient troites pour empcher laccs aux voleurs et prdateurs. La densit des cages
tait de 25 oiseaux /m2. Nourriture et eau taient distribus dans de vieilles casseroles,
des calebasses brches, des plats et des pots, afin de supplmenter dchets de cuisine et
picorage.

La proportion du troupeau en jeunes poussins et en sujets en croissance tait de 60 pour


cent, les adultes reprsentant 40 pour cent. La mortalit au cours du premier mois tait de
40 pour cent. Quatre cinq couves taient produites annuellement avec une moyenne de
8 15 ufs par couve. Le poids des ufs se rangeait entre 38 et 43 grammes avec une
moyenne de 40 g. Tous les ufs taient mis lincubation, avec une closabilit de 80
pour cent. Ce cycle de production stalait sur huit dix semaines (10 15 jours pour la
ponte, 21 jours pour lincubation, et seulement 34 jours pour llevage des jeunes). Les
poussins restaient prs de leur mre pendant les deux premires semaines avec un taux de
mortalit relativement faible de 14 pour cent. Ds quils quittaient la protection
rapproche de leur mre, la mortalit saccroissait critiquement jusqu 40 pour cent entre
trois et quatre semaines et jusqu 66 pour cent trois mois. De mme, le gain quotidien
moyen enregistr dans ce systme extensif diminuait de 10 g huit semaines 6 g 12
semaines.
Aviculture Familiale 47

Tableau 4.7 Structure du troupeau villageois dans le cas du Sngal (Sall, 1990)
_______________________________________________________________________
Age Nombre Males Nombre Femelles N Total %
(mois)
_______________________________________________________________________
0- 1 - - - - 320 50.5
1- 3 - - - - 99 15.6
3- 6 34 5.4 84 13.3 118 18.6
6- 8 2 0.3 21 3.3 23 3.6
8 - 10 1 0.2 19 2.9 20 3.2
10 + 15 2.4 39 6.2 54 8.5
Total 52 8.3 163 25.6 634 100
_______________________________________________________________________

Tableau 4.8 Mortalit lie lge chez les volailles locales au Sngal
_______________________________________________________________________
Age (Semaines) % Mortalit (cumulative)
_______________________________________________________________________
13 +/- 5
15 +/- 9
39 +/-20
42 +/-20
49 +/-20
66 +/-17
_______________________________________________________________________
Source: Sall, 1990. p.37

Tableau 4.9 Poids corporel des volailles locales au Sngal


_______________________________________________________________________
Age Nombre Mles Nombre Femelles Nombre Mles Femelles
_______________________________________________________________________
1 semaine - - - - 81 34+/- 5
2 semaines - - - - 75 58+/- 10
3 semaines - - - - 66 101+/- 43
1 mois - - - - 98 171+/- 70
2 mois - - - - 41 464+/-242
3 mois - - - - 58 631+/-211
4 mois 29 975+/- 20 63 746+/-170 92 860
6 mois 5 1380+/-150 21 1229+/-165 26 1305
8 mois 2 1826+/- 75 21 1264+/-183 23 1544
10 mois 1 1500 19 1245+/-150 20 1372
+1 an 15 1803+/- 4 39 1350+/-223 54 1577
_______________________________________________________________________
Source: Sall, 1990.
Chapitre 5
INCUBATION ET CLOSION

INCUBATION NATURELLE

La poule choisie pour la couvaison devra tre massive (afin de couvrir et de garder au
chaud un grand nombre dufs), en bonne sant, vaccine de prfrence, et rpute pour
son instinct maternel et ses qualits de couveuse. Ces dernires se manifestent par larrt
de la ponte, le dploiement des ailes et lmission dun gloussement distinctif. La
couvaison peut tre induite avec des ufs factices ou mme des pierres.

Les ufs deviennent habituellement fertiles environ quatre jours aprs quun jeune
coq a t introduit auprs des poules. Un maximum de 14 16 ufs peut tre couv la
fois dans un nid mais, souvent, lclosabilit diminue au-del de dix ufs. Ceci en
relation avec la taille de la poule. Eau et nourriture fournies proximit immdiate de la
poule permettront celle-ci de se maintenir en bonne condition ainsi que de rduire la
mortalit embryonnaire lie au refroidissement des ufs, lorsque la poule doit quitter le
nid pour partir la recherche de sa nourriture.

La poule maintient les ufs un degr dhumidit satisfaisant en les aspergeant deau
par le bec. Ceci reprsente une raison de plus pour lui fournir un accs facile leau.
Dans les rgions trs sches, un sol lgrement humide peut tre dispos sous le nid afin
daider la poule maintenir un degr dhumidit appropri (entre 60 80%). Les ufs
fertiles provenant dautres espces seront places sous la poule couveuse entre un et
quatre jours aprs le dbut de la couvaison. Au Bangladesh, il a t rapport que les
poules couveuses locales peuvent mme sasseoir et redmarrer une seconde couve,
tout en perdant un poids considrable dans cette opration (spcialement sil nest pas
accord suffisamment dattention la fourniture deau et daliment).

Pour les poules, la priode dincubation est de 20 21 jours; elle augmente jusqu 30
jours pour les autres espces de volailles. Aprs avoir couv pendant quelques jours, il
est possible de donner la poule quelques poussins frachement clos; si elle les
accepte, les ufs dorigine seront retirs et remplacs par dautres poussins. Il est ainsi
possible dutiliser au mieux les poules slectionnes pour leur bon instinct maternel.

Au dbut, les ufs ont besoin dun contrle strict de la temprature optimale qui se
situe 38C, du fait de la taille microscopique de lembryon. Lorsque ce dernier
saccrot en taille spcialement aprs le 18me jour sa production de chaleur
augmente et il est mme ncessaire de le refroidir. Des niveaux dhumidit relative de
60 80% (saccroissant au cours de la priode dincubation) sont importants pour viter
les pertes de liquide partir du contenu de luf travers ses membranes et sa coquille
poreuse. Pour une incubation naturelle russie, les facteurs suivants seront pris en
considration:
x Eau et nourriture se trouveront proximit de la poule;
x La poule couveuse sera examine afin de sassurer quelle nabrite pas de
parasites externes;
Aviculture Familiale 49

x Les ufs seront stocks pour lincubation une temprature de 12 14C, un


taux dhumidit relative lev de 75 85% pendant une priode nexcdant pas 7
jours;
x Des ufs fertiles supplmentaires ne seront introduits sous la poule qu la nuit
tombe;
x Aprs une semaine, les ufs seront mirs pour en tester la fertilit. Le procd
consiste les regarder par transparence devant une source lumineuse brillante (le
meilleur systme est le mire-ufs voir fig.7.8 p.158 dans Smith (1990) et photo).
Sil apparat une forme sombre lintrieur de luf (embryon en
dveloppement), cest que celui-ci est fertile. Un uf compltement clair est
infertile.

Une closabilit de 80 pour cent est normale en couvaison naturelle; toutefois un taux
de 75 80 pour cent est considr comme satisfaisant. Le dmarrage de la couvaison
sera programm afin que les poussins clos atteignent lge de deux mois lors des
changements majeurs de saison, tels le dbut de la saison pluvieuse (ou sche) ou de
lhiver (t). Une quantit abondante daliment complmentaire pendant la priode de
croissance offrira de meilleures chances de survie au poussin. En fait, les volailles
pondent et couvent instinctivement leurs ufs une priode de lanne qui permettra
aux poussins clos davoir accs des sources riches en protines et nergie dans leur
environnement. Par exemple, la pintade pond uniquement en saison des pluies avec,
cependant, le risque inhrent que les changements de climat sont galement facteurs de
risques de maladies.

INCUBATION ARTIFICIELLE (TECHNIQUES BASE DE RIZ PADDY


CHAUFF OU DE BALLES DE RIZ)

Il existe dans le commerce de nombreux incubateurs de diverses capacits. La plupart


fonctionne llectricit, mais certains dentre eux peuvent tre chauffs au gaz ou au
ptrole. Ils disposent dun thermostat permettant de maintenir la temprature constante
dans une fourchette de un degr Celsius. Le taux dhumidit appropri est gnralement
maintenu en fournissant une quantit dtermine deau proportionnelle au volume de la
chambre de lincubateur.

Le retournement des ufs plusieurs fois par jour est important car il empche
lembryon de se coller aux membranes de luf. Dans les systmes de retournement la
main, il est prvu un nombre impair de rotations par jour (cinq sept fois) de sorte que
luf soit toujours orient en direction oppose celle de la nuit prcdente.

La poule couveuse effectue toutes ces tches instinctivement et lincubation


artificielle essaye de les reproduire. Dans plusieurs parties du monde, des techniques
traditionnelles dincubation artificielle se sont dveloppes pendant plusieurs milliers
dannes. Lune dentre elles, primitivement initie en Chine pour lincubation des ufs
de cane, est la technique du riz chauff. Elle est base sur lemploi de riz paddy grill, et
la chaleur gnre par lembryon. Elle est toujours utilise en Chine et Bali, Indonsie,
avec une closabilit allant jusqu 80% (Smith, 1990). Ses objectifs sont atteints aussi
bien en utilisant du riz chauff ou des balles de riz, avec une closabilit quivalente de
65 75 pour cent. En mirant les ufs entre le 5me et le 7me jour, il est possible de
50 Incubation et Eclosion

dtecter les ufs clairs infertiles qui restent consommables pour lhomme et ce qui
amliore la rentabilit du systme.

Comme les coquilles dufs de cane sont moins fragiles que celles des ufs de poule,
le systme na jamais t utilis en Chine pour ces derniers. Le systme chinois original
utilisait 80 ufs de cane par lot. En utilisant 25 30 ufs de poule par lot et en les
manipulant soigneusement, le systme a t expriment avec succs au Bangladesh,
lorsquil a t adapt dans les annes 1980. De mme, le nombre dufs de cane a t
rduit 40 par lot ce qui a procur de meilleurs rsultats dclosion et moins de flures.

Le procd dmarre par un prchauffage des ufs, soit au soleil, soit dans une
chambre isole quipe dune source de chaleur. Par jours ensoleills, environ 25 30
ufs de poule ou 40 ufs de cane (supposs fertiles et soigneusement dats et marqus)
sont placs au soleil sur des morceaux de tissus capitonns pendant environ 30 minutes
et tourns de temps en temps afin daugmenter la temprature des ufs jusquaux 37
38C requis. Cette temprature peut tre estime par lapparition de gouttelettes deau
sur la coquille ou en appuyant luf sur la paupire. Les jours sans soleil, les ufs
doivent tre placs sur un tissu dans un panier de bambou peu profond et rangs sur des
tagres dans une chambre chauffe afin datteindre doucement la mme temprature.
Ceci requiert environ une trois heures. Nimporte quel combustible lent est utilisable;
le ptrole et le charbon de bois sont communment employs. En Egypte, des tiges de
haricot sches ont t utilises pendant des milliers dannes pour leurs proprits de
combustion ralentie et sont encore employes aujourdhui dans le district de Fayoumi
(do est originaire la race de poule bien connue du mme nom). Le foyer doit tre bien
ventil afin dviter toute fume toxique pour lembryon. Au Bangladesh, les ufs sont
recouverts avec du sable ou de la cendre de bois, lgrement chauffs 38C, ce qui se
rvle galement efficace. La sensibilit des paupires la temprature peut sacqurir
par entranement, en utilisant des thermomtres cliniques pour homme, facilement
disponibles lheure actuelle. Si lhumidit chute en - dessous de 70%, 60%, 50% ou
mme 40% (particulirement pendant les mois les plus secs), un tissu humide et
lgrement chauff sera plac sur les ufs une frquence correspondant aux taux
indiqus ci-dessus de une, deux, quatre ou six fois par jour. Ceci augmentera lhumidit
de luf et prviendra le desschement de lembryon.

Le riz dcortiqu (paddy) est chauff et continuellement remu jusqu ce quil


atteigne une temprature de 60C, afin de produire la chaleur ncessaire aux deux
premires semaines dincubation. Environ 2,5 3,0 kg de ce riz chauff sont introduits
dans un coussin de tissu et placs dans le panier ufs. Les coussins sont de mme
diamtre (40cm dans lexemple du Bangladesh) que le panier avec une paisseur de 8
cms. Si lon utilise des balles de riz, les coussins peuvent tre confectionns avec du
tissu noir qui absorbe aisment la chaleur solaire. Ds que la temprature du coussin a
chut aux environs de 40C, un ballot lchement serr contenant 40 ufs de cane ou 25
30 ufs de poule est dpos sur le riz chaud. Le ballot est confectionn partir dune
pice carre de tissu de 45cms de ct. Un tissu doux perfor est utilisable. On entasse
alors alternativement des coussins de riz et des ballots dufs jusqu remplissage du
panier, en terminant par un coussin de riz. Le panier est alors recouvert dun
rembourrage afin de conserver un maximum de chaleur. Ce procd est rpt jusqu
remplissage de tous les ufs dans les paniers, tout en laissant un panier vide pour y
Aviculture Familiale 51

ajouter du riz frachement chauff. Les paniers dincubation sont de forme cylindrique
(50 cm de diamtre et 80 cm de profondeur en Chine, 40 cm de diamtre et 70 cm de
profondeur au Bangladesh) et fabriqus de lattes de bambou tresses. En Chine,
quelques couches de papier de bambou sont colles sur les faces intrieures des cts et
sur le fond afin de boucher les ouvertures et dviter des pertes de temprature par
convection.

Dans les rgions les plus chaudes de la Chine mridionale, des balles de riz sont
utilises en place du riz paddy, et les coussins pour les contenir sont confectionns en
matriaux foncs, afin de capter aisment la chaleur solaire. Les balles de riz procurent
galement une excellente isolation contre les pertes de chaleur des ufs les plus anciens
qui, au contraire, sont transfres par conduction aux ufs les plus rcents placs leur
contact dans des ballots spars. Le systme base de balles de riz a t adopt grande
chelle au Bangladesh aprs avoir t introduit par des projets de dveloppement
avicole dans les annes 80. Depuis, le systme a volu et les paniers cylindriques de
bambou sont maintenant placs dans de larges cadres de bambou avec un surplus de
balles de riz dpos entre les paniers et les cts extrieurs des caisses. La paroi du
panier doit se trouver environ 10cm de la paroi de la caisse et 8cms du panier contigu.
Avec cette isolation plus performante, on enregistre moins de pertes de chaleur et donc
un moindre besoin de recourir des sources caloriques provenant de combustibles
coteux.

Pendant les trois premiers jours, le riz rchauff (ou les balles de riz) sont ajouts
trois fois par jour intervalles rguliers. Du 4me au 6me jour, cette opration se droule
deux fois quotidiennement. Lobjectif est de sassurer que les ufs sont maintenus la
temprature la plus approprie pour le dveloppement de lembryon. Le panier de
rserve est utilis pour transfrer les ufs dun autre panier lors du rechargement en riz
chaud ou balles de riz. De ce fait, la couche suprieure dufs sera dpose au fond du
panier de rserve et la couche infrieure finira au sommet. Le panier qui aura t ainsi
vid sera prt recevoir les ufs dun troisime panier, et le cycle peut ainsi continuer.

En Chine, la chaleur est fournie jusquaux jours 13 et 14 en t et aux jours 18 et 19


durant les mois les plus froids. Ensuite, les embryons en dveloppement sont capables
de produire suffisamment de chaleur sans besoin de source externe. Pendant les six
premiers jours, les ufs incubs sont appels les ufs nouveaux, du 6me au 13me
jour, les ufs entre deux (ils nont pas besoin de chaleur supplmentaire et ils nen
produisent pas); aprs le 13me jour, ce sont les ufs anciens qui produisent de
lextrachaleur. Ds quun panier contient des ufs entre deux et anciens, il est
possible dutiliser uniquement lextra-chaleur produite par les embryons pour incuber
des ufs nouveaux , que lon introduit progressivement dans le panier entre des
couches dufs anciens . Mme si lon ne rajoute pas de chaleur externe, il convient
de retourner et arer rgulirement les ufs trois cinq fois par jour ou bien de les
transfrer dans des paniers voisins. Afin dutiliser efficacement la chaleur produite par
lembryon tout au long de lanne, les couches dufs seront ranges dans les paniers,
selon un schma particulier, dont un exemple est illustr au tableau 5.1.
52 Incubation et Eclosion

Tableau 5.1 Rangement des ufs dans les paniers dincubation avant et aprs transfert
dans les paniers adjacents
_______________________________________________________________________
Dure dincubation (jours)
_______________________________________________________________________
Couche Avant le transfert Et Hiver Aprs le transfert
1 A 14-6 17-20 J
2 B 1-3 1-4 I
3 C 10-13 13-16 H
4 D 4-6 5-8 G
5 E 7-9 9-12 F
6 F 7-9 9-12 E
7 G 4-6 5-8 D
8 H 10-13 13-16 C
9 I 1-3 1-4 B
10 J 14-16 17-20 A
_______________________________________________________________________
Source: Fuan, 1987.

Les oeufs sont mirs aux jours 5 et 13 afin didentifier les oeufs infertiles et morts et
dvaluer le degr de dveloppement de lembryon; Ceci est utile pour ajuster la
temprature des paniers. Il est galement possible dvaluer la temprature de luf en
lappuyant sur la paupire suprieure. La temprature des paniers peut tre ajuste
suivant les moyens ci-aprs:
x En variant, dans un panier, la proportion dufs aux diffrents stades dincubation
(par exemple, la temprature peut tre abaisse en dplaant certains des ballots
dufs anciens).
x En variant le rangement des ufs dans un panier; comme la dissipation de chaleur
est plus rapide sur les cts du panier quau centre, on peut disposer au milieu un
ballot dufs anciens et, en priphrie, des ballots dufs nouveaux qui,
ainsi, les enserreront.
x En changeant la couverture du panier; le rembourrage sera plus pais par temps
froid et en dbut dincubation; il sera plus lger lorsque la rtention de chaleur
sera moins critique.

Les ufs qui se trouvent en tat avanc dincubation produisent beaucoup de chaleur, de
sorte quaux 13me et 14me jours en t (18me et 19me jours en hiver), les ufs
anciens sont transports dans des plateaux dclosion, o ils sont placs en une couche
unique pour dveloppement final et closion. La surface du plateau est recouverte dune
fine couche de balles de riz, protge par une natte de paille. Les bords du plateau sont
garnis de rembourrage pour protger les ufs. Pour recouvrir les ufs en
dveloppement sur le plateau, on utilise un tissu pais ou lger, suivant le degr
disolation dsir. La temprature du plateau dclosion est maintenue entre 36 et 37C,
soit un peu moins que celle du panier. La temprature du plateau peut tre ajuste soit
en changeant lpaisseur du recouvrement, soit en variant lespace entre les ufs et en
bougeant les ufs deux fois par jour de sorte que les ufs en priphrie prennent la
Aviculture Familiale 53

place des ufs centraux. Par climat sec trs chaud, les ufs sont aspergs dun fin film
deau. Ils restent sur le plateau jusqu lclosion et au schage des poussins.

Les plateaux dclosion sont disposs en double tage comme un lit couchettes
superposes. Un tel plateau dune capacit de 500 ufs a une longueur de 90 cm et une
largeur de 68 cm. La hauteur des cts est de 20 cm avec au-dessus un espace de 25 cm
destin la ventilation et faciliter laccs.
Chapitre 6
SANT

Dans la plupart des troupeaux familiaux, la maladie reprsente un problme important.


Quoique les symptmes et les signes de maladie soient familiers pour les fermiers, leurs
causes sous-jacentes en sont moins connues. Presque chaque fermier et la majorit des
vulgarisateurs tiennent la maladie de Newcastle responsable de la plupart des mortalits,
et cette maladie possde un nom local dans toutes les langues.

Tableau 6.1 Signes des maladies de la volaille observes par les fermiers des villages
de lEst Kalimantan, Indonsie
_______________________________________________________________________
Signes Frquence en %
_______________________________________________________________________
Blottissement des poussins lun contre lautre 16.1
Toux, ternuement, acclration de la respiration 13.2
Jetage buccal et nasal 10.9
Somnolence, inapptence, fermeture des paupires 10.9
Paralysie des pattes et des ailes 9.2
Diarrhe blanche 8.6
Retournement ou torsion du cou 8.0
Couleur rouge sombre de la tte et de la crte 6.9
Diarrhe verte ou jaune 4.6
Diarrhe rouge sanguinolente 4.0
Gonflement de la tte et de la crte 2.9
Crte ple 1.7
Vers prsents dans les fces 1.7
Ver dans lil 1.1
_______________________________________________________________________
Source: Ramm et al, 1984.

Cependant, le virus de la maladie de Newcastle nest pas responsable de toutes les


maladies infectieuses. Des problmes digestifs dbouchant sur un retard de croissance
ou de la diarrhe peuvent provenir de lingestion daliments rancis ou dun excs de sel;
ils peuvent galement reprsenter des symptmes de maladies comme la coccidiose, la
salmonellose ou la maladie de Gumboro (aussi appele Bursite infectieuse). La Maladie
de Newcastle saccompagne souvent de diarrhe verdtre, tmoin dun manque
dapptit.

Les volailles disposent dun systme respiratoire dvelopp et trs sophistiqu. Leurs
rythmes cardiaque et respiratoire sont plus rapides que ceux de lhomme, et leur
temprature corporelle est de 5C plus leve. Leurs poumons sont connects la base
avec une srie complexe de sacs ariens membraneux qui, leur tour, sont relis des
cavits ariennes dans les os les plus importants du squelette. Ces caractristiques
contribuent leur lgret et facilite ainsi laptitude voler, Le dsavantage est
lextrme susceptibilit aux infections respiratoires, causes par une varit
Aviculture Familiale 55

considrable de bactries, virus et champignons. Ces infections deviennent plus


problmatiques avec la domestication, du fait de laugmentation de la promiscuit
mme si celle-ci se restreint au logement de nuit et augmente ainsi le risque dinfection
croise.

Une ventilation inadquate des poulaillers rsulte en un accroissement de la teneur en


ammoniaque partir des matires fcales des volailles qui contiennent de lure. Ceci
peut prdisposer les oiseaux des dsordres respiratoires, tels que lternuement, le
larmoiement et le jetage buccal. Ceci est aisment prvenu par une bonne ventilation.
Des dsordres respiratoires plus prolongs sont habituellement causs par des maladies
telles la Newcastle, la Bronchite Infectieuse, la Laryngo-trachte infectieuse, la
Maladie Respiratoire Chronique et la Variolo-diphtrie.

Des troubles locomoteurs, comme la paralysie,la boterie, la torsion du cou et un


ralentissement de la motricit, peuvent tre le fait dune varit de facteurs, tels une
blessure, des dficiences nutritionnelles, et des maladies, incluant la Newcastle
(torticolis), la maladie de Marek (paralysie), la synovite (infections du tendon avec
articulations trs chaudes) et lEncephalomylite aviaire.

MALADIES COMMUNES

Les maladies communes et dsordres de la volaille en libert peuvent tre infectieuses


ou non, et causes par une grande varit dorganismes ou de dficiences, qui sont
rsums dans le tableau 6.2 Le contrle des maladies sera discut dans une section
ultrieure de ce chapitre.
56 Sant

Tableau 6.2 Causes et exemples de maladies de la volaille


_______________________________________________________________________
Agent causal Exemple
_______________________________________________________________________
Infectieux
Virus Maladie de Newcastle, encephalomylite aviaire, variole, maladie
de Marek, Bronchite infectieuse, laryngo-trachte infectieuse,
maladie de Gumboro (bursite infectieuse), hpatite virale du
canard.
Mycoplasme Maladie respiratoire chronique,
Bactrie Cholra (Pasteurellose), salmonellose, pullorose, typhose,
sinusite infectieuse, colibacillose.
Parasites Externes: puces, poux, tiques.
Internes: nmatodes, hmoparasites, cestodes, trmatodes,
Protozoaires: coccidiose, histomonose
Champignons Aspergillose: A. flavis (toxines) A.fumigatus (airsaculite)

Non-Infectieux
Dficiences Rachitisme, doigts crochus, encphalomalacie
Intoxications Empoisonnement par le sel, intoxication alimentaire (botulisme
clostridium botulimum et c. perfringens) plantes vnneuses.
_______________________________________________________________________

MALADIES INFECTIEUSES

Maladies virales
Elles sont parmi les plus meurtrires. Elles ne peuvent tre traites mais peuvent tre
prvenues par des vaccins. Les plus importantes sont dcrites ci-dessous.

Maladie de Newcastle (Ranikhet Disease en Asie) (MNc )


Elle se diffuse rapidement via les gouttelettes projetes et transportes dans lair par la
toux ou lternuement des sujets infects. Le virus peut tre transport par les oiseaux
sauvages, les ufs contamins et lhabillement. Comme la mortalit peut atteindre
souvent 100 pour cent chez les jeunes poussins, la MNc reprsente probablement la
contrainte la plus importante au dveloppement de laviculture familiale. Les sujets de
tous ges peuvent tre affects, quoique les jeunes soient plus susceptibles. La mortalit
chez les oiseaux plus gs est habituellement plus faible, mais la production peut tre
svrement rduite.

La priode dincubation de trois cinq jours est suivie de somnolence, de toux,


dternuement et de haltement. Lacclration de la respiration saccompagne dun
bruit de gargouillis dans la gorge. Habituellement, les signes respiratoires apparaissent
les premiers et sont quelquefois suivis de signes nerveux, caractriss par une torsion du
cou, pouvant tre accompagns de laffaissement des ailes et des pattes. Compte tenu de
Aviculture Familiale 57

lenvironnement et du degr de rsistance des oiseaux, tous les symptmes ne sont pas
visibles ou peuvent napparatre que sous forme attnue ou sub-clinique. Certains
fermiers ont observ que la torsion du cou napparaissait que chez les sujets qui
survivent ultrieurement. Une perte prcoce de lapptit provoque une diarrhe verdtre.
La manifestation diagnostique la plus vidente est lapparition soudaine dune mortalit
trs leve, sans que, souvent, des symptmes aient le temps de se dvelopper. Le
diagnostic est difficile poser partir des seuls symptmes, car ces derniers, trs varis,
se retrouvent dans beaucoup dautres maladies. La discussion sur le contrle de la MNc.
sera discute en dtail plus loin dans la section consacre ce sujet. La haute incidence
de la MNc parmi les troupeaux familiaux en libert sont dus aux facteurs suivants:
x La prvalence de souches trs virulentes (vlogniques, viscrotropiques et
pneumotropiques) en rgions tropicales;
x Le contact permanent avec dautres espces doiseaux domestiques et sauvages
(tels canards et pigeons) qui peuvent vhiculer le virus sans prsenter de maladies,
(Majiyaghbe et Nawathe, 1981);
x La circulation incontrle des oiseaux entre les villages.

Il existe une saisonnalit des accs de MNc, (Sharma et al, 1988), influence par:
x Larrive doiseaux migrateurs;
x Le changement de conditions climatiques, induisant un stress et prdisposant les
animaux la maladie;
x Les priodes chaudes, sches et venteuses qui favorisent le transport arien du
virus;
x La surexploitation des rares points deau disponibles en saison sche qui se
contaminent fortement par le virus.

Variole aviaire
Elle reste importante dans beaucoup de troupeaux du fait que:
x Le virus peut demeurer vivant dans les crotes tombes des oiseaux et garder son
pouvoir virulent pendant 10 annes.
x Les moustiques et autres insectes hmatophages peuvent transmettre le virus.

La maladie est saisonnire et apparat aprs la priode de reproduction des moustiques.


Elle est enzootique en Papouasie Nouvelle-Guine, o elle est significativement
importante sur le plan conomique. Cest galement une maladie majeure dans
beaucoup dautres rgions tropicales.

Maladie de Marek
Linfection se manifeste prcocement et lorsquun oiseau infect survit, il peut
dissminer le virus toute sa vie partir de la perte de squames cutanes. Les signes
cliniques apparaissent chez les jeunes oiseaux en croissance sous forme aigu de la
maladie, caractrise par une forte mortalit due des tumeurs viscrales. La forme
classique, galement accompagne dun pic lev de mortalit, survient chez les oiseaux
gs de 15 semaines jusqu lentre en ponte. Elle se manifeste par la paralysie des
pattes et des ailes.
58 Sant

Maladies mycoplasmiques
Les mycoplasmes, ni bactries ni virus, sont classifis comme PPLO (Pleuro-
pneumonia like organisms). Ces derniers sont essentiellement associs la Maladie
Respiratoire Chronique, un syndrme complexe caus par Mycoplasma gallisepticum
associ des bactries (souvent E.coli), des champignons et des virus (souvent celui de
la Bronchite infectieuse). Les dficiences nutritionnelles et le manque deau
reprsentent dimportants facteurs dans lpidmiologie de la maladie en troupeaux
ruraux.

Maladies bactriennes

Cholra aviaire (Pasteurellose)


Il sagit dune septicmie contagieuse (cause par Pasteurella Multocida) affectant tous
les types de volaille. Souvent transmis par des oiseaux sauvages ou dautres animaux
domestiques, elle se dissmine par contamination de la nourriture ou de leau et par le
jetage nasal ou oral doiseaux infects. La priode dincubation est de quatre neuf
jours, mais des accs aigus peuvent apparatre en deux jours. Dans certains cas, les
oiseaux meurent dans les quelques heures suivant les premiers signes qui varient suivant
la forme de la maladie. La forme respiratoire se caractrise par du haltement, de la toux
et des ternuements, tandis que dans la forme septicmique, apparat une diarrhe avec
des fces humides de couleur grise, jaune ou verte. Dans la forme localise, les signes
sont la paralysie et la flaccidit des articulations des ailes et des pattes. Dans les cas
aigus, la tte et la crte virent au rouge sombre ou au pourpre. Si linfection est localise
la rgion des oreilles, une torsion du cou (torticolis) peut quelquefois sobserver. Dans
les cas chroniques, la crte est gnralement ple, avec des gonflements autour des yeux
et un jetage buccal ou nasal. Le cholra est commun partout o il y a des troupeaux
villageois en libert, du fait quils associent plusieurs espces de volailles et sont
constamment en contact avec des oiseaux sauvages.

Pullorose (Diarrhe Blanche)


Maladie transmise par loeuf et cause par Salmonella pullorum, elle se transmet
pendant lincubation ou immdiatement aprs lclosion. La diarrhe blanche peut
sobserver ds lge de trois jours jusqu lge de plusieurs semaines. Les poussins
refusent de manger, tiennent leur tte replie et leurs ailes pendantes. Ils se blottissent
lun contre lautre en mettant un ppiement caractristique. Dans les formes aigus, la
mortalit varie de 20 80 pour cent; elle est denviron 5 pour cent dans la forme
chronique. Dans cette dernire, les signes sont un gonflement marqu de larticulation
du jarret, un dveloppement ralenti du plumage, une perte dapptit et une dpression
gnrale. Le tableau 6.3 montre les rsultats dune enqute mene en 1984 par Adesiyun
et al. Zaria, Nigria, sur la recherche danticorps anti-Pullorum, indiquant une
infection antrieure par la bactrie.
Aviculture Familiale 59

Tableau 6.3 Prvalence des anticorps de Salmonella Pullorum chez les poulets au
Nord Nigria
_______________________________________________________________________
Conduite de Age Nombre Nombre (%)
llevage (semaines) tests positifs
_______________________________________________________________________
Libert jeune 59 15 25
(race locale) adulte 101 40 40

Basse cour jeune 90 8 9


(exotique) 20 + 70 24 34

Confinement jeune 70 22 31
(exotique) 20 + 90 69 77
_______________________________________________________________________
Source: (Adesiyun et al., 1984)

Lchantillon en libert tait indigne, et les deux autres groupes exotiques. Comme
lge ntait pas connu pour les oiseaux du premier groupe, les sujets non encore en
ponte taient considrs comme jeunes.

Typhose
Cause par Salmonella gallinarum, elle affecte communment les volailles adultes.
Lorsquelle surgit chez les jeunes oiseaux, les signes sont semblables ceux de la
pullorose. La priode dincubation est de quatre cinq jours, et deux jours plus tard, les
oiseaux deviennent dpressifs et anorexiques. La couleur de la crte et des barbillons
passe au rouge sombre; les fces deviennent jaunes et les oiseaux laissent tomber la tte
avec les yeux clos. Habituellement, les oiseaux affects meurent entre trois et six jours.
Pullorose et Typhose sont rpandus en conditions dlevage en libert.

Salmonellose aviaire
Infection cause par tout type de Salmonella, autre que S. pullorum ou S. gallinaruim.
Dans les pays systmes avicoles intensifs, la viande de volaille et les ufs
reprsentent une source majeure dinfection pour lhomme. Linverse peut tre vrai
quand cest la volaille qui est infecte par lhomme. Ojeniyi (1984) a rapport que S.
hirschfeldii a t isol de prlvements cloacaux chez des volailles ainsi que dans les
selles dun homme adulte dans le mme village.

Maladies Parasitaires

Parasites externes (ectoparasites)


Trs commun chez les volailles en divagation, ils comprennent:
x Poux: vivent sur la peau, spcialement autour du cloaque et sous les ailes. Ils
causent une irritation qui peut rduire la production. Les espces de poux
communment rencontres sur la volaille sont: Menacanthus straminens, Lipeurus
caponis, Monopon gallinae, Goniodes gigas and Chelopistes meleagride.
60 Sant

x Acariens: parasites gnants, Ils se nichent dans les fentes du logement et des
perches et sortent seulement pendant la nuit. Ils sucent le sang et diminuent la
production dufs. Certains acariens comme Dermanyssus gallinae peuvent
transmettre aussi le protozoaire Borrelia qui provoque fivre, dpression, cyanose
et anmie.
x Tiques: une infestation massive peut causer une anmie svre et, dans les cas
extrmes, la mort due la perte de sang. Argas persicus est particulirement
dangereux, car il reprsente le vecteur de plusieurs parasites du sang, comme les
hmoprotozoaires et les microfilaires. En Malaisie, il a t rapport (Sani et al.
1987) que, parmi 201 chantillons de sang prlevs sur des volailles villageoises,
plus de 100 contenaient Leucocytozoon sabrazesi, 30 des microfilaires et 6
Plasmodium gallinaceum (malaria aviaire). La malaria est plus rpandue chez les
sujets exotiques ou croiss.

Parasites internes (endoparasites)


Les plus importants sont:
x Helminthes: ils sont communs chez la volaille en divagation, spcialement les
nmatodes et les cestodes. Ssenyonga, (1982) a dmontr que les vers
reprsentaient une cause essentielle de la faible production dufs chez la volaille
en libert en Ouganda; les plus communment trouvs taient Ascaridia galli (ver
rond), Heterakis gallinae (ver du coecum), Syngamus trachae (ver de la trache)
et Raillientina spp. (ver plat)
x Protozoaires: les plus pathognes sont les diffrentes espces de Eimeria tenella
et E.necatrix responsables de coccidioses. Celles-ci reprsentent des maladies
parasitaires communes chez la volaille en divagation. Elles affectent surtout les
jeunes oiseaux et les signes les plus apparents sont lmaciation, la soif, lapathie,
un plumage bouriff, des matires fcales sanguinolentes, et un blotissement des
oiseaux les uns contre les autres. Des enqutes conduites en Asie du Sud - Est et
en Afrique de lEst ont dmontr que respectivement 73 et 47 pour cent des
oiseaux, prsentaient des chantillons fcaux porteurs de Eimeria spp. (Eissa,
1987). La prsence de coccidies dans les chantillons fcaux indique une
infection, mais non ncessairement une maladie clinique. Tout comme les
anticorps prsents dans le sang, cela peut indiquer un certain degr dimmunit.
Un traitement ne simpose donc pas, sous peine de rompre celle-ci.

Maladies fongiques

Mycotoxicoses
Aspergillus flavus se dveloppe communment sur des aliments stocks dont la teneur
en humidit dpasse onze pour cent, spcialement les crales (mas) et les farines de
tourteaux (arachide). Laflatoxine est la toxine spcifique produite par A.flavus. La
toxine peut subsister mme si tous les signes de moisissure ont disparu. Les canards
sont plus sensibles, la dose lthale dans la nourriture est de un pour un million (ppm)
alors que le poulet peut tolrer jusqu 4ppm. Dans les formes aigus de la maladie, la
mortalit peut slever jusqu 50 pour cent. Les autres effets secondaires incluent une
croissance ralentie chez les jeunes sujets et une ponte rduite chez les poules (Smith,
1990).
Aviculture Familiale 61

Aspergillose
La maladie sappelle galement arosaculite. Le champignon Aspergillus fumigatus
provoque la maladie en se dveloppant dans les poumons et les sacs ariens. Il prospre
dans les litires ou dans la nourriture humide. Les oiseaux peuvent inhaler les spores,
qui se dveloppent en lsions aisment visibles sous forme de nodules verts ou jaunes
qui vont envahir compltement les poumons.

MALADIES NON INFECTIEUSES


Dficiences
La sant de la volaille est galement affecte par des facteurs nutritionnels et
environnementaux, tels une alimentation dficiente soit en quantit, soit en qualit. Une
mortalit leve chez les poussins pendant les premiers jours ou les premires semaines
aprs lclosion peut tre due un manque deau ou daliment. Chez les adultes, une
mortalit leve peut tre provoque par des problmes nutritionnels, comme une
carence en sel.
Des dficiences et dsquilibres en nergie et protines peuvent survenir lorsque les
aliments contiennent des quantits insuffisantes de ces nutriments, ce qui entrane une
croissance ralentie chez les jeunes sujets, une chute dans la quantit dufs produits
ainsi quune diminution du poids de luf chez les poules pondeuses. Des dficits en
minraux et vitamines peuvent entraner une croissance ralentie, une production faible
ou la mort. Le manque de vitamine D provoque le rachitisme (dformation des os) chez
les poussins et, combin un dficit en calcium, chez les sujets de tout ge. Un manque
de manganse entrane des dformations des pattes chez les poulets.

Intoxications
Un excdent de certains nutriments, spcialement de minraux, peut causer des
problmes. Trop de sel commun (NaCl) par exemple induit des dformations de la
coquille de luf et une augmentation de la consommation deau; si leau de boisson est
insuffisante comme cest souvent le cas chez les volailles en libert des signes
dintoxication peuvent apparatre. Un accs libre une alimentation riche en hydrates de
carbone et pauvre en graisse, combin un manque dexercice, une temprature leve,
et un stress, peut causer le syndrme du foie gras, conduisant une mortalit leve.
Lingestion de parties de plantes toxiques telles que feuilles, graines et sve,
reprsente un risque commun pour les oiseaux en divagation. Certaines toxines sont
produites par des micro-organismes, comme celles libres par les bactries Clostridium
botulinum et C.perfringens, toutes deux retrouves dans le sol. C.pefringens est
responsable de lentrite ncrotique, provoque par la multiplication de la bactrie dans
le tractus intestinal en conditions favorables et la libration subsquente de toxine trs
puissante qui entrane une mortalit leve. Occasionnellement, certains oiseaux atteints
prsentent de lanorexie, de la dpression et de la diarrhe, mais la plupart meurent sans
montrer le moindre signe clinique. C.botulinum provoque le botulisme, qui est une
intoxication alimentaire aigu. Elle est plus frquente chez le canard qui prsente des
symptmes nerveux, comme le cou repli vers le bas, ainsi quune chute acclre des
plumes au moindre toucher. Le botulisme provient de la consommation par les oiseaux
de dchets de lgumes en dcomposition, contenant la toxine. Les dchets mnagers
vgtaux qui ne sont pas rgulirement mis au rebut reprsentent un risque potentiel de
botulisme.
62 Sant

PIDMIOLOGIE

Effets dus la conduite de llevage


Quoique quasiment toutes les maladies importantes de la volaille se retrouvent dans les
diffrents modles de conduite, le tableau pathologique des oiseaux divaguant en libert
est diffrent de celui rencontr en production avicole intensive. Les troupeaux divagants
comprennent habituellement des sujets de diffrentes espces et de tous ges et sont
constamment exposs aux alas du climat, de lenvironnement ainsi quaux accs
saisonniers des maladies, aux germes et parasites trouvs dans le sol, aux oiseaux et
animaux sauvages.

Dans une tude mene pendant 15 annes au Nord Nigria sur lincidence des
maladies avicoles, Saidu et al. (1994) ont observ que les infections virales telles la
Maladie de Newcastle chez la poule et la variole chez le dindon reprsentaient les
causes les plus communes, quoiquune association concomitante avec des parasites soit
note dans la moiti des cas (voir tableau 6.3). Ils en ont conclu que virus et parasites
taient responsables des principales maladies chez les poulets indignes et que le
dclenchement de celles-ci tait saisonnier.

Tableau 6.4 Maladies des poules /poulets et dindes /dindons locaux Zaria, Nord
Nigria
_______________________________________________________________________
Poules/Poulets
_______________________________________________________________________
Maladie Mortalit (%)
Newcastle 36.1
Association pathologiques 28.5
Morsure de serpent 8.6
Autres maladies 8.6
Gumboro 7.1
Variolo diphtrie 5.1
Ectoparasites 3.5
Endoparasites 2.5
_______________________________________________________________________
Dindes/Dindons
_______________________________________________________________________
Maladie % de toutes maladies
Variolo-diphtrie 16.5
Ectoparasites 15.7
Newcastle 12.2
Association 10.6
Sinusite infectieuse 10.2
Endoparasites 3.5
Autres maladies 31.3
_______________________________________________________________________
Source: Saidu et al. 1994.
Aviculture Familiale 63

Une autre recherche conduite par Adene et Ayandokun (1992), a tudi lvolution du
tableau pathologique au SudNigria entre 1949 et 1955. Il a t observ que la
mortalit des troupeaux divagants de lUniversit dIbadan tait principalement due :
x Helminthiase avec comme agents: Raillietina, Heterakis, Ascaridia, Capillaria,
Tetrameres, Symgamus spp.
x Pediculose avec Menopon, Gonoeodes, Goniocotes et Lipeuris spp.; et acariens
tropicaux avec Ornithonyssus bursa chez les poulets et Numidilipueria tropicalis
chez les pintades.

A cette poque, les infestations parasitaires reprsentaient de plus importantes causes de


mortalit que la maladie de Newcastle.

Une autre enqute mene au Zimbabwe sur des poulets de basse cour (Kelly et al.,
1994) partir de 450 chantillons de sang provenant de 52 troupeaux a rvl une
incidence de 85 pour cent de Bronchite Infectieuse et de seulement 27 pour cent de
Maladie de Newcastle (voir tableau 6.5) Une explication possible pour cette frquence
assez faible pourrait provenir du taux de mortalit lev de la MNc et donc du nombre
restreint de survivants pouvant effectivement tre prlevs.

Tableau 6.5 Etat pathologique des troupeaux de poulets au Zimbabwe estim par test
sanguin
_______________________________________________________________________
Maladie Pourcentage chantillons positifs
_______________________________________________________________________
Bronchite infectieuse 85
Rticulo-endothliose 65
Maladie de Gumboro 55
Pasteurella multocida 52
Mycoplasma gallisepticum et / ou
Mycoplasma synoviae 33
Maladie de Newcastle 27
Encphalomylite 11
Leucose aviaire 9
Reovirus 3
_______________________________________________________________________
Source: Kelly et al. 1994.

De mme, en Zambie, une enqute mene sur 2000 chantillons de sang (Alders et al,
1994) a rvl que la sroprvalence moyenne de la Maladie de Newcastle tait de 37
pour cent avec une variation entre 29 pour cent pour la province du Nord et de 51 pour
cent dans la province du Copperbelt. Un rsum de limportance relative des maladies
avicoles rassemble auprs dautres sources est reprise ci-dessous dans le tableau 6.6.
64 Sant

Tableau 6.6 Importance relative des maladies rencontres en aviculture familiale


_______________________________________________________________________
Classement Saunders Adene, Ramm Ahmed,
1994 1990 et al. 1984 1987
Burkina Faso Nigria Indonsie Bangladesh
_______________________________________________________________________
1 MNc MNc MNc MNc
2 Trichomonas Gumboro MRC Cholra
aviaire
3 Variolo-diphtrie Variolo-diphtrie Variolo Coccidiose
diphtrie
4 Salmonellose Typhose Coccidiose Variolo-
diphtrie
5 Pasteurellose Maladie Cholra Pullorose
de Marek aviaire
6 Parasites Parasites Pullorose Parasites
_______________________________________________________________________

Effets lis lespce aviaire


Dans les rgions tropicales, la Maladie de Newcastle est considre comme la maladie
la plus importante de la volaille villageoise cause de son taux de mortalit lev qui,
en Afrique, dpasse les 70 pour cent. Cependant, toutes les espces de volaille ne sont
pas galement susceptibles. La pintade, quoique affecte pisodiquement, semble avoir
une meilleure rsistance mme si on la mlange aux poules. Elle est cependant plus
sensible Trichomonas, contre lequel la poule parat immune. On ne pense pas que le
canard soit sensible la Maladie de Newcastle mme sil en reprsente un vecteur
significatif ni mme la plupart des autres maladies du poulet, mais il succombe
aisment dautres maladies qui lui sont spcifiques comme:
x Peste du canard: maladie aigu et hautement contagieuse avec un taux de
mortalit avoisinant les 100 pour cent;
x Hpatite du caneton et Mycotoxicose: trs dangereuse pour les jeunes canards. La
Myycotoxicose se contracte essentiellement par lingestion daflatoxine partir
daliments composs moisis; une dose de 0,75ppm. peut tre mortelle pour le
caneton;
x Cholra du canard: ( infection Pasteurella multocida ): largement rpandu dans
les troupeaux villageois, il attaque aussi bien canetons que poulets;
x Pasteurellose (Pasteurella anapestifer) importante maladie des canetons, tandis
que le colibacillose (infection Escherichia coli ) est une maladie septicmique
des canards en croissance qui peut galement affecter les poulets.

Les maladies ci-dessus sont largement responsables des pertes normes de canetons qui
sont une caractristique de la production en libert.

Quoique la salmonellose ne soit pas une maladie importante dans cette espce, les
ufs de cane peuvent reprsenter une source non ngligeable de contamination pour
lhomme. Cela peut expliquer le tabou frappant la manipulation des ufs de cane
rpandu dans beaucoup de cultures, particulirement en Afrique. Les ufs de cane ne
Aviculture Familiale 65

doivent pas tre stocks au contact de lgumes consomms crus, tels carottes, laitue et
chou.

Effets de la saison et de lge


Les modles de maladie varient en fonction de la saison. La Maladie de Newcastle est
plus meurtrire en saison sche. En Thalande, Pasteurellose, Coryza et infections
streptocoques apparaissent aussi plus frquemment en saison sche, et le Cholra, la
Colibaccilose et la Pseudomonose en saison pluvieuse (Thitisak, 1992). Dans le Nord
Nigria o Saidu et al. (1994) ont tudi 522 cas, impliquant 8800 poulets la
Maladie de Newcastle est intervenue pour 30 pour cent. Parmi ceux-ci, 38 pour cent
sont survenus immdiatement avant la saison sche doctobre dcembre et seulement
10 pour cent en saison des pluies, de juillet septembre. La plupart des pousses de
variolo-diphtrie surviennent en saison pluvieuse et sont les plus importantes au mois de
juillet; 60 pour cent des accs affectent les jeunes poussins. En Thalande, Thitisak et
al. (1989) ont observ quune mortalit catastrophique est survenue en mars 1987 et
1988 lorsquen fin de saison sche, des orages prcoces ont provoqu des chutes de
temprature qui ont refroidi les oiseaux. Ils ont galement remarqu que les poussins en
dessous de deux mois (en pleine priode de croissance) et les poulets /tes de plus de six
mois (en phase de maturit sexuelle) taient plus susceptibles aux maladies infectieuses.
(Voir tableau 6.7)

Tableau 6.7 Taux de mortalit pour 100 oiseaux risque


_______________________________________________________________________
Cause de mortalit Age (mois)
_______________________________________________________________________
>2 26 <6 Total
Coryza infectieux 6.8 0.7 16.8 24.3
Pasteurellose aviaire 4.6 1.1 2.4 8.1
Maladie de Newcastle 4.1 1.4 0.7 6.2
Variolo-diphtrie 3.2 0.3 0.0 3.5
Salmonellose 1.4 0.0 0.3 1.7
Pseudomonose 0.0 0.3 0.0 0.3
_______________________________________________________________________
Total 20.0 3.8 20.2 44.1
_______________________________________________________________________
Source: Thitisak et al., 1989, et Janviriyasopak et al. 1989.
Donnes denqute 1987 sur 2231 et 3239 oiseaux.

Ncessit dtudes pidmiologiques


Les tudes pidmiologiques en aviculture rurale sont essentielles pour la mise sur pied
de programmes de sant appropris au milieu villageois. Elles ont t entreprises dans
de nombreux pays, mais le travail accompli en Thalande (Janviriyasopa et al, 1989)
sera prsent en exemple.

Le Centre Rgional de Recherche et de Diagnostic vtrinaire du Nord Est, bas


Tha Pra, Khon Kaen, Thalande sest lanc dans une tude long terme: Sant et
Productivit des volailles locales avec lassistance de lAgence allemande pour la
66 Sant

Coopration Technique (GTZ) et le Dpartement des Sciences Cliniques Vtrinaires de


lUniversit de Massey, Nouvelle-Zlande. Cette tude faisait partie dun programme de
recherches pidmiologiques sur les facteurs affectant la productivit du btail dans la
rgion. Lobjectif de ltude tait de dcider de la priorit des problmes pour lesquels
des programmes de contrle pourraient tre dvelopps au sein du service rgional de
sant de base pour la volaille.

Dans les villages slectionns, furent recrutes environ 15 familles possdant des
troupeaux de 15 20 oiseaux. Dans la plupart des villages, furent effectues des
vaccinations contre la Maladie de Newcastle, variolo-diphtrie et cholra aviaire, afin
de susciter un certain intrt. Par ailleurs, deux villages furent rmunrs pour
reprsenter une population totalement non vaccine. Tous les oiseaux furent marqus
laile et regroups par ge:
x en - dessous de deux mois;
x deux six mois;
x six douze mois;
x un deux ans;
x deux trois ans;
x plus de trois ans.

A chaque visite, les ufs et volailles furent pess, compts et marqus. Du sang fut
prlev la veine de laile pour dtermination du titre de la maladie de Newcastle et
pour effectuer des tests pour la pullorose, la maladie respiratoire chronique, la bronchite
infectieuse et la maladie de Gumboro. Chaque oiseau marqu fut sujet un examen de
sant, du plumage et la recherche de parasites externes. Les oiseaux malades et morts
furent collects pour examens pathologiques au laboratoire, afin didentifier la cause de
la mort ou de la maladie. Des frigos furent mis la disposition de certains villages afin
de stocker les cadavres pour examen ultrieur. Les animaux morts ou malades furent
changs contre des oiseaux sains afin de pouvoir en examiner le plus grand nombre
possible, mais comme les villageois consommaient de temps autre les animaux morts
ou malades, ceux quils prsentaient pour change taient souvent des oiseaux jeunes
quils avaient moins tendance manger. En calculant les taux de mortalit par ge et en
dterminant les taux de causalit lintrieur de chaque groupe, il fut possible de
dterminer la contribution par ge de chaque maladie la mortalit. Un questionnaire
fut labor pour rassembler linformation complmentaire.

Les objectifs de lenqute taient dtablir:


x un indice de productivit;
x la longvit moyenne des oiseaux;
x les caractristiques des flambes de maladie;
x les relations entre maladies et niveau de production.

Les paramtres utiliss pour lenqute taient:


x production dufs;
x taux dclosion;
x nombre de mortalits dans chaque groupe;
x gain de poids chez les sujets en croissance;
Aviculture Familiale 67

x nombre de sujets sacrifis pour la consommation;


x nombre doiseaux vendus;
x pertes inopines.

Certains des rsultats sont repris dans le tableau 6.7 ci-dessus. La manipulation
incorrecte des ufs, la mauvaise conduite de lincubation et des jeunes poussins, tout
comme la malnutrition, particulirement en saison sche, furent identifis comme autant
de facteurs prdisposant aux maladies infectieuses et aux infestations parasitaires
(Thitisak et al. 1989).

CONTRLE DES MALADIES DANS LES TROUPEAUX FAMILIAUX

Contrle non mdical


Le moyen le plus conomique et efficace de prvenir les maladies non virales est
damliorer la conduite de llevage et la nutrition; les aspects les plus importants en
sont lhygine, le logement, la structure du troupeau, le soin et lalimentation des jeunes
poussins.

Hygine
Les mesures dhygine simples suivantes, aptes prvenir la maladie, ont t
recommandes par le Projet FAO/PNUD de Dveloppement du Petit Elevage au Nord
Kivu, Zaire (FAO. Van Vlanderen, 1989):
x Les matires fcales, les plumes et les oiseaux morts sont sources dorganismes
pathognes; ils seront retirs des abris de nuit, ramasss sur les parcours et
dtruits. Cette pratique rduira galement lincidence des parasites externes.
x Les nouveaux arrivants seront isols. Les oiseaux achets ou reus seront gards
en quarantaine dans un panier ou une cage pendant au moins quinze jours; sils
restent en bonne sant, ils pourront rejoindre le troupeau.
x Tous les nouveaux arrivants seront traits tant pour les endo- que pour les
ectoparasites; ils seront, si possible, vaccins ds leur arrive.
x La litire du poulailler sera frquemment retourne; en cas dhumidit, elle sera
change.
x Les paniers utiliss pour garder les oiseaux pendant la nuit seront schs au soleil
ou, pendant la saison pluvieuse, suspendus auprs du feu.
x Abreuvoirs et mangeoires seront nettoys frquemment.
x Les pots brchs utiliss comme abreuvoirs seront rchauffs devant le feu avant
remplissage.
x Le poulailler ou le panier sera rgulirement dsinfect tous les deux mois.

Logement
Lorsque le poulailler est vide, des amliorations simples et un entretien seront effectus.
Un bon logement suppose les lments suivants:
x Ventilation: si des paniers volailles sont utiliss comme logement de nuit, ils ne
seront pas couverts de tissus ou de sacs. Huttes, cages et paniers ne seront pas
placs auprs de fumires ou de latrines.
x Espace: la surpopulation sera vite, et les effectifs de volailles seront
proportionns lespace disponible. Les poussins faibles et les sujets en
68 Sant

croissance seront gards dans un logement spar pour la nuit. Les nids de ponte
et de couvaison seront gards au calme.
x Sparation des espces: il est meilleur de nlever quune seule espce de volaille.
Si cela nest pas possible, les diffrentes espces seront loges sparment pour la
nuit afin dviter la propagation des maladies.

Structure du troupeau
De toutes les espces de volaille, la poule est la plus sensible aux maladies. Canards,
oies et pintades sont souvent des porteurs sains ou faiblement atteints. Ceci reprsente
une source commune dinfection chez les poulets alors que linverse et rare. Ds lors,
une attention spciale sera porte la sant des poulets au sein des troupeaux mixtes. La
sparation par espces ou par groupes dge peut ne pas tre possible, mais des attirails
simples comme des paniers ou des cages amnags lusage exclusif de certains sujets
peuvent tre utiliss comme mesure temporaire lors de certaines manipulations comme
la vaccination des poussins ou une alimentation particulire.

Alimentation
Limportance de la nutrition dans ltat de sant du troupeau est bien connue. Des
recherches complmentaires sont ncessaires sur les sources alimentaires alternatives
pour la volaille rurale, afin dviter lutilisation du grain, prcieux pour lalimentation
humaine.

Contrle mdical
Parmi les mesures simples de contrle mdical appropries pour les troupeaux
villageois divagants, on inclura:
x Vaccination contre la Maladie de Newcastle, la Variolodiphtrie et le Cholra
aviaire.
x Dans les troupeaux mixtes, vermifugation contre les parasites internes avec un
vermifuge polyvalent. Chez la pintade, un vermifuge sera utilis contre
Trichomonas.
x Traitement contre les parasites externes. Les insectes et autres ectoparasites
prosprent rapidement dans les huttes, cages et paniers. Il existe des mthodes
traditionnelles efficaces contre ce flau. Les diverses surfaces seront asperges
avec un insecticide appropri, en utilisant une pompe main antimoustiques. Ce
procd sera pratiqu pendant la matine en labsence des oiseaux qui ne seront
autoriss rintgrer leur logement que dans la soire. Les ectoparasites vivant
sur la volaille seront traits en ajoutant des boules de naphtaline et de la cendre
dans les bains de poussire. La cendre est plus abrasive que le sol ordinaire et
rode la carapace cireuse de lexosquelette de linsecte lorsque loiseau prend un
bain de poussire. Si la carapace cireuse est suffisamment attaque, linsecte va se
dshydrater et mourir.

Contrle de la Maladie de Newcastle


Il y a trois approches gnrales pour contrler la Maladie de Newcastle:
x Hygine: est toujours importante, particulirement dans le contrle en systmes
semi-intensifs o les oiseaux sont confins dans une cour clture ou dans un abri.
Lhygine inclut des mesures telles que le nettoyage, la dsinfection, un accs
limit des oiseaux sauvages, et des mesures de propret du personnel.
Aviculture Familiale 69

x Abattage des troupeaux infects: mesure drastique employe avec succs dans des
rgions isoles ou des les, non atteintes en principe par la maladie.
x Vaccination associe avec des mesures dhygine appropries: cela demeure la
mthode la plus efficace pour contrler la maladie.

Vaccins et Campagnes de vaccination contre la Maladie de Newcastle


La vaccination demeure la seule forme de prvention contre les maladies virales. Une
campagne de vaccination correctement conduite peut diminuer rapidement et
significativement les pertes dues la maladie. En Indonsie, suite une campagne de
vaccination contre la Maladie de Newcastle, la mortalit des troupeaux villageois a
chut de 50 8 pour cent et la population de poules / poulets sest accrue de 900 3500
sujets, soit de 250 pour cent (Moerad, 1987). Les vaccins disponibles contre la maladie
de Newcastle sont de deux types: vivants ou morts:
x Les vaccins vivants sont fragiles et sont utiliss suivant des rgles strictes; ils
requirent une chane de froid jusqu leur application sur loiseau. Leur efficacit
est rduite, sil subsiste des anticorps rsiduels chez le sujet. Cela est spcialement
important chez le poussin qui possde des anticorps transmis par sa mre jusqu
lge de 10 jours. Un taux faible danticorps maternels rduit limmunit acquise
par la vaccination. La vaccination de groupe peut tre pratique en administrant le
vaccin buvable dans des abreuvoirs et de leau trs propre ou par arosol dans des
locaux confins. Le vaccin vivant conventionnel, Hitchner B1, ne peut pas tre
distribu dans leau de boisson aux troupeaux villageois, mais bien par voie
oculaire, ce qui prsente lavantage que chaque oiseau reoit sa dose
individuellement. Cette mthode a t pratique avec succs au Maroc o elle a
contribu rduire considrablement la mortalit (Bell et al. 1990). La mthode
par instillation oculaire sera utilisse seulement lorsquil existe un personnel
vtrinaire qualifi former les vaccinateurs.
x Vaccins tus: procurent une bonne immunit mais demandent dtre amorcs par
un vaccin vivant pour de meilleurs rsultats, moins quune infection naturelle ait
dj jou ce rle au pralable. Ils ont t utiliss avec succs au Burkina-Faso
(Verger 1986 et Ouandaogo, 1990). Ils prsentent plusieurs inconvnients: ils
doivent tre administrs individuellement par injection intramusculaire, ce qui
dune part, requiert une formation vtrinaire et qui dautre part, est formellement
contre indiqu chez les poussins. Pour ce faire, les oiseaux doivent tre maintenus
ce qui reprsente un travail astreignant. Les vaccins tus prsentent lavantage de
ne pas exiger une chane de froid aussi rigide que pour les vaccins vivants;
comme, de ce fait, ils prsentent une dure de vie plus longue, ils peuvent tre
utiliss dans des rgions plus recules. Ils semblent tre plus efficaces chez des
oiseaux ayant dj acquis un certain degr dimmunit par exposition naturelle
la maladie ou partir dune primo- vaccination par vaccin vivant. Un autre
avantage est que la technique chimique dinactivation du virus tue galement les
autres polluants, tels que virus non dsirs, bactries et autres micro-organismes.
Les vaccins tus sont gnralement meilleur march que les vaccins vivants parce
que le produit est plus durable; toutefois ceci nest vrai que pour les grands
troupeaux. Cela a t largement dmontr au Burkina Faso et au Niger, il existe
un important gaspillage car les flacons contiennent au minimum 100 doses pour
une vaccination villageoise de quelques douzaines de sujets. Lintrt dune
prparation, dun conditionnement et dun transport efficaces sont ainsi
70 Sant

compltement remis en question moins que le flacon puisse entirement tre


utilis.

Contraintes la vaccination des troupeaux villageois


Le faible taux de russite de la vaccination contre la Maladie de Newcastle est presque
entirement du linactivation du vaccin du fait de labsence dune chane de froid
efficace. Cela est, son tour, aggrav par lparpillement des troupeaux, le mauvais tat
des routes et le manque de moyens de transport. En Indonsie, le dlai entre le dpart du
vaccin partir dun laboratoire central et la vaccination elle-mme peut tre de plusieurs
jours.

Les programmes de vaccination seront excuts aux moments les plus appropris.Pour
les flambes de Maladie de Newcastle et de Variolo- Diphtrie maladies pour
lesquelles les campagnes de vaccination sont ordinairement pratiques il existe des
caractristiques saisonnires. Par ailleurs, le calendrier agricole sera pris en
considration. En Thalande, par exemple, les vaccinations contre la maladie de
Newcastle sont effectues en saison sche, lorsque les paysans ne sont pas requis par la
riziculture (Danvivatanaporn, 1987).

Il a t report frquemment que le manque de motivation reprsentait la cause la plus


importante du faible taux de vaccination dans les rgions rurales. Pour surmonter ce
problme, un projet pilote a organis en Thalande un cours de formation pour les
enfants de 12 ans. Les avantages de la vaccination contre la Maladie de Newcastle leur
furent prsents et on leur enseigna comment reconnatre les signes cliniques simples de
la maladie. Un autre cours de formation lusage de volontaires en levage fut dispens
cinq jeunes dirigeants villageois slectionns. A leur retour au village, ils prodigurent
gratuitement leurs services et avis sur le contrle de la maladie. Il tait espr quavec
ce surcrot de connaissance et dimplication personnelle, il en rsulterait une meilleure
motivation des villageois dvelopper leurs propres programmes de vaccination.

Au Bangladesh, le fonctionnaire en charge de llevage au niveau du sous- district


organise une formation spciale en vaccination et en levage du btail, en consultation
avec le prsident et les membres du comit local.Ces derniers slectionnent les fermiers
et les volontaires pour cette formation. Le cours est divis en deux parties: thorique et
pratique. En fin de cours, les vaccinateurs reoivent contre paiement des flacons de
vaccins et lquipement ncessaire afin de vacciner leur troupeau ainsi que ceux du
village, moyennant rtribution. Ils renvoient ensuite les flacons vides et reoivent du
vaccin frais. Le Dpartement de lElevage conduit le programme de contrle des
maladies du btail des petits fermiers en tant que partie de son programme de
dveloppement de laviculture, ceci gnralement en collaboration avec des
groupements dorganisations locales non gouvernementales (ONG). (Dpartement de
lElevage, Bangladesh, communication personnelle, 2000).

Le Vaccin V4, (ND V4)


Il sagit dun nouveau vaccin qui possde les avantages suivants:
x Il est thermo-tolrant et produit partir de souches non virulentes du virus de la
maladie de Newcastle prsentes en Australie. Dans une exprience conduite au
Malawi, les poussins ayant reu le vaccin aprs quil eut t expos pendant six
Aviculture Familiale 71

semaines la temprature ambiante, ont dvelopp un taux lev danticorps et


ont rsist lexposition une souche vlognique et viscrotropique de
Newcastle (Sagild et Spalatin, 1982).
x Si la moiti dun troupeau familial est capture et vaccine, le vaccin va se
rpandre naturellement des oiseaux vaccins aux autres oiseaux confins avec eux
pendant la nuit. Le taux danticorps de ces derniers naturellement vaccins est
comparable celui des premiers (Young, 1991).
x A la diffrence des vaccins conventionnels qui ne peuvent tre administrs des
oiseaux stresss, le NDV4 est si bnin quil peut tre distribu tous les sujets.
x Le vaccin peut tre incorpor dans la nourriture quoique la mthode par
instillation intra-oculaire soit beaucoup plus efficace.

Adlers et al. (1994) rapportent quun essai vaccinal de laboratoire avec le vaccin
thermotolrant V4 et le vaccin Hitchner B1, a dmontr que le premier (HRV4)
produisait un taux plus lev dinhibition lhmatoagglutination. Le HRV4 fut utilis
avec succs dans le contrle de la Maladie de Newcastle sur des troupeaux villageois au
Malawi (Saglid et Haresnape, 1987). Dans un essais de terrain, les oiseaux vaccins ont
dvelopp une bonne rponse immunitaire lorsque le vaccin a t administr dans des
abreuvoirs trs propres contenant une eau limpide. Cependant, cette mthode ne peut
tre employe quen saison sche, du fait de la difficult de confiner les oiseaux en
conditions compltement sches pendant la saison des pluies.

Un vaccin thermorsistant drivant du V4 a t utilis en Asie du Sud Est par


addition la nourriture (Copland, 1987). Il na pas requis de doses individuelles et sest
dissmin aux autres oiseaux dans une certaine mesure. Le choix de laliment porteur
sest rvl crucial. Laliment du commerce prsente deux inconvnients comme
porteur; tout dabord, la variation de sa composition, dont certains lments peuvent se
rvler toxiques pour le virus; dautre part, les aliments prpars sont coteux et lun
des facteurs essentiels dans un modle de vaccination pour petits exploitants doit rsider
dans son faible cot.

En Malaisie, le vaccin est pulvris sur du bl pendant que celui-ci est moulu et
mlang dans un mlangeur simple galets fabriqu localement. Il est possible de
mlanger en une fois dix mille doses de vaccin. Laliment vaccinal est alors conditionn
en petits sacs de plastique de 200g suffisants pour 20 oiseaux. Mme aprs 45 jours de
stockage temprature ambiante, le vaccin emball procure 90 pour cent de protection.

Dans dautres pays asiatiques, o le bl nest pas aisment disponible, le riz a t


utilis: le riz, tout comme le bl, prsente un inhibiteur de virus hydrosoluble dans les
enveloppes; le grain lav maintient ainsi un titre viral plus lev que le grain non lav.
Le lavage est effectu en trempant le grain pendant 24 heures, le vaccin est ensuite
mlang au grain humide. Au niveau du village, la quantit requise du grain humide (10
grammes par oiseau) est pese dans un sachet de plastique et ensuite additionne de
vaccin. Il est important de procurer un systme de creep-feeding pour les poussins et les
sujets en croissance, sous peine de voir les oiseaux plus gs consommer tout le vaccin.

La souche V4 a t teste dans diffrents pays africains (Ethiopie, Gambie, Tanzanie,


Zimbabwe et Nigria), Le premier essai de terrain de HRV4 a t conduit en Gambie
72 Sant

(Jagne et al. 1991). En juillet 1993, la FAO et les gouvernements thiopien et gambien
ont sign un accord de projet financ par le Programme de Coopration Technique
(PCT): Assistance aux femmes rurales pour la protection de leurs troupeaux de
volailles contre la maladie de Newcastle (TCP/RAF/2376T). Lobjectif tait
dintroduire et dvaluer le vaccin oral HRV4 en conditions africaines, aprs quil eut
dmontr son efficacit en Asie du Sud-Est, ainsi que dimpliquer les femmes rurales
dans lexcution du projet. Dans les deux pays, la vaccination orale rpte jusqu
quatre fois intervalles rguliers, ne produisit gnralement pas le haut degr
dimmunit obtenu en Asie du Sud-Est. Toutefois, des groupes parallles instills par
voie oculaire dvelopprent de tels niveaux de protection.

En 1995, des essais furent mens en laboratoire en Ethiopie. La vaccination orale,


administre sur orge, bl et mas broy, furent compars la vaccination par instillation
oculaire et la non vaccination. Huit jours aprs, les oiseaux furent soumis linfection
par le virus de Newcastle. Les taux de survie furent de 80 pour cent pour le groupe
vaccin par voie oculaire, 20 pour cent pour le groupe vaccination orale, et 0 pour cent
pour le groupe de contrle. Parmi les trois crales utilises comme porteurs, lorge se
rvla la plus efficace, suivie par le mas et enfin par le bl.

Le Zimbabwe a t indemne de Maladie de Newcastle de 1986 1994, lorsquune


pizootie clata en provenance dAfrique du Sud. Du fait de la circulation non contrle
des volailles, elle se rpandit rapidement travers la plus grande partie du pays. En
1994/95, dix millions de volailles rurales furent vaccines au niveau national pour un
cot projet de US $ 1.50 par oiseau. Dbut 1996, un Projet FAO financ par le PCT fut
initi pour tablir un programme communautaire de prvention des pizooties de
Maladie de Newcastle chez la volaille locale. Lapproche prconise combinait
ladministration immdiate du vaccin V4 par la mthode conventionnelle dinstillation
oculaire avec des essais communautaires utilisant la mthode orale alimentaire dans les
conditions du Zimbabwe. Il tait ainsi espr viter dautres pizooties et de gnrer les
donnes ncessaires la programmation dune vaccination rgulire de la volaille rurale
base sur lusage de vaccin oral, en tant que composant du service vtrinaire de
vulgarisation.

Quoique le V4 a dmontr des rsultats prometteurs en surmontant la majorit des


contraintes poses par la vaccination contre la Maladie de Newcastle, des problmes
persistent pour la volaille en divagation au niveau villageois, o lalimentation demeure
irrgulire et o la volaille clt, sachte et se vend en continu toute lanne durant.
Dans tous les pays, des essais de laboratoire sont ncessaires pour valuer les diffrents
aliments porteurs de vaccin et familiariser les techniciens avec le vaccin et les systmes
de testage par souches virulentes, avant le testage en conditions de terrain. Les donnes
de production seront collectes auparavant, durant et pendant la vaccination. Ceci est
essentiel pour valuer lefficacit de la vaccination.

Mthodes traditionnelles de contrle des maladies de la volaille en Afrique


Le traitement et contrle de maladie traditionnels sont importants, car la majorit des
pays en dveloppement nont pas les moyens dimporter ou de subsidier mdicaments
vtrinaires et vaccins pour les petits exploitants. Par ailleurs, une inquitude
grandissante se manifeste au sujet des effets sur les animaux et lenvironnement des
Aviculture Familiale 73

mdicaments produits par synthse. Ojeniyi (1985) a dcouvert une corrlation entre
lutilisation des antibiotiques et la rsistance ces derniers de certaines souches
dE.coli isoles partir de volailles conduites en mode intensif lUniversit dIbadan,
Nigria. Les 1248 souches dE.coli provenant de la ferme avicole de luniversit et les
2196 souches provenant dune ferme avicole commerciale dIbadan, taient rsistantes
la ttracycline, la streptomycine et aux sulfamides. En revanche, les 2284 souches
isoles partir de troupeaux urbains et villageois conduits en libert taient toutes
sensibles ces mdicaments.

La majeure partie de linformation prsente ci-aprs sur lusage de la mdecine


traditionnelle pour la volaille a t rassemble de manire informelle (Bizimana, 1994)
et na pas t teste scientifiquement. La raison principale de son inclusion est
dencourager la recherche formelle.

Maladies virales
x Maladie de Newcastle: du Nigria, aussi bien Lageneria vulgaris que lcorce de
Parkia filicoidea sont donns au troupeau dans leau de boisson (Nwude et
Ibrahim, 1980). Au Zimbabwe, les feuilles de Cassia didymobotrya ou le latex de
Euphorbia matabelensis sont donns dans leau de boisson (Chavunduka, 1976).
En Tanzanie, dans les rgions dArusha et du Kilimanjaro, sont distribus la tige
de Euphorbia candelabrum Kotscky var. candelabrum ou le fruit de capsicum
annuum associ aux feuilles de Iboza multiflora (Minja,1989).
x Variolo. Diphtrie: Au Zimbabwe, les feuilles dAloe excelsa sont macres et le
liquide ainsi extrait est ajout leau de boisson (Chavunduka, 1976). Une
maladie de la volaille, trs meurtrire, pour les sujets de tous ges se rencontre en
Mauritanie, Mali et Sngal, o les Peuls lappellent Yoko yoko . La cause
exacte en est inconnue mais Ba (1982) suggre quil puisse sagir dune forme de
VarioloDiphtrie. Les signes et symptmes, dcrits par les Peuls, sont le jetage,
des difficults respiratoires accompagnes de lmission du son yok yok et
lternuement. Lobstruction des narines par des crotes jauntres oblige les
animaux respirer par le bec, lui aussi porteur de crotes. Un manque dapptit et
une conjonctivite purulente ont galement t observs. Finalement, les oiseaux
suffoquent et succombent. Chez les sujets en croissance, la mortalit avoisine les
100 pour cent, mais certains adultes peuvent survivre. Les oiseaux sont
systmatiquement abattus et le poulailler incendi afin de prvenir la
dissmination. Ces symptmes, tels que dcrits, indiquent la forme humide de
la variolo diphtrie, dans laquelle loiseau meurt finalement de suffocation par
dpts caseux dans la trache. Les lsions de variole sont quelquefois moins
videntes dans cette variante de la maladie mais elles peuvent tre retrouves
aprs examen soigneux.
x Refroidissements: au Nigria Hibicus subdariffia est pulvris et mlang leau
de boisson avant dtre distribu aux oiseaux prsentant un bouriffement du
plumage (Nwude et Ibrahim, 1980).

Maladies protozoaires
Coccidiose: au Nigria, Lageneria vulgaris est immerge dans leau de boisson des
troupeaux.
74 Sant

Maladies bactriennes
Cholra aviaire: au Nigria, le fruit dAdansonia digitata est bris et macr dans leau
de boisson des volailles. Le fruit de Capsicum annuum est mlang avec la suie
provenant des plafonds des btiments couverts de chaume (en Hausa: Kunkunniya) et
distribu dans leau de boisson (Nwude et Ibrahim, 1980).

Maladies mtaboliques et infectieuses


x Troubles abdominaux: au Nigria, les jeunes feuilles de Boswellia dalselii sont
haches et macres dans leau; le liquide extrait est donn comme traitement
anti-diarrhique (Nwude et Ibrahim, 1980). En Afrique du Sud (Province du
Natal), Leonotis leonurus Ait.f. est utilis contre la diarrhe jaune et verte. (Watt
et Breyer-Brandwijk, 1962). En Afrique mridionale, les fermiers emploient une
infusion froide de feuilles dAloe saponaria Haw pour traiter entrite et
indigestion de la volaille (Watt et Breyer-Brandwijk, 1962). En Afrique
Occidentale, les feuilles haches de Pergularia extensa sont distribues aux
dindons souffrant de diarrhe (Dalziel, 1937). Au Zimbabwe, le bulbe dAdenium
multiflora est macr dans leau pendant 12 heures, avant dtre donn aux
animaux malades, souffrant de diarrhe aqueuse ou sanguinolente. Le latex dAloe
chabandii ou dEuphorbia matabelensis est utilis dans leau de boisson dans le
mme but (Chavunduka, 1976).
x Sang dans les excrtions: au Zimbabwe, lcorce de Cussonia arborea est
macre dans leau; lextrait est administr aux animaux malades (Chavunduka,
1976).

Croissance ralentie et faible production


Au Nigria, le fruit de Cucumis pustulatus est mlang du son et vers dans leau de
boisson, pour acclrer la croissance, protger des maladies et augmenter la production
dufs. Le fruit de Cyperus articulatus est galement distribu dans leau de boisson
(Nwude et Ibrahim, 1980). En Afrique de lOuest, le fruit de Cucumis prophetarum ou
C.pustulatus est rparti dans leau de boisson pour favoriser le crot, prvenir les
maladies, repousser les faucons prdateurs et augmenter la production dufs (Dalziel,
1937)

Ectoparasites
x Ectoparasites divers et maladies parasitaires: Au Nigria, les feuilles sches
et les brindilles de Guiera senegalensis Lam: sont consumes dans les poulaillers
pour rduire le taux dectoparasites (Nwude et Ibrahim, 1980). A Bolawayo,
Zimbabwe, Thamnosma africana Engl: est dpos dans les abris pour volailles
afin de repousser les puces et les fourmis (Watt et Breyer-Brandwijk, 1962).
x Poux: au Nigria, les feuilles de Bandeiraea simplicifolia sont disposes dans les
poulaillers pour tuer les poux (Daziel, 1937; Nwude et Ibrahim, 1980). Les
cendres provenant de la combustion des feuilles de Nicotiana rustice, N.tabavum
ou Carica papaya est frictionne dans le plumage pour protger de linfestation.
Au Sngal, les feuilles de Calotropis procera Ait.f. sont utilises pour tuer les
poux sur la volaille (Daziel, 1937; Warr et Breyer-Brandwijk, 1962).
Aviculture Familiale 75

Endoparasites
Vers: au Nigria, les fruits de Cucumis prophetarum et de Solanum nodiflorum
balsamina sont utiliss par les Haoussas pour traiter les vers de la volaille (Nwude et
Ibrahim, 1980).

Autres
Boiterie du canard: au Nigria, les Haoussas pulvrisent les feuilles de Momordica
balsamina et les mlangent la nourriture pour traiter les canards boteux (Nwude et
Ibrahim, 1980).
Chapitre 7
AMLIORATION DES RACES

Les stratgies aptes dvelopper des races de volailles adaptes aux besoins des petits
producteurs des rgions tropicales doivent diffrer de celles utilises en production
intensive, et devront se concentrer sur lamlioration des races indignes tout en faisant
usage de races pures exotiques ou de croisements lorsque la situation sy prte.

La conservation des races locales prsentant des variations gntiques spcifiques un


environnement particulier est essentielle pour un dveloppement durable. Quoiquelles
nexistent quen populations numriquement faibles, les races locales ne sont pas
seulement hautement adaptes lenvironnement naturel, mais font aussi partie
intgrale du mode de vie des populations rurales. La population, le btail et
lenvironnement forment un cosystme dlicatement quilibr mais durable, et donc
limpact potentiel de toute intervention destine accrotre la production dans un
systme traditionnel doit tre pralablement estim. La situation est moins sensible en
aviculture priurbaine, industrielle ou intensive petite chelle, o des amliorations
rapides peuvent tre ralises travers des programmes de dveloppement bien cibls.
Le secteur de laviculture intensive est, cependant, beaucoup plus rduit que celui de
laviculture familiale dans presque tous les pays en dveloppement.

STRATGIES DAMLIORATION DES RACES

Les deux rgles suivantes seront incorpores dans toute stratgie damlioration
gntique:
x Le matriel gntique ne sera pas modifi en conditions traditionnelles tant que
gestion et logement nont pas t bonifis et, mme en ce cas, la slection sera
circonscrite aux races locales.
x Lorsque les conditions techniques sont optimales et quun march est prt en
commercialiser les produits, des races amliores, des croisements et des souches
hybrides slectionns pour leur performances leves peuvent tre introduits en
systmes pri-urbains, mme petite chelle.

La mthode la plus commune pour amliorer le rservoir gntique local est de croiser
sujets indignes et exotiques, et de laisser la descendance se multiplier par slection
naturelle. A cet effet, des coquelets (ou poulettes) de race pure ou hybride, slectionns
pour la production de viande ou dufs sont introduits dans les troupeaux, gnralement
dans le but daugmenter la production dufs. Il est important de savoir quacclration
de la croissance et production leve dufs sont gntiquement incompatibles chez le
mme oiseau. Il sagit de deux caractres gntiques corrls ngativement, ce qui
signifie que la slection pour un caractre va rduire leffet de lautre.

Echange de poulettes ou de coquelets


A titre dexemple de ce type de stratgie, il est envisag un troupeau de poules
indignes pondant 50 ufs par an aprs avoir entam la ponte lge de 25 semaines.
Ces poules sont croises avec des coquelets de race amliore dont le potentiel
gntique est de 250 ufs par an avec une entre en ponte 21 semaines. Il en rsultera
Aviculture Familiale 77

une premire gnration de poulettes croises commenant pondre 24 semaines,


avec un potentiel gntique de 200 ufs par an. Cette premire gnration (F1)
danimaux croiss a un potentiel gntique thorique (gnotype) plus lev que la
moyenne des deux races parentales; cest ce que lon appelle la vigueur hybride.
Cependant, en pratique, ce potentiel gntique ne sera pas extrioris, moins que la
conduite du troupeau soit significativement amliore, spcialement dans le domaine de
lalimentation.

Si les gnrations suivantes de poulettes croises sont de nouveau fcondes par des
coquelets amliors (croisement dabsorption), le potentiel gntique continuera
slever pour la production dufs, quoiqu un rythme plus lent (car la vigueur hybride
ne fonctionne seulement quen premire gnration). A chaque gnration, de meilleurs
niveaux de gestion, incluant la fourniture daliments correctement quilibrs, seront
ncessaires pour lextriorisation de ce potentiel.

Cependant, si les sujets croiss se reproduisent entre eux, le potentiel de production va


chuter dans les gnrations suivantes et revenir la moyenne des productions des deux
races de dpart, mme si la conduite de llevage peut soutenir un niveau plus lev
dhybridation.

Lutilisation de coquelets cet effet reprsente la base du Programme dchange de


coqs ou de coquelets, communment appele opration coq qui a t exprimente
dans presque tous les pays tropicaux. Les mnages changent leurs coquelets locaux
pour quelques coquelets amliors qui sont ensuite amens maturit afin de leur
permettre de sadapter aux conditions locales.

Dans certains cas, un programme dchange de poulettes ou dufs fertiles a t


prconis. Ces approches furent employes extensivement du dbut des annes 30
jusquaux annes 60, priode laquelle le dveloppement urbain a encourag
linstallation dune production avicole priurbaine intensive, de petite moyenne
chelle, qui utilise des races commerciales et une technologie importes.

Le remplacement progressif des gnes locaux par croisement et slection artificielle


fut la base initiale du dveloppement dans de nombreux pays (Omeje et Nwosu, 1986;
Coligado, Lambio et Luis, 1986)

Quoique de nombreuses stratgies juges appropries pour les systmes de production


villageoise ont t mises en uvre, la plupart dentre elles ont chou du fait du manque
de suivi quant lamlioration de la conduite de llevage.

Remplacement de toutes les races indignes


Lutilisation de souches hybrides en conditions de libert a souvent t tudie,
particulirement au Zimbabwe (Huchzemeyer, 1973), et au Sri Lanka, Zambie et
Nicaragua (Roberts et Senaratne, 1992; de Vries, 1995).

Il a t rgulirement constat que les programmes de remplacement intgral


induisaient une augmentation de la production doeufs et de viande, mais uniquement
lorsque la gestion procurait de bonnes conditions de nutrition et dhygine. Cependant,
78 Amlioration des Races

le grand inconvnient de lusage de souches hybrides pour accrotre la production


dufs rside dans llimination de la couvaison naturelle, puisquil existe une
corrlation gntique ngative entre ces deux facteurs. Pour cette raison, le
remplacement total dune race locale ne saurait tre envisag sans lexistence dune
source fiable de fourniture de poussins dun jour dune race adapte.

Slection au sein des races locales

Caractres de production des races locales


Lamlioration gntique des races et souches locales dans les pays en dveloppement
requiert au pralable de runir une documentation approprie sur leurs performances de
production et de reproduction. Les caractres de production principaux des races locales
sont:
x taille corporelle rduite (avec des besoins nutritionnels dentretien faibles);
x retard de maturit pouvant ntre atteinte qu 36 semaines;
x faible production (20 50) et poids des ufs (25 45 g.);
x taille de couve petite (2 10 ufs);
x dlai allong entre la ponte et la propension la couvaison.

Pour les systmes ruraux en petites exploitations, la production de viande ne peut tre
spare de celle des ufs ou des poussins et une trs bonne couveuse et, par consquent,
faible pondeuse (faibles besoins nutritionnels) reprsente le meilleur animal pour
survivre dans de telles conditions. Les coquelets en surplus sont gnralement vendus
pour la viande, quel que soit leur poids, lorsquils atteignent la maturit sexuelle trois
ou quatre mois.

Dans les conditions dun tel systme extensif, il nexiste que peu de contrle de la
reproduction des poules, parce quelles couvent leurs propres poussins pour un
renouvellement continu du troupeau. Les activits de couvaison et dlevage des
poussins accrot la longueur de cycle reproductif de 58 jours pour atteindre environ 74
jours, suivant le schma:

16 jours de ponte et de constitution de la couve + 21 jours dincubation + 37


jours dlevage des poussins = 74 jours
Source: Horst, 1990 b.

En consquence, la plupart des poules peuvent produire 4 5 couves annuellement, et


seulement quatre si la priode dlevage est tendue huit semaines. Comme la
malnutrition, les prdateurs et les accidents entranent des taux de mortalit de 60 70
pour cent pendant la priode dlevage, quasiment tous les ufs sont destins la
reproduction. A raison de quatre cinq cycles reproductifs par an, il nest possible
dobtenir quenviron neuf poulettes de remplacement.

Fertilit et closabilit sont galement leves chez les oiseaux locaux. Ils sadaptent
gnralement bien des conditions dfavorables de conduite. La rsistance aux
maladies prdominantes est gnralement considre comme apprciable quoique les
taux de mortalit des jeunes et quelquefois des adultes puisse tre importants en
systmes extensifs.
Aviculture Familiale 79

Des disparits gntiques considrables existent entre les diffrentes populations


rgionales et continentales de poulets indignes et les taux de production doivent tre
pralablement valus avant lintroduction de programme de dveloppement.

Programme de slection pour races locales


Quoique de meilleures mthodes de gestion puissent amliorer significativement les
performances des races locales, certains chercheurs ont estim quil existait galement
un besoin de slection gntique (Nwosu, 1979). Des programmes de slection en race
pure ont t mis en place au Bangladesh (Ahmad at Hashnath, 1983) sans tre conduits
sur le terrain. Les diffrents chercheurs ci-dessus sont arrivs la conclusion que, mme
si lamlioration des races locales de volailles pouvait tre bnfique, il tait essentiel
dvaluer ces races et leurs croisements pralablement la mise en place dune stratgie
de slection.

Des recherches menes en Tanzanie (Katule, 1991) ont conclu que la slection pour
les caractres deux fins au sein des populations locales demandait du temps tout en
tant coteuse. Le croisement avec des races amliores, suivi dune slection au sein
de ces populations composites, est prfrable.

Quoique, dans la plupart des pays en dveloppement, la prfrence soit accorde des
races deux fins, il est important de raffirmer que, chez le mme oiseau, lamlioration
de la production dufs et de linstinct de couvaison sont gntiquement incompatibles
tout comme accroissement dufs et de production de viande. La slection lintrieur
dune paire de ces caractres, va forcment rduire lautre trait.

Modification des races locales par utilisation de gnes dominants


Lutilisation de gnes dominants simples ou combins pour la rduction (Na) ou la
structure (F) du plumage, ainsi que celle du gne rcessif li au sexe pour la rduction
du poids corporel (dw) a t estime comme particulirement approprie pour les
tropiques (Horst, 1989; Harren-Kiso, Horst et Valle Zarate, 1995). La recherche sur
leffet de ces gnes sur les rpercussions conomiques a t entreprise en Malaisie
(Khadijah, 1988; Mathur et Horst 1989). A titre dexemple, la rduction du plumage ou
Cou Nu (Na) entrane une diminution totale de plumage de 40% avec la partie infrieure
du cou presque totalement nue. Ceci rduit considrablement le besoin nutritionnel
protique pour la production de plumes, alors que ce besoin reprsente souvent le
facteur limitant dans la Base des Aliments Rsiduels Picorables (voir chapitre 3). Barua
et al. (1998) a parcouru linformation disponible sur les performances des volailles
indignes locales cou nu dans lespoir dattirer lattention des chercheurs travers
le monde sur ses intressantes caractristiques et faciliter les recherches futures.

Lincorporation de ces gnes pourrait tre significative pour le dveloppement de


races et de souches appropries dans laviculture tropicale petite chelle. Il est
naturellement recens sept gnes majeurs potentiellement utiles:
x Na Cou nu (autosome A)
x Dw nain (li au sexe S)
x K faible emplumement (S)
x F fris (A)
80 Amlioration des Races

x H soyeux (A)
x Fm fibro mlanose (A)

Lutilisation de gnes majeurs afin damliorer la productivit dans les programmes de


slection daviculture petite chelle a t exprimente dans diffrents pays tropicaux:
Indonsie. Malaisie, Thalande, Bangladesh, Bolivie, Inde, Cameroun, Nigria.

Dautres caractres morphologiques qui permettent une meilleure dissipation de la


chaleur comprennent: le dveloppement de la crte et des barbillons, lallongement des
pattes. Dans ce cas, il sagit du rsultat de laction combine de gnes multiples. Cela
peut galement tre envisag favorablement pour tre incorpor dans le dveloppement
de races locales hautement performantes sous les tropiques.

POUR UNE PRODUCTION MEILLEURE: AMLIORATION GNTIQUE


OU MEILLEURE GESTION ?

Laviculture familiale est bien intgre dans la majorit des systmes fermiers
villageois, o les races locales fournissent 40 70 pour cent de la production nationale
en viande et en ufs de la plupart des pays tropicaux. Du fait de leur adaptation la
recherche de la nourriture, de leur capacit produire et de leur faible cot, les races
locales sont leves par les petits exploitants ruraux, les fermiers sans terre et les
travailleurs de lindustrie. Il est difficile dimaginer des oiseaux mieux adapts
survivre en conditions de libre divagation que les races qui ont dj volu dans le
mme environnement et qui ont dmontr leur capacit y survire. Cependant, il reste
un potentiel considrable et largement inexploit augmenter la production des races
locales partir de meilleures conditions de gestion.

Pour les systmes divagants en libert, lobjectif critique est de rduire le taux lev
de mortalit tant chez les animaux en croissance et les adultes, mais plus spcialement
chez les premiers o il se situe entre 60 70 pour cent. Ce taux lev de mortalit
signifie que beaucoup dufs pondus doivent tre gards pour la reproduction et le
maintien de leffectif du troupeau, plutt que dtre vendus ou consomms. Il signifie
aussi que beaucoup doiseaux meurent plutt que dtre utiliss pour le revenu ou la
consommation.

Le problme des races locales nest donc pas intrinsquement une faible productivit
en ufs ou en viande, mais une forte mortalit. Lamlioration gntique aux fins
daccrotre la production en viande ou en ufs ne rsoudra pas les problmes de sant et
de nutrition. De plus, laccroissement de la production en ufs crera un nouveau
problme avec la disparition de linstinct de couvaison dans le troupeau, qui forcera le
petit exploitant acheter ses animaux plutt que de les voir couver et lever par ses
poules.

La mortalit peut tre significativement rduite par une prise de conscience


progressive par le fermier des besoins de sant travers la fourniture de vaccins
(spcialement contre la maladie de Newcastle) et par lamlioration des conditions
dalimentation des sujets en croissance (par exemple, en utilisant des systmes de creep-
feeding). Ces mthodes reprsentent les amliorations les plus substantielles dans la
Aviculture Familiale 81

gestion et permettront au fermier de mieux exploiter le potentiel existant de ses races


locales en conditions de divagation.

Si, pour le fermier, les ressources disponibles pour la conduite de llevage se


diversifient, au point de lui fournir localement un aliment quilibr pour ses volailles,
les options qui lui sont offertes pour gnrer son revenu seront amliores. Cependant,
la solution ne sera pas de confiner les races locales au sein de systmes de conduite
intensifs. En effet, les performances des races indignes naugmenteront que trs
lgrement en batterie ou en litire profonde (Akinokun, 1975; Oluyemi, 1979; Nwosu,
1979). Du fait du faible potentiel gntique tant pour la viande que pour les ufs,
compar celui des souches commerciales hybrides, il est plus rentable de rserver ce
type dinvestissement ces dernires.

Si un aliment quilibr, des produits vtrinaires et des poussins dun jour de souches
hybrides sont localement disponibles, la production avicole intensive reprsente une
option possible. Si non, lever des races locales dans des conditions de libre divagation,
demeure le meilleur choix.

Le vaste potentiel pour augmenter le revenu de laviculture familiale conduite selon le


systme divagant rside clairement dans le domaine de rduction de la mortalit chez
les jeunes sujets. Ceci reprsente dj un dfi suffisant pour les ressources restreintes du
personnel de vulgarisation du gouvernement et des ONG dans les pays en
dveloppement.

Le potentiel damlioration gntique pourra tre considr dans le futur, mais


seulement lorsque lobjectif plus immdiat de rduction de la mortalit sera atteint.
Entretemps, les efforts seront poursuivis afin de maintenir le matriel gntique comme
ressource pour lavenir.
Chapitre 8
CONOMIE DE LA PRODUCTION

Le sous-secteur agricole de la production animale fait partie dun systme fermier


complexe interdpendant. Lanalyse de la production de llevage ne peut tre
uniquement calcule en termes dintrants et de revenus mais doit galement prendre en
considration les autres activits agricoles. Linteraction entre la production animale et
les autres soussecteurs peut tre complmentaire, telle lutilisation du fumier ou
comptitive, comme lallocation des terres aux crales ou au pturage.

Le systme fermier dans son ensemble, et llevage en particulier, est influenc par
des facteurs externes, comprenant la politique gouvernementale sur le dveloppement et
la commercialisation de llevage, qui doivent tre pris en compte dans toute analyse ou
valuation.

DFINITION ET ANALYSE DES COTS DE PRODUCTION

Le systme fermier se dfinit comme la combinaison de tous les sous-systmes/


entreprises de la ferme, la gestion et les objectifs du fermier et linteraction entre tous
ces lments. Cest une unit la fois de prise de dcision et dutilisation des terres qui
englobe lexploitation, les systmes de culture et dlevage afin de transformer sol,
travail, gestion et capital en produits destins la consommation ou la vente.

Les entreprises/soussystmes se dfinissent comme les diffrentes subdivisions du


systme fermier, chacun dentre eux produisant un type de crale ou un produit animal.
Dans le cas de laviculture familiale, les produits sont la viande et les ufs, et le fumier
reprsente un sousproduit. Le produit de laviculture familiale pour la consommation
personnelle et la vente peut tre considr comme la gestion dune ressource fixe pour
un rendement conomique. Dans cette optique, les principes conomiques qui
sappliquent la gestion de la faune, des parcs, des terres de parcours semblent plus
appropris que les concepts communment employs dans la production animale lie au
travail et au capital ainsi que dans lagro-industrie.

MTHODES ET CRITRES POUR LVALUATION DES COTS

Le cot de production peut tre apprci sous diffrents angles. Les intrants peuvent tre
externes (cots non factoriels) ou internes (cots factoriels). Les intrants internes sont
sous le contrle de lexploitation fermire et comprennent les terres, le travail, la gestion
et le capital. Largent impliqu dans la production reprsente soit des cots (pays) en
espces soit des cots thoriques (calculs). Une autre mthode pour diffrencier les
cots est de distinguer les cots variables des cots fixes. Les cots variables
augmentent ou chutent suivant limportance du produit et le niveau de lopration. Ces
cots variables (pour des articles tels la nourriture, les vaccins et le travail temporaires)
peuvent tre contrls jusqu un certain point et napparaissent pas lorsquil ny a pas
production. Les frais fixes (pour des lments tels quimpts, assurances, intrts et
amortissement des btiments et quipements) sont pris en compte quil y ait production
ou non.
Aviculture Familiale 83

Le principe du cot occasionnel sapplique dans la comptabilit fermire. Il peut se


dfinir comme le revenu pouvant tre gnr si lintrant, la ressource ou le facteur de
production avait t consacr la meilleure alternative similaire possible.

De nombreux sous-systmes ou entreprises fermiers fournissent plus dun produit. La


volaille produit des ufs, de la viande et du fumier. Lorsquon calcule le cot unitaire
de production, la valeur montaire de tous les sousproduits, (quils soient vendus
lextrieur o quils soient utiliss en tant que substitut dans un autre soussystme ou
entreprise de la ferme) doivent tre dduits des frais gnraux bruts, ce qui aboutit aux
frais gnraux nets. Pour avoir le cot unitaire, il convient de diviser les frais gnraux
nets par le nombre total dunits de production.

Le modle de calcul de cot divise les frais de production en deux catgories: les frais
au comptant et les frais calculs. Les frais au comptant comprennent les paiements
effectifs en espces ou en nature pour intrants ou services utiliss. Les frais calculs
sont dtermins par des formules mathmatiques, incluant les lments suivants:
x amortissement du poulailler et de lquipement;
x intrts sur les espces en caisse et le capital personnel utilis pour construire le
poulailler et acqurir lquipement, les oiseaux et laliment;
x entretien du poulailler et de lquipement;
x travail familial.

Les frais calculs comprennent les cots occasionnels qui sont lis la situation de
lconomie nationale: par exemple, le chmage et les taux levs de dvaluation de la
monnaie nationale. Ceci fait partie de la ralit socio- conomique pour le petit
exploitant, et influence le cot occasionnel du travail (qui baisse lorsque le chmage
augmente fortement) et du capital (qui tend vers zro lorsque le taux de dvaluation est
plus lev que le taux dintrt). En utilisant des matriaux locaux disponibles et
recyclables pour le logement des volailles et lquipement, les aviculteurs familaux
minimisent lintroduction de capital extrieur dans leur entreprise.

La production avicole grande chelle ne peut rellement tre compare la petite


aviculture familiale, car souvent les petits exploitants doivent faire face des
contraintes telles que labsence dun march structur et le manque de prix attractifs en
fonction de la qualit et de luniformit du produit. Ds lors, le calcul des cots en
aviculture grande chelle tout comme en aviculture commerciale en parcours nest
pas applicable aux petits systmes daviculture familiale.

Elson (1992) a dmontr que pour les poules pondeuses, les cots de production par
douzaine dufs produits augmente avec lespace allou par animal (densit). La
densit minimale alloue dans lUnion europenne (telle que spcifie dans la directive
1988/66 de la CEE) est de 22 sujets/m2 (450cm2/oiseau). Les cots de la production
pour oiseaux logs en cages cette densit sont utiliss comme base de calcul. Le
pourcentage de cot ajouter en fonction du systme de conduite est:
x 5 pour cent pour les volires;
x 712 pour cent pour les volires avec perchoirs et plancher de treillis 20
oiseaux/m2;
84 Economie de la Production

x 15 pour cent pour les cages de 20 oiseaux/m2 (750cm2/oiseau);


x 21 pour cent en systme litire profonde 7 oiseaux/ m2;
x 30 pour cent en enclos paills 3 oiseaux/m2;
x 35 pour cent en systmes semi-intensifs 0,1 oiseau/m2 (1000 oiseaux/ha.);
x 50 pour cent en systme en libert 0,4 oiseau /m2 (400 oiseaux/ha.).

Une comparaison des normes de base de lU.E. compare aux systmes avec perchoir et
en libert est fournie au tableau 8.1 ci-dessous.

Tableau 8.1 Performances et cots de production de trois systmes alternatifs au


Royaume-Uni.
_______________________________________________________________________
Systmes
_______________________________________________________________________
Cage Perchoirs Libert
Performances
Densit 22 22 0.04
Nb. ufs/poule loge 276 265 252
Consommation aliment g./oiseau/jour 115 16 135
Mortalit % 5 5 8
Poids, poule adulte 2.2 2.2 2.3
Nb. Oiseaux/travailleur 20.000 10.000 2.500

Cots production (pence/douzaine ufs)


Nourriture 25.5 27.8 32.8
Amortissement poule 7.9 8.4 8.6
Travail 1.5 3.2 13.3
Electricit 1.2 1.2 0.7
Mdicaments 0.1 0.1 0.2
Autres cots 1.1 1.2 1.3

Total 37.4 41.8 56.9


_______________________________________________________________________
Source: Elson (1992), daprs des donnes de Tucker (1989)
N.B. Les calculs ont t faits sur base de 140/tonne; poulettes 2,35/ units; poule
adulte 24,2p./kg

CADRE CONOMIQUE LARGI POUR ANALYSE

Toute activit conomique consiste transformer des ressources (sol, travail et capital)
en biens et services destins satisfaire les besoins et dsirs de la population. Une
grande partie dune valuation quantitative dune analyse cot/bnfice nest que de la
simple comptabilit: assigner des valeurs montaires des quantits physiques
mesures ou estimes; les ranger en catgories sous une rubrique cot ou bnfice, les
additionner et finalement comparer les totaux. Une analyse conomique rationnelle
devra procurer un cadre au sein duquel les bnfices de la production sont visualiss
Aviculture Familiale 85

dans le systme conomique et comment ces bnfices sont valus par la socit. Ceci
peut seffectuer uniquement par une analyse avant et aprs ou avec et sans.

Les bnfices peuvent se mesurer de deux faons:


x Par une composante technique reprsentant laugmentation de la productivit des
ressources (et, par consquent, la rduction des cots unitaires) utiliss pour la
fourniture de produits avicoles.
x Par une composante conomique qui reflte la valeur accorde par la socit ces
fournitures.

Les effets techniques apparaissent dans une tude conomique comme un changement
dans la courbe des fournitures, la relation de base exprimant le prix minimal auquel
diffrents niveaux de production peuvent tre disponibles pour le march. Ceci apparat
sur la Figure 8.1 ci-dessous comme linflexion vers le bas sur la courbe S0 S1. La
valeur indique pour ce changement dans la disponibilit potentielle est alors
entirement dpendante de la demande pour les produits avicoles. Lorsque la demande
slve pour ces produits, des fournitures supplmentaires deviennent onreuses et, ds
lors, la production excdentaire se convertit en un accroissement substantiel des
bnfices pour la communaut. Il peut tre rtorqu que cette situation arrive
gnralement dans les pays en dveloppement o, compars la ration journalire de
rfrence, les produits avicoles reprsentent des produits de luxe de valeur relativement
leve. Il en rsulte que la courbe de demande D indique que la quantit dsire ragit
fortement aux changements de prix et de revenu, alors quune consommation
additionnelle ne diminue la valeur que faiblement. La demande pour les produits
avicoles rvle une lasticit prix/revenu.

Ce modle simple souligne limpact conomique gnral dun accroissement de la


production avicole tel quil se manifeste sur les marchs pour ces produits. Production
et consommation slvent de Q0 Q1 mais le prix pay par le consommateur (et peru
par les producteurs) chute de P0 P1. Les consommateurs gagnent de manire
significative, engrangeant les bnfices dune offre plus leve et de prix plus bas. Les
producteurs en profitent galement. Quoique le cot unitaire sabaisse, laugmentation
de la production compense la rduction de prix et il apparat vident daprs le
diagramme que le revenu total P1Q1 peru par les producteurs est plus lev que le
revenu prcdent P0Qo0.
86 Economie de la Production

Fig. 8.1 Reprsentation du march des produits avicoles des petits producteurs

prix

lunit

Quantit demande et fournie

Le bnfice conomique net global obtenu partir dune technologie amliore de la


production avicole familiale est reprsente par la taille de la zone ombre. Cest ce
bnfice conomique net quune analyse des schmas et programmes de dveloppement
doit sefforcer destimer
Chapitre 9
COMMERCIALISATION

Plus un pays se dveloppe, plus ses consommateurs perdent contact avec le village et les
producteurs daliments. Ds lors, des services spcialiss de commercialisation
deviennent ncessaires. Les produits de la ferme doivent tre rcolts, emballs et
transports dans de bonnes conditions et distribus aux dtaillants proximit du
domicile des consommateurs. Ceci demande galement que les produits soient classs
par qualit et entreposs. Plus le pays se dveloppe, plus augmente la varit de produits
qui peut conomiquement tre produite. Ces derniers doivent tre disponibles cot
supportable par les consommateurs.

Une tude sur les systmes de commercialisation au niveau dun pays permet souvent
dexpliquer leur volution jusquau stade actuel. Beaucoup de pays en dveloppement
ne possdent pas de chane de froid pour la conservation que ce soit pendant le
transport, chez le dtaillant ou chez le consommateur. Cest pour cette raison que le
poulet se vend vivant et est abattu immdiatement avant la consommation. De mme la
qualit des ufs vendus au dtail doit tre apprcie par lacheteur lui-mme, soit par
mirage (vrification au moyen dune source de lumire) soit par la flottaison. Les deux
mthodes consistent essentiellement vrifier la dimension de la chambre air, situe
au gros bout de luf, qui slargit au fur et mesure que luf vieillit et perd une
partie de son contenu en eau. Dans le procd par flottaison, luf aura tendance
remonter vers la surface au fur et mesure de llargissement de la chambre air.

Dans les pays en dveloppement, le transport des ufs et de la volaille des villages
vers les cits commence gnralement par des achats effectus par des colporteurs, soit
directement auprs des mnages, soit dans des petits marchs locaux hebdomadaires.
Des paniers contenant de la paille protgent les ufs de la casse: dautres types de
paniers servent transporter les volailles vivantes. Des charrettes bufs continuent
tre utilises dans de nombreux pays pour le transport la fois des volailles et des ufs
vers les grands centres communautaires. Les toits des bus et des trains remplacent ces
vhicules lents lorsque le rseau de transport se modernise. En ce qui concerne les
qualits de commercialisation des oiseaux vivants, le problme principal rside dans la
perte de poids par dshydratation durant le transfert. Celui-ci peut tre aisment rsolu
en procurant boire pendant le voyage qui se fera, si possible, pendant les heures
fraches de la journe. Les considrations sur la qualit des ufs sont plus complexes et
seront envisages dans la seconde moiti de ce chapitre.

Les programmes damlioration de la commercialisation doivent sefforcer de ne pas


grever le produit de cots que ne pourrait pas supporter le consommateur. Il sagit donc
dapporter simplement de petites corrections aux moyens existants de manutention, de
transport, demballage, de classement et de stockage.

Les organisations de commercialisation sintgrent dans la filire trs progressivement


et doivent proposer des mesures appropries aux habitudes culturelles, aux
caractristiques et lducation de la population concerne. Des plans radicaux de
changement, qui ne tiennent pas suffisamment compte de lenvironnement socio-
88 Commercialisation

conomique, sont gnralement vous lchec. Par consquent, tout programme


damlioration sera conu afin de raliser les modifications dsirables au sein des
facilits commerciales existantes (et leur cadre conomique et lgal) travers un
processus solide dexpansion.

Lorsquun pays se dveloppe, les tches dvolues dans la commercialisation des ufs
et de la volaille continuent impliquer la rcolte des ufs et des poulets auprs des
fermiers, les transporter une entreprise de contrle de la qualit, demballage ou de
transformation qui classera et standardisera les ufs et la viande de poulet, les
transformera et les conditionnera en prparations plus commodes, qui les entreposera
(de prfrence en atmosphre rfrigre), qui les transportera vers les rseaux de gros et
de dtail et les livrera aux consommateurs en lieu et temps opportuns.

Ce chapitre procure un bref aperu de ces aspects, comprenant des informations et


conseils pratiques ceux qui sont impliqus dans la commercialisation des produits
avicoles. Pour un examen plus dtaill de cette commercialisation, le lecteur est pri de
se rfrer au Manuel de la FAO n4: Commercialisation des ufs et de la volaille
(1961), dont sont extraites les considrations suivantes.

FACTEURS AFFECTANT LA DEMANDE EN UFS ET EN VIANDE DE


VOLAILLE

Aspects crmoniaux et traditionnels


Dans les socits traditionnelles, la volaille est souvent utilise pour les dons,
crmonies et sacrifices. Ci-aprs sont repris quelques aspects traditionnels de la
proprit des volailles chez les Mossi du Burkina-Faso, les Mamprusi du Nord Ghana et
les fermiers Bangladeshi et Malay dAsie du Sud.

Chez les Mossi, dans le cas o il ny a plus de volaille disponible, comme aprs une
ruption de Maladie de Newcastle, le mnage doit acheter ou emprunter un oiseau pour
satisfaire ses obligations familiales habituelles. Les poulets sont donns une relation
pour lui transmettre son estime ou en signe de remerciement pour une faveur ou une
aide ( un personnage officiel par exemple). Dans le cas dvnements socio culturels
et religieux, couleur et sexe des volailles sont imposs. Une famille fournira un coquelet
blanc lorsquun accord aura t conclu pour un mariage.

La consommation dufs nest pas commune dans les villages Mossi. Il persiste une
croyance solide sur la propension des enfants qui mangent rgulirement des ufs
devenir des voleurs, du fait que la saveur de luf incitera lenfant en manger le plus
souvent possible. Les seuls ufs consomms sont ceux qui nclosent pas aprs
couvaison; ils sont alors bouillis avant dtre mangs. Les ufs de poule, la diffrence
des ufs de pintade, ne font pas partie des produits avicoles commercialiss car ils sont
tous gards pour lincubation afin de maintenir leffectif du troupeau, compte tenu des
taux de perte apprciables durant les priodes dlevage. Les dtaillants des rgions
urbaines rpercutent la demande pour les ufs villageois. Ceux-ci sont souvent achets
par de petits gargotiers qui les revendent comme casse-crote aprs les avoir bouillis.
Un nombre considrable dufs de pintade est collect pour la vente par les Mossi; la
Aviculture Familiale 89

plupart sont achets sur les marchs villageois par des dtaillants qui les acheminent
vers les villes.

La socit Mamprusi au Nord-Ghana utilise les produit avicoles des fins varies. Les
coquelets sont les animaux les plus priss pour les sacrifices. Les pintadeaux mles ne
sont pas utiliss cet effet. La couleur de loiseau est importante. Un coq rouge est
sacrifi pour appeler la pluie ou une bonne rcolte, un coq blanc pour transmettre son
estime une relation. Et un coq noir pour protger de la maladie, de la guerre ou des
disputes.

Du fait de ces coutumes, les coqs rouges, blancs ou noirs valent le double des sujets
dautres couleurs.

La vente dufs et de jeunes oiseaux seffectue dans les marchs villageois. Les prix
fluctuent au cours de lanne, et diminuent pendant la priode prcdant la rcolte,
lorsque les greniers sont vides, les crales en train de pousser, et les liquidits peu
disponibles A cette poque, les marchands du sud viennent s approvisioner afin de
revendre dans les villes. Parfois, des dtaillants intermdiaires interviennent. Ils
achtent des oiseaux dans les villages et les revendent dans les marchs ou des
commerants urbains. La vente de produits avicoles reprsente environ 15 pour cent du
revenu annuel en espces pour les mnages Mamprusi.

La consommation familiale est rare car la plupart des oiseaux sont vendus pour
gnrer un revenu. Dans la socit Mamprusi, les femmes, les filles circoncises et les
enfants premiers-ns ne consomment ni ufs ni viande. Ces produits sont rservs aux
hommes gs, aux visiteurs masculins et aux jeunes enfants. Les raisons de ces
traditions ne sont pas compltement lucides. Certaines femmes Mamprusi pensent
que, durant la grossesse, leur comportement (y compris leurs inclinations alimentaires)
peut influencer lenfant natre. Comme les animaux ressemblent plus lhomme que
les plantes, elles craignent que le bb puisse prsenter des attributs animaux si la mre
mange des produits carns.

Au Bangladesh, ufs et viande sont consomms prfrentiellement par les hommes et


les garons, et trs rarement par les femmes et les filles. Les groupes faible revenu ne
consomment habituellement ni ufs ni viande. Ceux-ci sont vendus et partir des
recettes, sont achets des produits de base, parmi lesquels les hydrates de carbone et les
protines vgtales bon march sont importantes.

La pintade, davantage que la poule, est utilise comme cadeau pour les visiteurs.
Offrir un cadeau est considr comme une action enrichissante tout comme une preuve
destime pour le bnficiaire. Les fermiers conomisent frquemment pour se procurer
du matriel agricole et autres quipements et le petit btail sert souvent de compte
dpargne. La descendance (poussins par exemple) est considre comme lintrt de
celui-ci.

Dans beaucoup de rgions africaines, les oiseaux sont vendus pour satisfaire des
dpenses imprvues, par exemple pour acheter la bire et les noix de kola distribues
aux fossoyeurs lors de la mort dun membre de la famille. Les oiseaux habituellement
90 Commercialisation

vendus au sein du troupeau villageois sont: les mles en excdent (coqs et coquelets);
les poulettes; les poules ges ou non productives; les oiseaux de grand gabarit ou sujets
malades. Les jeunes oiseaux sont souvent vendus au dbut de la priode haut risque
pour la maladie de Newcastle.

Prfrences gastronomiques traditionnelles pour la viande des volailles


Il est important de comprendre les prfrences gastronomiques et leur effet sur la
demande du march. En effet, le prix du march pour la volaille leve en libert est
gnralement stable du fait que:
x La viande est considre plus savoureuse et plus succulente que celle du poulet
commercial.
x Le tissu musculaire est plus ferme et ne perd pas sa texture mme dans des plats
requrant une longue cuisson.
x Les oiseaux ne sont pas nourris avec des aliments composs pouvant renfermer
des antibiotiques, des antifongiques, des enzymes, des sulfamides et autres
mdicaments ou composs chimiques de synthses.

En Asie orientale, les poulets nourris avec des substances chimiques ou des composs
pharmaceutiques sont considrs comme thrapeutiquement pauvres, car leur viande ne
se combine pas bien avec le ginseng et autres condiments utiliss pour la prparation
des soupes, spcialement celles prpares la vapeur. Pour ces dernires, les jeunes
poulettes sont prfres aux coquelets et atteignent ainsi un prix suprieur ces
derniers. La femelle est considre plus salutaire et sa viande plus goteuse. La soupe
de poulet la vapeur est rpute apporter virilit et vigueur. Elle est couramment
recommande en Malaisie aux femmes enceintes et aux convalescents.

Dans le cas de production commerciale grande chelle de ayam kampung (poulet


villageois) en Malaisie, les oiseaux locaux sont confins et nourris par aliments
commerciaux; ils atteignent des prix infrieurs ceux obtenus pour les oiseaux locaux
levs en libert. De telles units de production ont un effet sur la valeur de tous les
oiseaux locaux, car les acheteurs prouvent des difficults distinguer les animaux
levs en libert et ceux produits en units commerciales. Cela nempche cependant
pas que le prix de layam kampung continue tre suprieur celui du poulet
commercial normal. Lintroduction en Malaisie de mthodes plus appropries de
vaccination contre la Maladie de Newcastle pourrait rduire les mortalits au niveau
villageois, et susciter ainsi plus dintrt pour laviculture familiale. Si ceci advenait, il
y aurait une augmentation de loffre pour la volaille leve en libert et ses produits, et
le prix de layam kampung produit en units commerciales pourrait continuer chuter.

Dcoupes et Organes
La valeur des oiseaux vendre dans les pays en dveloppement dpend dabord de
loffre disponible, ensuite de lge et du sexe, enfin de la taille ou du poids. Les jeunes
oiseaux, spcialement les coquelets de moins de six mois (pesant maximum 1kg de
poids vif) sont gnralement prfrs par les consommateurs. Ceci parce que les oiseaux
plus grands sont trop chers pour la majorit des mnages, et que les jeunes oiseaux sont
plus tendres tout en prsentant les mme morceaux de choix (pilons par exemple). Le
tableau 9.1 indique les caractristiques des produits avicoles locaux au Bangladesh.
Aviculture Familiale 91

Tableau 9.1 Caractristiques de la volaille locale divagante au Bangladesh


_______________________________________________________________________
Caractristique Moyenne
_______________________________________________________________________
Poids vif, kg. 1.14
% ge carcasse 55
Nb. ufs/poule/an 35 - 45
Poids uf, g. 35 - 39
Eclosabilit des ufs 84 - 87
_______________________________________________________________________
Source: Ahmed, 1994 (Bangladesh Livestock Research Institute)

Quelle que soit leur taille, tous les poulets ont un nombre gal de morceaux de choix
(tels brchets et pilons), ainsi quune proportion similaire de gsiers et dautres abats
apprcis.

Tableau 9.2 Poids des organes et composition de la carcasse du poulet thiopien selon
lge
________________________________________________________________________
Age abattage (mois)
3 4 5 6
_______________________________________________________________________
Poids partie
Corporelle (grammes)
Poids total 502 674 892 1006
Gsier 19,9 24,1 27,7 30,9
Coeur 2,6 3,1 3,8 4,1
Intestin 60,9 67,0 77,4 81,8
Reins 4.6 5.4 5.6 6.4
Foie 15,8 20,0 22,9 25,9
Poumons 4,0 5,1 6,2 6,6
Pancras 1,8 2,0 2,3 2,9
Total Organes 109,6 126,7 145,9 158,6
% Poids corporel 21,8 18,8 16,3 15,3
Carcasse
Os 87 113 123 138
Viande 197 267 331 406
Peau 36 49 59 68
Total Carcasse 320 429 513 612
% Poids corporel 63,7 63,6 57,5 60,8
_______________________________________________________________________
Source: Forssido, 1986.

Acheter de jeunes oiseaux fournit le mme nombre de parties apprcies pour un prix
infrieur. Cela, joint la tendret de la viande, explique la commercialisation plus
92 Commercialisation

leve des jeunes sujets, qui sont galement achets pour le remplacement dans les
troupeaux dcims.

MCANISMES DE LOFFRE POUR LA VIANDE DE POULET ET LES UFS

Suivant la localisation de lhabitation du fermier, les ufs sont, soit achets directement
auprs de celui-ci par le consommateur ou par des ngociants (dtaillants ou
intermdiaires), soit transports par lexploitant au march local. Le rle des
commerants dans la commercialisation des produits avicoles est important. Ceux qui
proviennent des zones urbaines achtent les ufs dans les villages pour les revendre en
ville. Lorsque le transport reprsente un lment important, comme cest le cas dans
beaucoup de rgions africaines, les ufs de pintade, dont les coquilles sont plus solides
sont prfrs aux ufs de poule. Le prix des ufs est li loffre/demande, au risque
plus lev de dtrioration ou de moindre utilisation pour lincubation pendant les
saisons chaudes et humides, et la disponibilit de sources alternatives de protines,
telles le poisson. Il existe une tendance incuber moins pendant la saison chaude, en
raison du faible taux dclosions et des maladies des jeunes sujets. Tout comme en
saison froide, cause du risque de refroidissement des poussins.

Les oiseaux sont amens au march une deux fois par semaine pour vente aux
consommateurs locaux ou des ngociants de la place. Les poulets sont transports au
march dans des paniers tresss bien ventils ou dans des clayettes en bois. Ils nont pas
besoin dtre aliments le jour de la vente mais de leau doit leur tre distribue. Si le
trajet au march ncessite huit heures ou plus de voyage, des arrts doivent tre prvus
pour distribuer de leau aux oiseaux. Durant la saison chaude, il est prfrable
deffectuer le transport de nuit ou aux heures fraches du petit matin. Si le prix des
volailles sur pied dpend de leur taille, le prix des ufs dpend de leur nombre.

Il est souvent estim que pour les produits avicoles, les producteurs obtiennent 60 65
pour cent du prix du march. Toutefois au Bangladesh, il a t observ, quils recevaient
en fait beaucoup moins. Le rle des ngociants ou colporteurs est fort important,
puisquils permettent la vente partir du domicile, en prlevant cependant 30 35 pour
cent du prix du march aux dpens du producteur. Cette perte de revenu a incit en
beaucoup dendroits les fermiers mettre en place leurs propres filires de
commercialisation ou leurs coopratives officielles.

FILIRES DE LOFFRE

Une tude de Adeyanju et al. (s.d. monographie non publie) portant sur la
commercialisation des produits avicoles dans lEtat dOndo (Sud-Ouest du Nigria)
dtaille un grand nombre de transactions et de participants. Lcoulement typique des
produits du producteur au consommateur est dcrit dans la figure 9.1. La filire locale
commence par le producteur qui vend ses produits aux dtaillants qui pourvoit aux
besoins des consommateurs locaux. Dans la plupart des rgions, les consommateurs
locaux sapprovisionnent aussi directement auprs des producteurs. Lautre filire
implique les grossistes. Ils achtent les produits avicoles directement aux producteurs et
les revendent aux dtaillants lintrieur et lextrieur de lEtat. Ils ont leur base dans
les centres urbains o sont domicilis les consommateurs des cits.
Aviculture Familiale 93

Fig. 9.1 Filires de loffre en produits avicoles dans lEtat dOndo, Nigria

PRODUCTEUR FERMIER

VENDEURS LOCAUX GROSSISTES URBAINS

CONSOMMATEURS LOCAUX DETAILLANTS URBAINS

CONSOMMATEURS URBAINS

GROSSISTES

FRONTIERES INTERETATS

DETAILLANTS URBAINS DES ETATS EXTERIEURS A ONDO

CONSOMMATEURS URBAINS
Source: Adeyanju, et al.(Poultry Farming in Ondo State, s.d. monographie non publiie)

Odi (1990) a dcouvert que les filires de commercialisation pour la volaille fermire
traversaient frquemment les frontires internationales et pouvaient ainsi gnrer des
changes fructueux pour les pays producteurs.

Fig.9.2 Filire de loffre conomique pour la pintade burkinab

MENAGE BURKINABE PRODUCTEUR ($1.33/oiseau)

COLLECTEUR PRIMAIRE (5 10 oiseaux)

COLLECTEUR SECONDAIRE (50 100 oiseaux)

MARCHAND (250 500 oiseaux)

OUAGADOUGOU (5000 oiseaux/voyage)


Station Chemin de fer
25% mortalit
ABIDJAN (3750 oiseaux)
Station Chemin de Fer

CONSOMMATEURS IVOIRIENS ($ 3.90/oiseau)


Source: Odi (1990)
94 Commercialisation

Organisation
Concevoir un plan de commercialisation suppose de fixer les dates auxquelles oiseaux
et ufs seront vendus pour en obtenir le meilleur prix. Mettre un grand nombre
doiseaux en vente au sein dune petite communaut peut dprimer les prix. Mme la
vente de la production dun petit effectif de pondeuses conduites en mode intensif
ncessite une planification pralable. Un troupeau de 20 poules peut produire 1200 ufs
par an, mme un taux de ponte rduit de 35 pour cent. Les prvisions des fermiers
voisins doivent galement tre prises en considration. Si chacun augmente son effectif
et ralise une bonne anne, les prix vont invitablement chuter. Il en est de mme des
fluctuations saisonnires. En Inde par exemple, les ufs sont considrs comme des
aliments producteurs de chaleur et sont consomms en saison froide pluvieuse.
Beaucoup de facteurs peuvent affecter la qualit des ufs (voir tableau 9.3 9.5.) et, par
consquent, le prix que les consommateurs voudront dbourser.

Tableau 9.3 Paramtres de qualit des ufs pour 4 races de poules


_______________________________________________________________________
Caractre Nigria ISA Ethiopie White
Locale Brown Locale Leghorn
_______________________________________________________________________
(Asuquo et al. 1992) (Forssido, 1986)
Poids uf g. 40.6 59.2 46.0 64.0
Jaune % 36.9 26.3 36.8 34.0
Blanc % 52.6 62.8 49.6 53.0
Epaisseur
Coquille, mm 0.30 0.35 0.35 ND
Index jaune 0.36 0.46 ND ND
Fertilit % ND ND 56.4 46.0
Eclosabilit ND ND 42.1 24.1
Index blanc 0.09 0.12 ND ND
Units Haugh 79.8 89.9 ND ND
_______________________________________________________________________

Tableau 9.4 Dure de ponte et qualit de luf chez la poule Nigriane indigne
_______________________________________________________________________
Caractre mois de ponte
2 3 4 5 6 7
_______________________________________________________________________
Poids ufs g. 35,8 37,2 36,9 37,1 39 38,6
Poids jaune g. 14,9 14,7 14,5 14,2 14 14,2
% blanc 47,9 50,8 51,5 52,0 52 53,5
Epaisseur
Coquille, mm. 0,39 0,39 0,36 0,32 0,36 0,35
_______________________________________________________________________
Source: Olori and Sonaiya, 1992b
Aviculture Familiale 95

Tableau 9.5 Qualit des oeufs de diffrentes couleurs de coquille chez la poule
Nigriane indigne
_______________________________________________________________________
Caractre Brune Brun Clair Blanche
_______________________________________________________________________
Poids uf g. 38,9 37,1 37,0
Poids jaune g. 14,5 14,0 14,8
Poids coquille g. 3,78 3,58 3,51
Poids blanc g. 20,6 19,6 18,8
Coquille % 9,77 9,67 9,49
Jaune % 37,4 37,8 39,9
Blanc % 52,3 52,8 50,8
Epaisseur
Coquille, mm. 0,37 0,37 0,35
Surface, cm2. 52,6 50,9 50,8
_______________________________________________________________________
Source: Olori and Sonaiya, 1992a

CONSIDRATIONS SUR LA QUALIT DE LOEUF

La qualit dtermine lacceptation dun produit par des acheteurs potentiels. La qualit
des ufs et sa prservation durant le stockage est fonction de sa structure physique et de
sa composition chimique. Un aperu fondamental des plus importants facteurs de
maintien de la qualit de luf est prsent ci-aprs.

Composition de luf
Luf est compos de la coquille, de deux membranes coquillres, du blanc (ou
albumen) et du jaune. La coquille est poreuse et permable lair et la vapeur deau
mais est trs rsistante linvasion par micro-organismes, tant quelle reste propre et
sche. Une fine enveloppe extrieure appele cuticule protge la coquille mais,
malheureusement, disparat aisment par lavage. Aprs la ponte, le contenu de luf se
contracte, la fois par refroidissement et par vaporation de leau. Afin de compenser
cette perte,lair pntre travers les pores, ventuellement avec des impurets prsentes
sur la coquille, telles que bactries ou champignons. Un espace se dveloppe entre les
deux membranes, du fait que lexterne est attach la coquille et linterne au blanc. Cet
espace sappelle la chambre air et se trouve gnralement au gros bout de luf. Le
blanc duf prend la forme dun sac dalbumine paisse entourant le jaune, avec une
fine albumine plus fluide situe entre ce sac et le jaune du ct interne et aussi entre le
sac et la coquille du ct externe. Ces couches forment une barrire empchant le jaune
de toucher la coquille et fournissent la nourriture lembryon. Le blanc de luf
possde des proprits antibiotiques spcifiques protgeant galement le jaune. Luf
possde galement deux cordons fibreux: les chalazes attaches au jaune dune part et
aux extrmits de luf dautre part. Elles maintiennent le jaune au centre de luf et
lempchent ainsi de toucher la coquille.

Le poids dun uf de poule villageois est denviron 35 g Les races hybrides


commerciales pondent des ufs d peu prs 58 g. La coquille reprsente
96 Commercialisation

approximativement 11 pour cent du poids de luf; le reste est la portion comestible,


dont 36 pour cent pour le jaune et 64 pour cent pour le blanc.

Qualit de la coquille
Les ufs de forme exceptionnelle sont plus facilement endommags durant les tapes
de la commercialisation et les consommateurs ne les apprcient pas. De fines flures de
la coquille, qui ne provoquent pas de fuites, sont habituellement dtectes par mirage.
Les ufs fls doivent tre vendus pour consommation immdiate car leur dure de
conservation est limite. Les ufs qui fuient, aprs rupture des membranes et de la
coquille sont gnralement consomms en famille. Les ufs cassants, fine coquille
sont galement impropres au transport. Les ufs sales doivent tre nettoys sec ou par
voie humide et prsentent ainsi un risque plus lev pour la commercialisation car la
cuticule protectrice a disparu.

La couleur de la coquille nest pas un tmoin de la qualit de luf, mais, compte tenu
de la prfrence du consommateur soit pour le brun, soit pour le blanc, il convient den
tenir compte pour la commercialisation.

Qualits du jaune et du blanc de loeuf


Le consommateur prfre lodeur et le got de luf frais normal. Le jaune doit tre
rond, ferme et de couleur accentue. Les prfrences locales peuvent varier et peuvent
tre facilement ajustes en ajoutant et en diminuant la part de verdure dans la ration ou
son supplment. Le blanc normal a une couleur lgrement jauneverdtre et la couche
paisse dalbumine est un peu nuageuse.

Les consommateurs napprcient pas les petites taches de sang, dont la couleur peut
varier du rouge au gris et la taille dun petit point jusqu un centimtre carr. Ces
macules proviennent de petites hmorragies lors de la libration de lovule (jaune)
partir de lovaire de la poule. On peut les retrouver dans le blanc ou adhrant au jaune.

Dtrioration
Aprs la ponte, la qualit interne de luf se dgrade un rythme qui dpend du temps
et des conditions dentreposage, telles la temprature, lhumidit relative (HR) et la
prsence de substances fortement odorantes ou dautres produits alimentaires dans le
local de stockage. Les ufs stocks 27 29C pendant 7 10 jours vont extrioriser
les mmes modifications de dgradation que ceux entreposs 1C et 85% HR
pendant plusieurs mois. Ces changements proviennent de la perte deau et de dioxyde
de carbone (CO2) ainsi qu labsorption dodeurs volatiles partir de lenvironnement.

Perte dhumidit
Comme luf contient environ 74 pour cent deau et que sa coquille est poreuse, les
pertes dhumidit sont aises. Une diminution de poids de 2 3 pour cent est commune
pendant la commercialisation et est rarement note par le consommateur. Lorsque les
pertes excdent ce taux, la chambre air saccrot significativement par contraction du
contenu de luf. Cette perte peut tre rduite si lhumidit est leve et la temprature
rduite pendant lentreposage. Enrober luf avec de lhuile ou dautres substances peut
galement attnuer cette perte. Les conditions idales de stockage sont moins 1C et 80
85 pour cent dHR. A 10C ou plus, lHR optimale est de 80 pour cent. Il existe un
Aviculture Familiale 97

risque denvahissement par moisissure si lHR est trop leve. Les plateaux ufs en
pulpe de papier ou autres matriaux qui absorbent lhumidit acclrent les pertes deau
partir des ufs, Une temprature aussi basse que 10C est difficile maintenir dans
les rgions rurales de beaucoup de pays en dveloppement. Des tempratures entre 10 et
15C sont plus pratiques mais, mme en ce cas, des prcautions doivent tre prises
lorsquon transfre les ufs depuis un local froid vers lextrieur o rgne une
temprature plus leve, car cela provoque frquemment une condensation deau sur la
coquille et par consquent des risques de dveloppement de moisissures suivi
ventuellement de pourriture.

Contamination microbiologique
Lors de la ponte, le contenu de luf est gnralement strile. La cause principale de
contamination rside dans le lavage. Humidifier la coquille permet aux micro-
organismes de pntrer et de se multiplier lintrieur de luf. Les risques indicateurs
sont des taches vertes, noires et rouges, une odeur de moisi et aigre. Les bactries
responsables ne peuvent pntrer si la coquille est maintenue sche. Si les ufs
shumidifient aprs condensation, par exemple aprs transfert dune atmosphre froide
dans un local chaud, les microbes sont alors mme de traverser la coquille.

Pollution
Les ufs, plus spcialement les jaunes, sont facilement contamins par des substances
fortement odorantes, comme les dsinfectants, les savons, le mazout, le ptrole,
lessence, la peinture, le vernis et les protecteurs de bois. Certains aliments, comme
loignon et les agrumes, peuvent transmettre leur odeur aprs quelques jours de contact.

CONTRLE ET MAINTIEN DE LA QUALIT DES UFS

Le maintien de la qualit des ufs est un problme majeur pour ceux qui sont impliqus
dans leur commercialisation. Limportance de lutilisation dun bon conditionnement,
entreposage et moyen de transport sera dtaille dans dautres sections ci-aprs.

Les ufs souills par des matires fcales ou par le contenu des ufs fissurs, ainsi
que les ufs casss se dgradent plus rapidement que les ufs propres. Seuls les ufs
de bonne qualit seront envoys la vente. Le moyen le plus simple de triage est de les
diviser en trois catgories: fls, sales et propres. Les ufs fls seront mangs ou
vendus localement pour consommation immdiate. Les ufs sales seront nettoys et
vendus localement pour consommation court terme, tandis que les ufs propres
pourront tre envoys vers les filires commerciales plus importantes. Dans certaines
rgions, prfrence est donne certaines couleurs ou tailles, et le triage devra en tenir
compte.

Facteurs de production pouvant affecter la qualit de luf


Les facteurs de production les plus importants pouvant affecter la qualit de luf sont:
x race et ge du troupeau;
x type dalimentation;
x incidence pathologique;
x contrle de la gestion du troupeau de ponte;
x contrle de la manipulation des ufs.
98 Commercialisation

Race et ge du troupeau de ponte


Leffet de la race sur luf intervient sur plusieurs aspects, dont la couleur, lpaisseur
et la texture de la coquille, lincidence de tches sanguines, et la quantit dalbumine
paisse. Si les leveurs commerciaux attachent une attention constante ces facteurs, ce
nest que vaguement que les fermiers peuvent les contrler.

Aprs la premire saison de ponte, les poules produisent des ufs coquille de
moindre qualit avec une paisseur dalbumine plus faible, mme si les ufs ont une
taille plus leve. Le taux de ponte est galement moins lev. Pour ces raisons, ainsi
que pour la valeur leve de carcasse de la poule ge dans la plupart des pays en
dveloppement, il est recommand de rformer les poules aprs 12 18 mois de ponte.

Type dalimentation
Une ration quilibre fournie aux poules conduites en confinement intensif doit leur
procurer les nutriments suffisants pour produire un uf avec une bonne paisseur de
coquille et une bonne coloration du jaune. Un niveau lev de mas jaune, de farine de
feuilles ou dherbe va assurer cette dernire. Le carbonate de calcium pourra tre fourni
sous diverses formes: calcaire ou coquilles (voir Chapitres 3: Ressources alimentaires et
4: Gestion). Il peut tre mlang la ration ou supplment en libre choix. Il est souvent
plus pratique de le distribuer dans un rcipient spar.

La farine de poisson gras introduite dans laliment des pondeuses peut confrer une
saveur de poisson aux ufs.

Incidence pathologique
Bronchite infectieuse et maladie de Newcastle peuvent, toutes deux, infrer sur la
qualit de luf, en provoquant des dformations de la coquille et des dfauts dans la
qualit du blanc. La bronchite infectieuse induit des sillons longitudinaux le long du
grand axe de la coquille.

Contrle de la gestion du troupeau de ponte


Dans beaucoup de pays en dveloppement, persiste la croyance quun coq est ncessaire
pour stimuler la ponte des poules. Ceci nest pas fond. La prsence dun mle actif
conduit la ponte dufs fertiles, porteurs dembryons, et ceci rduit la stabilit
ncessaire au stockage des ufs. Mme aprs le retrait du mle, les ufs restent fertiles
pendant six semaines car le sperme est entrepos et libr progressivement partir de
cavits particulires situes dans loviducte de la poule. Sil existe une demande pour
des ufs fertiles, il conviendra alors de placer des coqs auprs des pondeuses. Les ufs
non fertiliss ont une dure de vie plus longue et sont ds lors plus adapts la
commercialisation.

Le nombre dufs sales peut tre rduit, en nettoyant rgulirement les nids et en
remplaant la litire. Dans tous les types de logement, une rcolte frquente des ufs
au moins quatre fois par jour dans les rgions tropicales humides rduira lincidence
dufs sales.
Aviculture Familiale 99

Gestion du contrle de la manipulation des ufs

Contrle de la Temprature
Le moyen de protection des ufs le plus efficace est de les conserver entre 10 et 15C
pendant la manutention, le transport et la commercialisation. Des rcipients et/ou
vhicules pourvus de systmes isolants peuvent maintenir des tempratures fraches sur
des longs parcours. Une couche externe de paille sur un panier peut galement s avrer
utile. Par temps chaud, lorsquil nexiste pas de systme de stockage au frais, les ufs
seront transports, au march au moins tous les trois jours. Ils ne seront jamais laisss
au soleil ni dans un local trop chaud. Si disponibles, la climatisation ou la ventilation
lectriques seront employes. Cependant, si lair conditionn a lavantage du
refroidissement, il prsente aussi linconvnient de desscher le contenu de luf; aussi
des sacs humides seront placs comme rideaux dans le local de stockage, afin de
diminuer cet effet dshydrateur. Si ventilateurs ou climatiseurs ne sont pas disponibles,
des locaux ombrags bien ventils ou des caves seront opportuns.

Traitement des ufs sales


Une coquille duf possde un revtement naturel protecteur (cuticule) qui rsiste la
pntration des bactries et retient lhumidit interne. Laver des ufs leau retire cette
protection et, donc, les ufs lavs doivent tre consomms le plus tt possible. Les ufs
nettoys soit sec, soit par voie humide, doivent tre vendus sparment des ufs
naturellement propres, car leur dure de stockage est plus courte. La cuticule est une
substance lipoprotique et son absence peut tre dtecte avec une simple lampe
rayons UV. Les ufs lavs apparaissent rouges sous lumire UV tandis quune couleur
bleue confirme la prsence de la cuticule.

Nettoyage sec
Mme avec une bonne conduite du troupeau, certains ufs seront souills. Les risques
du nettoyage leau ont dj t mentionns. Frotter lgrement avec un fin papier de
verre ou un tissu rugueux est prfrable. Le papier de verre ou papier meri peut tre
enroul autour dun morceau de caoutchouc dur pour nettoyage manuel sec. La laine
dacier, les ponges de nylon ou les brosses rcurage peuvent galement semployer.
Il faut faire attention ne pas trop endommager la cuticule protectrice recouvrant la
coquille. Seules les taches les plus sales seront nettoyes. Il existe galement des
nettoyeurs sec moteur disponibles sur le march. Le modle le plus simple consiste
en un rouet de mousse de caoutchouc. Un mlange de colle et de sable est appliqu
priodiquement sur le rouet contre lequel loprateur appuie luf afin de le nettoyer.

Nettoyage humide
Le lavage des oeufs nest prconis quen conditions trs bien contrles. Il convient
que la temprature de leau de lavage (38 43C) ne soit jamais infrieure celle de
luf. Ceci afin dviter que cette eau soit absorbe par les pores lintrieur de luf
par contraction du contenu de ce dernier, ainsi que cela se produit si luf est en contact
avec de leau froide. De plus, la machine laver doit pouvoir maintenir les dtergents,
dsinfectants et antiseptiques de leau un niveau optimal. Les seuls produits chimiques
utilisables sont ceux qui ne transmettent aucune odeur particulire. Leau doit tre
change frquemment. Aprs lavage, la coquille sera pasteurise en la plongeant
pendant quelques secondes dans de leau porte 82C, puis rapidement sche avec de
100 Commercialisation

lair chaud avant emballage et tiquetage prcisant que les ufs ont t lavs .
Lutilisation du lavage est complexe et coteuse; elle ne se justifie que pour de grandes
units, o mme l, elle prsente certains risques.

CLASSEMENT DES UFS PAR QUALITE

Qualits internes

Mirage
Casser luf est la seule mthode prcise pour contrler intgralement lintrieur. Ceci
ne peut seffectuer que sur un chantillon limit. Le mirage peut dvoiler certains
aspects internes sans briser luf. Il consiste inspecter luf par transparence en
utilisant une source lumineuse suffisamment puissante pour illuminer le contenu.
Diffrents types de lampes peuvent tre employs mais leurs caractristiques
essentielles sont similaires. Une lampe incandescence de 25 50 Watts est enferme
dans une bote pourvue dun trou denviron 3cms par lequel passe la lumire et sur
lequel luf est dpos et retourn. La bote est gnralement pourvue dun autre trou
afin de fournir de la lumire loprateur si le local est trs sombre. La chambre
air reprsente lindicateur le plus visible de la qualit interne de l oeuf. En faisant
tourner luf devant le trou du mire-oeufs, la qualit du jaune et du blanc peut tre
estime partir de leur mouvement. Des oprateurs expriments peuvent mirer 24
ufs la minute. Les points les plus importants observer sont rsums ci-dessous.

Blanc
Les caractres dune bonne qualit du blanc sont son intgrit, son paisseur et sa
transparence. Lorsque le sac dalbumine paisse est robuste et sain, il est plein et adhre
au jaune lintrieur de ses diverses couches. Lorsque la couche paisse dalbumine se
dtriore, son contenu va se dverser dans la cavit dlimite par la couche fine. Le
jaune va se mouvoir plus librement avec le risque de rentrer en contact avec la coquille
et dtre contamin par les micro-organismes extrieurs. Un albumen sain est
transparent. Il peut se dcolorer ou devenir nuageux par pourriture ou surchauffe lors
dun lavage entranant une coagulation partielle.

Jaune
Les caractres dune bonne qualit du jaune sont la confinement au sein de la couche
paisse dalbumine, une forme bien arrondie, une couleur jaune-orange et labsence de
taches. Comme dcrit ci-dessus, le confinement de luf au sein de lalbumen le
protge de contaminants extrieurs. Une forme sphrique dnote une membrane solide.
Lorsque luf est expos des tempratures leves et la dshydratation, le jaune se
dtriore et devient plus gros et plus plat. Les consommateurs prfrent les jaunes
nuance orange sans tches. Les tches peuvent provenir du dveloppement dun
embryon (couleur rougetre), de sang provenant de lovaire de la poule ou de petites
particules libres partir de loviducte pendant la formation de luf (rouges et brunes
respectivement); de moisissures (grises ou noires) ou de putrfactions bactriennes
(bleues, violettes, vertes ou rouges). Les seules tches risques sont celles provoques
par les moisissures et les bactries.
Aviculture Familiale 101

Chambre air
Les caractres dune bonne chambre air sont ses dimensions rduites, sa faible
profondeur et sa position correcte au gros bout de luf. Une petite taille et un
dveloppement superficiel tmoignent de la fracheur de luf, ou de son bon
entreposage, du fait de la faible perte dhumidit. Sa position fixe au gros bout
indiquent que les membranes entourant la chambre air nont pas t endommages
(manipulation brutale par exemple).

Il existe habituellement une relation entre la profondeur de la chambre air et dautres


aspects qualitatifs. Cependant un uf entrepos haute temprature et un degr lev
dhumidit peut prsenter une bonne profondeur de la chambre air (car lhumidit
importante maintient le contenu en eau), tout en se dtriorant sous dautres aspects, du
fait de la temprature leve,

La chambre air peut compltement disparatre ou se mobiliser lintrieur de luf.


Elle peut se remplir dalbumen si la membrane interne sest rompue. Si la membrane est
simplement fragilise, la chambre air peut se dplacer librement autour de loeuf. Ceci
peut se produire souvent lorsque les ufs sont transports sur mauvaises routes ou si
loeuf a t conserv avec le petit bout au-dessus. Ceci ne prjuge pas de la fracheur du
produit.

Qualits de la coquille
Avant mirage, il convient destimer les qualits de la coquille. Les ufs sales, casss,
fls, coquille fine rugueuse ou malforme, seront commercialiss en consquence.
Ces points ont t largement abords dans la section antrieure traitant des facteurs de
production affectant la qualit de luf.

OPTIONS DE VENTE: UFS CLASSS PAR CATGORIE OU VENDUS EN


VRAC

Les ufs peuvent tre vendus par catgories ou en vrac. La premire option suppose
que chaque uf soit pes individuellement et rang par classe de poids (gnralement
petit, moyen et grand). Les ufs sont ensuite emballs en cartons de 10 12 units, et
vendus au prix dfini par classe. La vente en vrac ne suppose pas de pese pralable
avant lemballage et le prix est fix au kilogramme, tout comme pour la plupart des
autres produits alimentaires.

Les consommateurs des pays dvelopps sont habitus acheter leurs ufs classs par
catgories et emballs par cartons. Classer les ufs par taille requiert une machinerie
complexe apte mesurer et conditionner, quil convient de rgler et tester
rgulirement, tout comme il faut contrler les chantillons des diffrentes catgories d
ufs dans les boutiques de dtail.

Dans les pays en dveloppement, o nexistent pas les capacits financires ou


administratives pour effectuer de telles mesures de contrle, la vente des ufs en vrac
reprsente la meilleure option. Si, sur le march, existe une balance pour peser des
aliments tels le riz ou le mas, elle peut galement servir peser les ufs afin de les
vendre en ballots ou en sachets. Une telle faon de faire simplifie galement la situation
102 Commercialisation

lorsque la standardisation des rcipients et des catgories nest pas encore au point. Elle
permet galement au consommateur de pouvoir effectuer des comparaisons entre les
diffrents produits alimentaires.

Dans la plupart des pays en dveloppement, les ufs sont vendus par quantits plutt
que par poids, ce qui pnalise le producteur de gros ufs. Ceci ne reprsente pas un
vritable problme, puisque les races locales pondent gnralement des ufs petits.
Cependant, avec le dveloppement du march et laccroissement de la demande en
zones priurbaines pour une diffrenciation en classes, base sur la disponibilit de
races hybrides commerciales (pondant des ufs plus gros), la dcision de choisir entre
la vente par catgories ou en vrac doit tre envisage.

TRANSPORT DES UFS

Les quatre problmes poss par le transport des ufs sont:


x La protection contre les dommages mcaniques qui peut tre assure en vitant le
secouement excessif plus spcialement sur mauvaises routes et en pourvoyant les
transporteurs bicyclette damortisseurs.
x La protection contre une manipulation inadquate en procurant des moyens de
chargement appropris afin de faciliter le transport.
x La protection contre les mauvaises odeurs.
x La protection contre lexposition aux tempratures leves.

Mthodes demballages
Les ufs peuvent tre emballs sous un rembourrage de balles de riz ou de bl, de paille
hache, dans des paniers ou cageots fermement enserrs. Ceci rduit fortement la casse
durant le transport. En Iran, de longues botes plates, chacune contenant environ 100
ufs enfouis dans de la paille hache, sont communment utilises pour le transport
jusqu la capitale distante de plus de 1000 kms. Les botes sont vhicules en camions
sur de mauvaises routes avec une casse dpassant rarement cinq pour cent. La difficult
principale dun tel systme est la standardisation du nombre dufs par bote. Les
expditeurs et les rceptionistes vont autrement perdre beaucoup de temps compter et
remballer pour sassurer que le nombre soit correct avant paiement.

Lemballage standard pour le transport est le plateau de 30 ufs fait de pulpe de


papier et qui contient six ranges de 5 ufs. Ces plateaux sont empilables quils soient
vides ou remplis. Une caisse standard de 360 ufs (30 douzaines) est compose de deux
piles de six plateaux. Des plateaux de plastic lavables et rutilisables sont aussi
disponibles. Les caisses sont gnralement fabriques en contreplaqu. Des demi
caisses dune contenance de 180 ufs (15 douzaines) sont galement courantes et
fabriques en carton ondul.

Protection de la qualit durant le transport


La gamme des tempratures acceptables dpend de la dure du transport. En Europe,
pour un transport de deux trois jours en vhicule rfrigr, la temprature
recommande est de moins un plus trois degrs Celsius. Cependant dans les pays en
dveloppement, les vhicules rfrigrs ne sont pas courants. Mme en ce cas, des
Aviculture Familiale 103

prcautions sont ncessaires afin dviter la condensation dhumidit sur les ufs
dplacs de la caisse rfrigre vers lair chaud et humide de la boutique de dtaillant.

Au Pakistan, a t utilis un systme de refroidissement, consistant en des ventilateurs


brassant lair vers les ufs travers un rcipient contenant du sel et de la glace. Ceci
pour le transport par train sur les 1600 kms entre Peshawar et Karachi, pendant lequel la
temprature estivale extrieure varie de 38 47C.

Le transport rfrigr est coteux. Lors de lestimation financire de linstallation


dun tel systme, il convient de considrer avec attention le volume des produits
rfrigrs commercialiser. Le cot de linvestissement doit tre amorti sur cinq
annes. Le transport dautres produits ne peut tre envisag que sils ne peuvent
transmettre des odeurs indsirables. Ainsi doit tre pareillement considr le
chargement dautres marchandises ne requrant pas ncessairement une rfrigration.

Les transports publics, comme le train ou le bus, constituent les moyens de


dplacement les plus courants dans les pays en dveloppement. La connaissance des
besoins particuliers ncessaires au transport des ufs, abords ci-dessus, pourra aider
loprateur prserver leur qualit, quel que soit le moyen utilis.

CONSERVATION DES UFS

Tous les systmes dentreposage des ufs doivent rpondre aux critres suivants:
x La perte deau par vaporation doit tre rduite au minimum.
x La croissance des bactries et moisissures doit tre entrave.
x La qualit interne de luf doit tre prserve (rvle par une bonne proportion
du blanc pais, dun jaune arrondi et ferme, et une excellente saveur des deux
composants)

Les deux premiers critres peuvent tre satisfaits pour des priodes de trois cinq mois
en:
- recouvrant les ufs dhuile ou de silicate de sodium,
- les immergeant dans une solution dhydroxyde de calcium,
- les dposant dans un milieu desschant constitu de matriaux comme le son, la
poussire de tourbe, la chaux, le sel, la cendre de bois.
Toutefois, les trois conditions ci-dessus peuvent tre satisfaites par la seule
rfrigration, qui, lorsquelle est disponible, reprsente la meilleure mthode de
conservation.

Ci-dessous, sont dcrites quelquesunes des mthodes traditionnelles de conservation


en labsence de rfrigration. Les deux premiers systmes sont bass sur le
refroidissement par vaporation. Ceci nest efficace quen tropiques chauds et secs, car
les tropiques chauds et humides ne permettent pas une vaporation suffisante et leffet
de refroidissement sont insuffisant. Lorsque aucun de ces systmes ne peut semployer,
le dclin de la qualit des ufs est invitable et, ds lors, ceux-ci seront transports le
plus rapidement possible vers le consommateur.
104 Commercialisation

Pot dargile
Les ufs sont dposs dans un pot dargile enterr jusquau col dans le sol dune aire
ombrage, Le pot est ferm hermtiquement afin que leau ne puisse y pntrer. Le sol
avoisinant est arros mais sans laisser de flaques. A lintrieur du pot, on place de la
paille ou une petite natte afin de protger les ufs et de les prserver de toute infiltration
ou suintement deau. Les ufs sont dposs dans le pot ds leur rcolte, et recouverts
dun tissu et de paille humide. A cause de leffet refroidissant de lvaporation, la
temprature de lintrieur du pot est souvent infrieure de 5 6 degrs Celsius celle de
lextrieur. Une variante de la mthode, en usage au Soudan, est denfouir dans le sol un
pot de terre jusqu mi-hauteur. Une couche de 7cms dun mlange de sable et dargile
est ensuite dispose autour du pot jusqu son col et maintenue humide par arrosage. La
partie interne du pot est recouverte dherbe. A lintrieur, les ufs sont recouverts dun
tissu fin pour maintenir la circulation de lair. Ce refroidissement par vaporation dans
le climat soudanais chaud et sec rduit souvent la temprature des ufs de huit degrs.
Les ufs sont retourns tous les jours afin dempcher les jaunes de toucher la coquille,
ce qui acclrerait le processus de dgradation.

Sac humide rfrigrant


Il sagit dune autre mthode utilisant le principe de refroidissement par vaporation. Le
sac est maintenu humide par coulement dun filet deau partir dun plateau qui le
surplombe. Un systme lgrement plus sophistiqu utilise des tuyaux perfors relis
un rservoir deau. Afin de prvenir lapparition de moisissure, le sac est pralablement
tremp dans une solution de sulfate de cuivre (CuSO4) raison de 15 grammes /litre.

Enrobage dhuile
Une fine pellicule dhuile bouche les pores de la coquille et rduit ainsi lvaporation et
la souillure du contenu de luf. Pour ce faire, les ufs sont plongs dans un panier
mtallique, contenant de lhuile faiblement chauffe environ 11C de plus que les
ufs. Sont utilises des huiles minrales faible viscosit, sans odeur ni couleur. En cas
de non-disponibilit, on peut utiliser nimporte quelle huile minrale ou, la rigueur,
une huile de cuisson ne rancissant pas trop aisment. Pour rutiliser lhuile, il convient
de la filtrer et de la chauffer 116C pour la striliser. Quatre litres dhuile peuvent
revtir environ 7000 ufs. Les ufs ainsi huils peuvent tre conservs au moins trois
semaines, plus longtemps moins de 10C, et moins longtemps plus de 21C. Pour
conserver forte chaleur, les ufs seront traits dans les quatre six heures aprs la
ponte.

Pte de silicate au de sodium


Il sagit dune pte ou onguent de sodium mlang de leau. Loprateur sen frotte les
mains pour rouler ensuite les ufs entre les paumes afin de transfrer une couche
protectrice de pte sur les coquilles.

Solution de silicate de sodium


Un demi-litre de la pte ci-dessus est mlange 5,3 litres deau pralablement bouillie
puis refroidie; 100 ufs sont verss dans un pot ou une jarre de 25 litres et recouverts de
cette solution. Le pot est recouvert et gard dans un endroit frais et ombrag. Les ufs
peuvent tre ainsi conservs de un six mois.
Aviculture Familiale 105

Eau de chaux
Il sagit dune solution dhydroxyde de calcium (Ca [OH] 2), un alcali lger, dont la
chaux vive reprsente lingrdient principal. Son nom chimique est loxyde de calcium.
Au Bangladesh, elle est connue sous le nom de choon et est couramment utilise dans
les mlanges de noix de btel mches par de nombreuses populations tropicales.
Loxyde de calcium est produit en brlant du calcaire feu vif, ce qui provoque le
dgagement du dioxyde de carbone (CO2) pour laisser le produit final sous forme de
poudre blanche. On produit leau de chaux en dissolvant celle-ci dans leau. Il en rsulte
une partie soluble et un dpt. Pour fabriquer six litres deau de chaux, il faut mlanger
2,3 kg doxyde de calcium dans six litres deau pralablement bouillie puis refroidie.
Elle doit ensuite reposer pendant une nuit afin que se forme le dpt. Les ufs et la
partie claire de la solution sont verss dans un rcipient, recouverts et gards au frais.
Les ufs peuvent ainsi se conserver pendant plus dun mois. Avant 1970, les ufs
taient ainsi transports par train du Bangladesh, (alors Pakistan Oriental) au Pakistan
(Occidental) et le voyage durait environ un mois par temprature leve. Les ufs
taient gards dans des jarres en terre contenant de leau de chaux, sans altration de
leur qualit.

Immersion en eau chaude


Cette mthode, soigneusement contrle quant la dure, a un effet pasteurisant,
dtruisant lembryon des ufs fertiles, certaines bactries de la coquille et stabilisant la
qualit du blanc. Des effets quivalents peuvent tre obtenus par les combinaisons
temps / tempratures suivantes:
x 35 minutes 49C;
x 15 minutes 54C;
x 10 minutes 59C;
x 5 minutes 60C;
La mthode requiert un quipement spcial et un contrle rigoureux.

Sel, argile humide et cendres


Les ufs revtus dune telle mixture peuvent tre conservs pendant un mois. Il sagit
dune mthode pratique en Chine depuis des sicles.

Riz cuit sal


Cest galement une mthode pratique depuis longtemps en Chine qui permet de
conserver les ufs pendant six mois.

Chaux, sel, cendres de bois et th


Autres mthodes pluricentenaires chinoises; lemploi de ce mlange permet de garder
les ufs pendant plusieurs annes. (century eggs).
Chapitre 10
RECHERCHE ET DVELOPPEMENT

EN AVICULTURE FAMILIALE

Un ventail assez large dapproches aptes amliorer la productivit de laviculture


familiale a t expriment. En mars 1987, une Consultation FAO dExperts sur le
dveloppement de la volaille villageoise, tenue Dhaka, Bangladesh, a examin ces
approches afin didentifier les raisons de leurs succs ou de leurs checs. Un problme
majeur a rsid dans la dfinition ou la comprhension des diffrents systmes de
production avicole villageoise. Une certaine confusion existait entre les systmes
divagants faible technologie rencontrs au Bangladesh, Myanmar et Bhutan et les
petits systmes de production semi-intensifs ou intensifs (quelques centaines doiseaux)
pratiqus en Inde, Malaisie et Indonsie. Ces diffrences amenrent le facilitateur de la
Consultation (W. Bessei, 1987) proposer une classification des diffrents systmes
asiatiques de production avicole (tableau 10.1.). Le tableau dcrit lvolution logique
entre les niveaux 0 3 et il fut reconnu par la consultation que la raison de lchec de
nombreux projets de dveloppement provenait du manque de perception des contraintes
imposes chaque niveau. Les contraintes elles-mmes (nonces au tableau 10.2),
dmontrent le besoin dune prise de conscience progressive des fermiers sur la ncessit
dalimenter et dabreuver rgulirement leurs volailles, de nettoyer les logements, et de
prendre soin des jeunes poussins. Comme premire dmarche critique, la Consultation
recommand que soient encourags et assists les fermiers changer leurs systmes
traditionnels. Prenant en compte la pnurie chronique de personnel et de moyens de
transport au sein des services de vulgarisation des pays en dveloppement, la
Consultation a soulign limportance de slectionner des fermes pilotes pouvant servir
de modle et deffet multiplicateur auprs des exploitations voisines et des villages. A
cause probablement de la comprhension trs htrogne du dveloppement de la
volaille rurale, il apparat que plusieurs des mthodes proposes soient mieux adaptes
de petites units daviculture intensive.
Aviculture Familiale 107

Tableau 10.1 Effets de lamlioration de laviculture rurale sur la production, la


reproduction et le prlvement par poule et par an
_______________________________________________________________________
Systmes de production Nombre Nombre Nombre
ufs/poule/an
de poulets doeufs pour
dun an vente et
consommation
_______________________________________________________________________
Traditionnel 20 - 30 2-3 0
Niveau 0: picorage
pas de distribution rgulire
daliment et deau
logement de nuit mdiocre

Traditionnel amlior 40 - 60 4-8 10 - 20


Niveau 1: eau et aliment
de complment, logement
correct, soins pendant les
premires semaines,
vaccination MNc.

Niveau 2: comme niveau 1 100 10 - 12 30 - 50


avec aliment, abreuvement,
et logement amliors,
dparasitage, vaccinations
multiples.

Niveau 3: (semi-intensif) 160 - 180 25 - 30 50 - 60


comme niveau 2 avec races
amliores et aliments
complets
_______________________________________________________________________
Source: W. Bessei, 1987.

Les mthodes prconises refltent les processus ncessaires au transfert de nouvelles


technologies existantes. A titre dexemple, des primes furent juges essentielles pour
encourager les fermiers participer aux programmes, ce qui laisse prsumer que ces
programmes ne rpondaient pas aux priorits des exploitants. Le choix des fermiers fut
identifi comme un facteur majeur dans le succs ou lchec dun programme. De telles
compensations peuvent souvent conduire la slection dindividus qui ne sont pas
vritablement intresss par laviculture. Pour assurer la slection de candidats sincres,
la procdure suivante fut recommande:
x Le service de vulgarisation choisira des fermiers bien connus pour leur intrt en
aviculture.
x Les primes ne seront jamais attribues en espces.
108 Recherche et dveloppement en Aviculture Familiale

x Les privilges seront toujours subordonnes un engagement pralable du


bnficiaire. Par exemple, lquipement avicole ne sera fourni quaprs la
construction du poulailler par l exploitant ses propres frais.
x La fourniture des intrants, tels que poussins dun jour, ufs fertiles, aliments,
vaccins, sera faite prix cotant.

Lapproche ferme pilote risque lchec si son installation requiert une quantit
importante dapports trangers, tels que matriaux de construction et quipement. Dans
ce cas, les fermes voisines se dcouragent facilement car elles nont pas accs de tels
intrants.

Tableau 10.2 Contraintes techniques et besoins de formation en aviculture familiale


_______________________________________________________________________
Contrainte Mesures pdagogiques requises
_______________________________________________________________________
Risque de maladie Conseil en hygine et sant, formation de
vaccinateurs.

Prdateurs Conseil sur le contrle des prdateurs.

Logement Conseil sur lamlioration du logement des volailles.

Abreuvement et alimentation. Conseil sur la disponibilit des ressources


alimentaires locales et sur leurs combinaisons; sur la
fabrication dabreuvoirs et de mangeoires; sur
lapprovisionnement rgulier en aliment et en eau.

Potentiel gntique Introduction de races amliores indignes (et si


ncessaire, exotiques) et conseil sur les particularits
de leur conduite.

Commercialisation. Conseil sur la manutention et la conservation des


ufs, et formation des fermiers la gestion et la
commercialisation collective.
_______________________________________________________________________
Source: W. Bessei, 1987.

Afin dtre efficaces dans le transfert de linformation, les fermes pilotes devraient tre
responsables de fonctions particulires ce qui les maintiendrait obligatoirement en
contact avec dautres possesseurs de volailles. Des aviculteurs pilotes ont t forms
avec succs au Bangladesh et au Burkina-Faso afin dy vacciner respectivement poulets
et pintades. Les fermiers pilotes pourraient galement tre utiliss pour procurer des
lignes amliores ou pour lever des poulettes destines la distribution, de telle sorte
que plusieurs fermes du voisinage soient rgulirement approvisionnes en intrants et en
information.
Aviculture Familiale 109

CONTRAINTES AU DVELOPPEMENT

Contraintes socioculturelles
Une valuation sociologique se rvle galement essentielle dans la dtermination des
stratgies pour le dveloppement. Une valuation conomique est ncessaire mais reste
insufisante elle seule. Ceci est illustr par les ractions divergentes de propritaires de
btail vivant dans le mme environnement conomique.De nombreux facteurs socio-
culturels affectent la production animale. Par exemple, certaines communauts rejettent
le canard, prsum sale et pollueur des ressources en eau. Dautres considrent le
pigeon comme un symbole de paix et de concorde. Chez de telles communauts, la
prsence de pigeons est considre de bon augure, et leur dpart peut prsager une
catastrophe. Par contre, chez dautres populations, les pigeons sont considrs daugure
funeste car ils sont utiliss par les sorciers dans des rituels sinistres.

Une autre contrainte au dveloppement de laviculture consiste dans leur valeur pour
les crmonies ou festivits; comme source de revenu en temps de disette, mais non
comme source de nourriture quotidienne ni de revenu rgulier. Certains considrent la
volaille comme animal de compagnie ou partie intgrante de la famille. Ce nest donc
que lors de larrive impromptue dun visiteur important quil est permis de lutiliser
comme aliment alors quelle peut tre vendue sans regret tout comme peut tre dpens
largent de la transaction.

La prfrence accorde la production cralire, plutt qu llevage, reprsente


une autre contrainte majeure pour le dveloppement de laviculture. Ceci influe sur la
volont daccorder beaucoup de temps, dargent et defforts au btail. Le vol reprsente
une autre entrave importante. Les villageois qui se sont fait voler toutes leurs volailles
peuvent tre fortement dcourags redmarrer leur levage. Un autre obstacle est la
rgle sociale qui dtermine la proprit du btail. Typiquement, lorsque la culture
cralire reprsente lactivit masculine principale, llevage est considr comme une
activit secondaire rserve aux femmes et enfants. Cependant, lorsque les effectifs de
btail saccroissent, lhomme reprend ses droits et la proprit des animaux. Il ne saurait
tre prsum que les facteurs socio-culturels peuvent tre changs. Toutefois, en les
incorporant dans de telles stratgies de dveloppement, ladoption des programmes et
des technologies peut se rvler plus aise. Les programmes de dveloppement, qui
combinent le savoir local et la science occidentale, engendrent des stratgies plus
acceptables sur le plan culturel. Les facteurs socio-culturels ne sont donc pas perus
comme un problme, mais plutt comme une composante considrer dans la recherche
dune solution (Olawoye et di Domenico, 1990).

Contraintes techniques
Le troupeau familial le plus commun, comprenant 5 20 oiseaux, semble reprsenter la
limite de ce qui peut tre lev cette chelle sans apports particuliers en termes
dalimentation, logement et travail. Les petits effectifs trouvent suffisamment picorer
dans les alentours immdiats pour survivre et se reproduire. Tout accroissement
significatif conduit souvent la sous-alimentation si un complment alimentaire nest
110 Recherche et dveloppement en Aviculture Familiale

pas apport. De plus, des troupeaux plus importants doivent se dplacer sur de plus
grandes distances et, ainsi, endommager les potagers avoisinants, Toute modification
tendant clturer ou enfermer la volaille induit alors le besoin de fournir une ration
quilibre. Cette situation peut aisment survenir lorsque la mortalit se rduit aprs
vaccination ou amlioration des conditions hyginiques. La taille du troupeau peut alors
rapidement augmenter au point que les besoins alimentaires excdent la Base
dAliments Rsiduels Picorables (BARP) au sein de lexploitation (pour plus de dtails
sur le concept de BARP, se rfrer au Chapitre 3 Ressources Alimentaires ). A ce
stade, simpose la mise en place soit dune alimentation complmentaire, soit dun
systme de conduite semi-intensif. Si sont disponibles un aliment quilibr, des souches
hybrides de poussins, ainsi que des vaccins, au sein dun march bien organis, alors les
systmes semi-intensifs reprsentent une option viable. A vrai dire, de nombreux essais
ont tent de passer immdiatement au systme semi-intensif, sans passer par les tapes
intermdiaires (niveau 1 et 2, tels que dcrits dans le tableau 10.1) et ont gnralement
chou. Il a t not que, mme dans les programmes de dveloppement de laviculture
couronns de succs, la fourniture daliment et de produits vtrinaires prend souvent
du retard par rapport laccroissement des effectifs, particulirement lorsquelle est
organise par les services gouvernementaux de vulgarisation. Le recours aux
organisations non gouvernementales (ONG) ou des entrepreneurs privs semble une
alternative prfrable.

En dcembre 1998, la FAO a organis la premire confrence lectronique


RIDAF/FAO sur laviculture familiale, qui a suscit un tel engouement quelle fut
prolonge jusqu juillet 1999. La communication introductive portait sur les options de
recherche et de dveloppement (Sonaiya et al, 1998). Le canevas de cet important
papier comportait:
x Options de recherche pour le dveloppement de laviculture familiale.
x Perspectives de dveloppement.
x Approches de dveloppement.
x Elevage et reproduction (valuation et slection des races indignes et valuation
et adaptation des races importes sous climats chauds).
x Recherche et dveloppement en alimentation.
x Gestion sanitaire.
x Dveloppement entrepreneurial.
x Gestion de linformation.

Maladie
La Maladie de Newcastle (MNc) reprsente la maladie pizootique la plus srieuse
travers le monde, particulirement dans les pays en dveloppement. Aucun progrs na
t enregistr dans le contrle de cette maladie dans les troupeaux villageois en libert,
qui reprsentent plus de 80 pour cent de la population totale de volailles. A titre
dexemple, de nombreuses enqutes effectues en Afrique ont rvl des taux levs de
seropositivit, en labsence de vaccination. Dans les pays en dveloppement, la MNc
rapparat chaque anne et tue en moyenne 70-80 pour cent des poules villageoises non
vaccines (Branckaert et al, 2000). Il savre trs difficile dorganiser des campagnes de
vaccination pour la volaille vivant en libert pour les raisons suivantes:
x La difficult de rassembler un effectif suffisant doiseaux afin dobtenir un taux
de vaccination efficace.
Aviculture Familiale 111

x Le fait d lever ensemble des oiseaux dge diffrent.


x La complexit maintenir, tous les stades, une chane de froid active pour une
conservation correcte du vaccin.

Les maladies rendent ainsi trs risque une entreprise avicole. Les aviculteurs familiaux
levant leurs volailles en libert connaissent bien ce risque et essayent de minimiser son
impact sur lconomie du mnage en ne gardant que des troupeaux de taille rduite. La
MNc est un problme pathologique majeur pour tous les aviculteurs familiaux partout
o cette maladie existe. La vaccination est trs importante et installe les bases propices
un dveloppement ultrieur.

Il convient de rpter que la rpugnance des fermiers investir dans le secteur avicole
rside dans le risque druption de maladie et de mortalit,et non dans le manque de
ressources. Des maladies mortelles, telles la MNc dciment rgulirement les troupeaux
villageois. En systmes traditionnels, les fermiers se maintiennent la limite de la
survie ce qui les encourage viter les risques. Minimiser ces derniers est plus
important quaugmenter la production. Le problme fondamental du dveloppement de
laviculture familiale est le contrle des maladies les plus importantes. La vaccination
rgulire est un pralable toute amlioration du sous-secteur.

Prdateurs
Les prdateurs, tels serpents, rats, chiens, chats, renards, ratons laveurs, oiseaux de proie
sont responsables de la majorit des pertes, particulirement chez les jeunes oiseaux.
Lhomme reprsente un autre ravageur important pour les oiseaux adultes. Un logement
adquat sera construit base de matriaux locaux disponibles et les prdateurs seront
pigs, chasss ou repousss au moyen de plantes spcifiques (Branckaert et al. 2000).
Par exemple, au Nigria, des gousses dail (Allium sativum) sont places autour des
poulaillers pour loigner les serpents.

Lanalyse de la mortalit des poulaillers familiaux en Thalande a dmontr que les


quatre premiers mois sont cruciaux pour la survivance des poussins (Thitisak,
1992).Pendant cette priode, la mortalit peut slever jusqu 60 pour cent
(Matthewman, 1977) mme au sein des troupeaux vaccins contre la MNc. Alors que
diverses maladies, telles que Salmonellose ou Coccidiose affectent les poussins pendant
les deux premiers mois (Chabeuf, 1990), la prdation est la cause de mortalit
prdominante entre deux et quatre mois, pouvant causer jusqu 70 pour cent de pertes
(*Bourzat et Saunders, 1987). Un logement de nuit peut rduire considrablement ce
dommage; il sera construit base de matriaux locaux bon march.

Alimentation
La nourriture reprsente galement un apport dimportance primordiale, car la
fourniture dun complment nutritif appropri est critique. La consommation
alimentaire des oiseaux en libert varie de place en place en fonction des saisons, de la
croissance des crales et de la vgtation naturelle disponible. Dans les essais de
terrain, tout complment tel que rsidus mnagers (patates cuites, ignames ou tubercules
de manioc) ainsi que les tourteaux de graines olagineuses, entranent un effet positif
sur la production dufs et le poids corporel des oiseaux.
112 Recherche et dveloppement en Aviculture Familiale

Une attention soigneuse sera accorde la fourniture de ressources alimentaires


appropries qui reprsentent 60 80 pour cent des intrants conomiques en aviculture
commerciale. Dans les pays faible revenu et dficit vivrier, les surplus en crales
sont inexistants. Il nest donc pas recommandable de dvelopper des systmes
alimentaires bass sur lutilisation de grains . La stratgie prconise est didentifier et
dutiliser les ressources alimentaires localement disponibles pour formuler des rations
aussi quilibres que possible (Branckaert et al. 2000).

Une ration quilibre doit tre distribue ad libitun la volaille conduite en


claustration mme petite chelle. En ce cas, on recommande un aliment commercial
mais beaucoup de fermiers considrent celui-ci trop coteux et livr trop
irrgulirement. Les sous- produits des cultures locales (sons, huiles et tourteaux)
peuvent tre utiliss la fois comme source dnergie et de protines (voir Chapitre 3
Ressources alimentaires ) mais, par elles-mmes, elles ne peuvent procurer une ration
compltement quilibre. Une recherche additionnelle est ncessaire sur lapport
doligo-lments et de vitamines travers les ingrdients locaux, spcialement les
feuilles, fruits, algues, champignons et autres matriaux prsents. Toutefois, mme en
possession de ces connaissances, les services dun nutritionniste bien quip et
expriment sont ncessaires pour formuler des rations moindre cot.

Reproduction (potentiel gntique)


Les races indignes ou locales sont gnralement leves en systmes de production
familiaux. Les oiseaux sont habituellement slectionns pour leur robustesse,
quelquefois pour la production de viande, mais non pour la production dufs. Les
poules sont donc des pondeuses mdiocres, mais de bonnes couveuses, au contraire des
pintades. Lorsque les fermiers envisagent de passer un mode daviculture plus
intensif, ils sont impatients dacqurir des oiseaux plus performants. Il est ncessaire de
trouver le meilleur moyen pour leur procurer de tels animaux et les options sont:
x Soit de leur fournir des souches hybrides ce qui suppose la prsence de couvoirs
bien grs et de lignes (grand) parentales.
x Soit de les approvisionner en races pures ce qui leur permettra de renouveler leur
troupeau et de demeurer indpendant de fournisseurs extrieurs. Malheureusement
les races pures sont de plus en plus difficiles se procurer et sont moins
productives que les hybrides (Branckaert et al. 2000).

Commercialisation
Les produits avicoles continuent tre onreux dans la plupart des pays en
dveloppement, spcialement en Afrique. Le systme de commercialisation est
habituellement informel et pauvrement organis. Les consommateurs prfrent
gnralement ufs et viandes de volaille provenant de troupeaux indignes, plutt que
les produits des animaux issus des fermes commerciales. Lexistence dun march local
pouvant offrir de bonnes opportunits de vente et des facilits de transport appropries
sont des pralables essentiels au dveloppement de laviculture familiale. Comme la
plupart des consommateurs possdant un pouvoir dachat suffisant habitent en ville,
lintensification de laviculture sera dabord initie en rgions peri-urbaines ou, du
moins, dans des zones possdant une bonne infrastructure routire (Branckaert et al.
2000).
Aviculture Familiale 113

Les vendeurs et colporteurs traditionnels qui acheminent ufs et volailles dans les
villages, facilitent la commercialisation des produits avicoles familiaux dans la majorit
des pays en dveloppement. De telles structures traditionnelles sont bien souvent
ngliges, court-circuites ou critiques. Il existe, dans certains pays, une tendance
regrettable utiliser les services de vulgarisation gouvernementaux ou des organismes
parastataux pour la commercialisation des produits de laviculture familiale. Ceci
devrait tre dcourag car cette option nest pas durable.

Organisations fermires
Organiser les producteurs avicoles familiaux nest pas une tche aise pour diffrentes
raisons. Les effectifs de volailles sont rduits et les oiseaux sont conduits avec un
minimum de terrain, de travail et de capital. Cela signifie que les fermiers considrent
gnralement laviculture familiale comme une activit secondaire, par comparaison
dautres activits agricoles et commerciales. Nanmoins, il est essentiel de dvelopper
des groupements de producteurs afin de permettre leurs membres davoir un accs
facilit aux intrants, tels qualiments complmentaires, oiseaux amliors, mdicaments
et vaccins, ainsi quau crdit, la formation, au transport et la commercialisation des
produits avicoles. De tels groupes pourront galement encourager les populations
instruites initier laviculture comme occupation secondaire, conduite au niveau
familial sur des effectifs de taille moyenne, ainsi que de dvelopper des activits
associes, comme le jardinage, apte utiliser le fumier de volaille et rduire ou dplacer
les rsidus et nuisances mnagres (Branckaert et al. 2000).

Les fermiers seront autoriss dvelopper les structures de commercialisation les


mieux adaptes leur niveau. Souvent, les groupements de femmes se rvlent trs
efficaces dans la vente des ufs jointe celle dautres produits sur les marchs locaux.
De tels groupes seront encourags et aids, sils existent dj. Toutefois, les installer
uniquement pour laviculture familiale nest ni ncessaire ni viable.

Dans une tude mene dans la rgion de Niamey, Niger (Kobling, 1989) il a t
dmontr que de petits effectifs (infrieurs 20) de pondeuses, situs moins de 2,5
km dune route goudronne principale, peuvent fournir et vendre ufs et viandes de
volaille sur le march urbain des prix comptitifs. Des villages beaucoup plus loigns
des routes principales peuvent livrer des volailles vivantes mais non des ufs. Les ufs
ne reprsentent pas une denre importante au niveau du village, car il sagit dun
aliment protique relativement coteux et, de ce fait, des efforts de coopration doivent
tre consentis par les producteurs pour transporter les ufs en milieu urbain. Les
moyens cet effet incluent lutilisation de canaux de commercialisation traditionnels
ou louverture de nouvelles filires comme les associations de producteurs, les
coopratives, les groupements de femmes ou les associations de jeunes fermiers.
Linstallation de coopratives spcialises en aviculture sest rvle difficile en
beaucoup dendroits, surtout cause de facteurs socioconomiques.

Formation et gestion
Ainsi que soulign par Bessei (1987) au dbut de ce chapitre, les comptences
techniques doivent tre prises en compte tant au niveau du fermier qu celui du
vulgarisateur. Pour chacun dentre eux, une formation est essentielle dans les domaines
suivants: contrle des maladies, logement et quipement, alimentation, amlioration
114 Recherche et dveloppement en Aviculture Familiale

gntique et commercialisation. Des connaissances de base sur les caractristiques


anatomiques et physiologiques de la volaille sont galement ncessaires pour
comprendre les thmes ci-dessus. Logement et gestion peuvent tre amliors par une
formation approprie, dispense prfrentiellement sur la ferme. Les artisans locaux
peuvent tre forms la fabrication de petits quipements, tels quabreuvoirs et
mangeoires (Branckaert et al. 2000).

LEONS TIRES DAUTRES PROJETS

Amlioration gntique
Celle-ci a reprsent la stratgie de dveloppement la plus anciennement et
communment adopte et supporte par de nombreux donateurs partir des annes 60.
Elle a gnralement ncessit dimportants investissements au niveau des infrastructures
gouvernementales, en termes de fermes et de btiments servant multiplier les effectifs,
et trs peu dimplication dans la formation des fermiers villageois ou lorganisation de
rseaux de distribution de vaccins et de mdicaments. Lapproche traditionnelle tait le
Programme dEchange de Coquelets (PEC), dans lequel des coquelets de souches
exotiques taient levs jusqu 15-20 semaines, gnralement dans des stations
gouvernementales, et ensuite changs contre des coquelets locaux appartenant des
fermiers, propritaires de petits effectifs et qui taient requis de dplacer ou dchanger
tous les coquelets locaux. Quelquefois les troupeaux fermiers ou villageois taient
vaccins contre la MNc et des conseils taient dispenss sur lalimentation et le
logement.

Dans le district de Machakos au Kenya, une valuation effectue par Ballard (1985),
cit par Mbuga, (1990), sur limpact dun PEC men en 1977, a dmontr une
augmentation denviron 30 ufs par poule dans un troupeau de neuf poules et un coq.

Tableau 10.3 Augmentation de la production par poule dans un troupeau de neuf sujets
_______________________________________________________________________
Poule locale Poule amliore
(avant) (aprs)
_______________________________________________________________________
ufs / poule 57.2 87
ufs pour consommation et vente 41 63
ufs pour incubation 16 24
Poussins clos 11 17
Oiseaux pour consommation et
Vente 3.2 4.9
_______________________________________________________________________
Source: Ballard, 1985 cit par Mbuga, 1990

La mthode PEC a principalement t critique du fait que llevage de coquelets en


fermes gouvernementales est coteux et que lexposition aux conditions villageoise de
coquelets levs en mode intensif, requiert des problmes dadaptation considrables
avec des taux de mortalit suprieurs 50 pour cent. De plus, les coquelets locaux ne
sont pas toujours retirs car le fermier (avec raison dans bien des cas) est sceptique sur
Aviculture Familiale 115

la capacit survivre et/ou se reproduire de la race exotique. La prsence des coqs


locaux rduit ainsi lefficience de cet essai damlioration gntique, car ils sont mieux
arms pour obtenir les faveurs des poules locales que les coqs de races exotiques.

Du fait des problmes rencontrs dans le PEC, dautres mthodes ont t dveloppes,
comprenant distribution de poussins, de poulettes ou dufs fertiles de races amliores.
Une comparaison de lefficacit relative de ces diffrentes mthodes damlioration
(*ter Horst, 1987 [Ed.1986 dans la Bibliographie]), base sur le critre de production
de poussins dun jour amliors au niveau villageois dans les trois ans a dmontr que
la distribution dufs fertiles se rvlait la meilleure mthode.

Tableau 10.4 Efficacit relative de diverses stratgies pour amliorer la production


avicole.
_______________________________________________________________________
Augmentation en %
_______________________________________________________________________
Distribution de poulettes 15
Echange coquelets 17
Distribution poussins dun jour 67
Distribution ufs fertiles 100
_______________________________________________________________________
Source: Horst, 1987 (Ed. Dans la Bibliographie).

Dans cette opration, des ufs fertiles de lignes slectionnes sont vendus des
familles leveuses de volailles. Des poules locales couvent les ufs et lvent les
poussins qui sadaptent ainsi aisment lenvironnement. La distribution dufs fertiles
reprsente ainsi la mthode la moins coteuse et la plus efficace damlioration
gntique. Elle prsente les avantages et inconvnients suivants:

Avantages:
x Les ufs sont peu coteux, compars aux coquelets et poulettes.
x Ils entranent 100 pour cent damlioration gntique par comparaison aux 50
pour cent des poulettes et coquelets utiliss en croisement avec les volailles
locales.
x Les jeunes poussins sont levs en conditions naturelles ds lclosion et
apprennent dvelopper leur capacit de picorage.

Inconvnients:
x Les coquelets sont gnralement mieux apprcis et accepts par les fermiers.
Ceci empche la distribution dufs fertiles en vue de lamlioration gntique
dans la mme rgion.
x Le transport dufs fertiles sur routes difficiles dans de mauvaises conditions en
diminue lclosabilit.
x Le remplacement total des volailles locales par des oiseaux amliors dorigine
exotique conduit une perte de biodiversit de la population locale, et dinstinct
de couvaison des poules, ainsi quune rupture du systme auto suffisant de
116 Recherche et dveloppement en Aviculture Familiale

reproduction au niveau du village. Ces problmes sont srieux et doivent tre


considrs avec attention.

Vaccination
Trois vaccinations pendant la phase de six mois de croissance des poulettes/coquelets
sont considres ncessaires pour les protger contre la Maladie de Newcastle. En
fonction des conditions locales, deux trois vaccinations annuelles sont ncessaires
pour les oiseaux adultes. Compte tenu des ressources limites des services vtrinaires
gouvernementaux, il savre ncessaire de mettre en place un rseau priv de
vtrinaires, dassistants vtrinaires et de vaccinateurs aptes fournir les soins
prventifs en rgions rurales isoles, ainsi que dassurer une fourniture fiable de
vaccins, (avec chane de froid pour stockage et distribution de vaccins conventionnels).
Le Dpartement des Services de lElevage du Bangladesh a mis en place une telle
chane de froid depuis le laboratoire de production jusquau niveau du village. En trois
ans, 4500 fermiers (spcialement des femmes) ont t forms comme vaccinateurs
villageois. Le cot intgral de la vaccination a t support par les aviculteurs afin de
soutenir le paiement total de la production et de la distribution de vaccin. Avec cet
argent, il aurait galement t possible de financer un service de vulgarisation
partiellement priv. Un tel systme, financ par les frais de vaccination et la vente
doiseaux exotiques aux fermiers, a t mis en place Sao Tome et Principe.

Combinaisons de stratgies
Une approche combinant vaccination contre la MNc, la distribution rgulire deau, une
complmentation alimentaire (rsidus mnagers), et une protection particulire des
poussins pendant les premires semaines de la vie (logement amlior pendant la nuit
par exemple) augmente le nombre dufs pondus denviron 100 pour cent et le nombre
de poulets levs par poule /an de 10 12.

Lintroduction dune amlioration gntique combine avec une amlioration de


lalimentation (aliment compos), du logement (semi-claustration), et de la sant
(vaccination complte et dparasitage) va son tour augmenter la production dufs de
50 pour cent et le poids de luf de 60 pour cent.

Autres tudes de cas


Plusieurs pays ont rencontr un certain succs en dveloppant laviculture familiale. En
Egypte, la Cooprative Fayoumi a accru la productivit et le revenu de producteurs de
volaille villageoise. Elle distribue des sujets Fayoumi amliors et produit un aliment
complmentaire dans sa propre provenderie partir principalement dingrdients
locaux. Elle assiste galement les fermiers dans la commercialisation des ufs et des
oiseaux.

En Malaisie, les effectifs de volaille sont nourris partir dun Aliment domestique
commercialis prix rduit par les fabricants daliments, dune densit nutritionnelle
moindre que les aliments commerciaux. En 1986, la production villageoise dufs et de
viande de volaille tait estime en Malaisie 150 millions et 17.000 tonnes. Elle
reprsentait cinq pour cent de la production totale dufs et sept pour cent de la
production de viande. Compte tenu de la forte demande pour la viande de poulet
villageois, certains troupeaux ont volu en units relativement grandes de poulets
Aviculture Familiale 117

commerciaux villageois. Certaines de ces fermes lvent entre 2000 et 15000 jeunes
sujets qui sont ensuite vendus pour achever leur croissance en systme traditionnel
extensif.

En Ouganda, la production de viande de canard a progress de 600 tonnes en 1980


3500 tonnes en 1992. Ceci a t ralis en amliorant les soins de sant dans les petites
units traditionnelles, avec pour rsultat que le taux de mortalit moyen de plus de 40
pour cent en 1980 a chut moins de 8 pour cent en 1992.

Le modle du Bangladesh
Au Bangladesh, un effort considrable a t poursuivi au cours des dernires annes afin
de dvelopper laviculture familiale. Ceci a t le sujet de la 2me Confrence
Electronique FAO/RIDAF qui sest tenue de mai juillet 2002. toutes les
communications ont t rendues disponibles sur le site Web de la FAO dans les deux
mois de la conclusion:

http://www.fao.org/ag/aga/AGAP/LPA/fampo1/fam.htm

Ce qui na pas t couvert sur la situation du Bangladesh au cours de cette confrence


lectronique tait limportance aux yeux de ce pays de la recherche et du progrs
accompli en ce domaine. Cinq thmes de recherche potentielle ont t clairement dfinis
en aviculture familiale: reproduction, maladies, alimentation, gestion et production,
commercialisation et socio-conomie. Ils sont proches des sept catgories dfinies dans
la section consacre ci-dessus aux Contraintes Techniques.

Ci-aprs sont repris les protocoles esquisss pour des propositions de recherche, sous
lgide du Programme gouvernemental du Bangladesh pour lamlioration du Modle
dAviculture familiale, assist par la Banque Asiatique de Dveloppement et Danida au
sein de deux projets en cours. Les propositions marques dun astrisque taient
considres de premire priorit en octobre 2000.

Maladies
x Etude sur la prvalence pathologique (pidmiologie):
o hte (ge, sexe et race)
o morbidit et mortalit
o gestion et alimentation
o espace et temps
o parasitisme et efficience alimentaire
o vaccin et chec de vaccination
x Etude en profondeur des maladies les plus srieuses:
o identification, caractrisation et virulence de lagent causal
o caractrisation srologique
o pathognicit
x Dveloppement dune stratgie de contrle des maladies bases sur la vaccination:
o calendrier de vaccination
o anticorps maternels avec leurs effets sur limmunisation
o mise en place de rseaux de diagnostic
x Dveloppement et amlioration de la vaccination:
118 Recherche et dveloppement en Aviculture Familiale

o Dveloppement dun vaccin base de virus local


o Etude comparative de vaccins locaux et imports
o Slection des vaccins actuels contre la MNc base sur la thermotolrance, en
comparaison avec lutilisation des souches I2 ou V4
o Utilisation du vaccin souche thermotolrant I2 dans des ufs locaux incubs
produits dans les laboratoires vtrinaires de district
x Etude de la prvalence des maladies suivant lendroit et de leur effet sur
diffrentes races ou de leurs combinaisons suivant la saison.
x Quantification des pertes en semi-libert associes aux maladies principales,
comprenant des possibilits de remdes contre celles-ci.

Alimentation
x Mise en place de banques protiques, culture petite chelle de Ipil-ipil, de
lentille deau et descargots.
x Disponibilit annuelle en nutriments pour les volailles en divagation dans les
conditions de lleveur modle de base.
x Production annuelle en protines partir de diffrentes ressources
conventionnelles ou non:
o Production de lentilles deau en tangs fertiliss peu profonds aliments par
eau propre ou pollue.
o Protines foliaires (manioc par exemple).
o Leucoena, Sesbania, Glyricidia.
o Protines animales partir de farine de sang, contenu de rumen, vers de terre,
insectes, dchets dleveuse, sous-produits de tannerie.
x Evaluation nutritionnelle dingrdients alimentaires varis, utiliss pour
lalimentation de la volaille en conditions de semi-divagation:
o composition chimique
o valeur nutritive aprs essai alimentaire
o prservation daliments pour la volaille
x Niveau efficace de supplmentation pour les oiseaux en semi-divagation sous
diffrentes conditions agro-cologiques. Pour les animaux de tous ges de la
supplmentation
o effet de la supplmentation en farine protique (vgtale et animale)
o effet de la supplmentation riche en nergie (conventionnelle ou non)
o effet base dingrdients conventionnels ou non
x Recyclage des nutriments travers la production de protines base de fumier en
conditions de semi-divagation:
o Cycle de lnergie au sein de la ferme (systmes conventionnels et amliors).
o Economie protique (systmes traditionnels et amliors).
x Qualification et quantification des mlanges alimentaires les plus conomiques
pour lleveur modle cl dans diffrents environnements, saisons et rgions.
x Utilisation des dchets de th, de la lentille deau, de la litire de volaille, des vers
de terre, des cultures dinsectes et autres aliments non conventionnels comme
sources de protines pour la volaille en semi-divagation.
x Quantits et composition des aliments disponibles pour le picorage, avec leurs
variations saisonnires et rgionales.
Aviculture Familiale 119

x Etude de la Base Alimentaire de Ressources pour le Picorage, et de la densit


optimale de volaille pour un systme durable dlevage en semi-divagation dans
les conditions socio-conomiques du Bangladesh. Comparaison du contenu des
jabots et des quantits relles daliment consomm par diffrence entre
supplments distribus et refus constats.
x Moyens dincorporer la culture daliments pour la volaille en croissance (par
exemple ver de terre, asticots, termites, cancrelats) dans le dveloppement de la
petite exploitation, en valuant son influence dans lquilibre matriel et
conomique.
x Utilisation de certains sous-produits agro-industriels provenant des brasseries et
des units de transformation de poisson comme nourriture complmentaire dans le
modle daviculture familiale en semi-divagation.

Reproduction
x Rentabilit compare entre deux croisements commerciaux (bass sur RIR x BPR
connu comme Harco, Nera); Sonali (RIR x Fayoumi); et Fayoumi (une race
gyptienne ), en systme de (semi) divagation.
x Suite aux tudes et recherches effectues par la Direction des Services de
lElevage, lInstitut du Bangladesh pour la Recherche sur lElevage, (assist par le
Projet de Dveloppement de llevage petite chelle actuellement achev) et
lUniversit Agricole du Bangladesh, le Sonali a t valu comme la meilleure
race pour la production dufs et de viande,sa rsistance la maladie et sa
rentabilit que ce soit en divagation ou semi-divagation. Une tude
complmentaire est programme afin de dterminer le type dindex de slection
appliquer (suivant le type denvironnement) pour augmenter son efficience (par le
biais dune slection des souches parentales Fayoumi et RIR) et ses performances
en semi-divagation. Voir aussi ci-dessous: commercialisation et socioconomie.
x Croisement entre Cou Nu avec Fayoumi/RIR pour une production plus leve
dufs et de viande, rsistance la maladie et rentabilit en (semi) divagation.
x Croisement entre Cou Nu et Desi pour accrotre la taille et amliorer la capacit
de couvaison.
x Afin de maintenir lefficience reproductive du croisement RIR/Fayoumi, les
souches grand parentales doivent tre maintenues et dveloppes.
x Performance de diverses combinaisons de races sous diffrents environnements,
conditions dalimentation et de maladie.
x Essais de densit de diffrentes races et combinaisons de celles-ci afin de
dterminer leffectif le plus appropri la meilleure productivit dans le modle
de petite exploitation.
x Dmonstration ou non de la supriorit des races commerciales par rapport la
Desi et autres combinaisons faites maison par les Eleveurs Cl utilisant des
poules couveuses.

Commercialisation et socioconomie
x Impact des activits du Projet de Dveloppement Participatif de lElevage (dure
attendue: 1998-2003) sur le revenu, lemploi et la pauvret dans le Bangladesh
rural. A titre dexemple, statut nutritionnel et effet sur la capacit de travail et les
index de masse corporelle de la mre et de lenfant.
120 Recherche et dveloppement en Aviculture Familiale

x Analyse comparative des cots/bnfices de laviculture en divagation par rapport


aux systmes en confinement.
x Changement du rle de la femme dans le domaine de llevage au sein du Projet
Participatif de Dveloppement de llevage (PPDL).
x Offre et demande pour les produits avicoles et identification des contraintes une
commercialisation russie.
x Dveloppement des intermdiaires dans la commercialisation et des problmes
quils posent.
x Effets des modes opratoires des ONG dans les participations aux pratiques du
Modle et leur vulgarisation.
x Impact socio-conomique de la petite aviculture combine dautres activits,
comme lhorti- ou la pisciculture.
x Comparaison conomique de la production dufs et de viande entre le systme
en divagation et les systmes commerciaux. Analyse conomique de llevage de
coquelets Fayoumi et Sonali au niveau villageois.
x Implication du PLDP/SLDP-1 rsoudre les disparits entre genres dans la
situation socio-conomique du Bangladesh et utiliser les recettes de laviculture
(par exemple secteur social, sant, ducation).
x Taux dintrt rels auxquels est confront le bnficiaire impliqu dans les
diverses entreprises du Modle au sein de chacune des ONG partenaires du
PPDE.
x Impact du concept SLDP sur ltat nutritionnel des femmes et jeunes filles dans le
village. Une tude sur ce sujet a dj t complte sans le cadre dune Matrise
en Sciences par une tudiante de la KVL Hanne Nielsen (2000).

Gestion et production
x Utilisation conomique dleveuses artisanales et de combustibles domestiques
pour lincubation.
x Construction dun local dincubation appropri avec plancher surlev de bambou
(macha ). Pour ce faire, des matriaux de diffrents types, paisseur et cots
seront employs afin dassurer une ventilation optimale avec une durabitlit
raisonnables.
x Emploi de diffrents quipements pour lincubation et mthode dlevage des
poussins par le poule couveuse.
x Logement adapt faible cot avec mesure de scurit pour les oiseaux exotiques
des Eleveurs Cl du Modle.
x Fourniture de source dclairage bon march pour les Eleveurs du Modle.
x Choix de matriaux de litire appropris faible cot.
x Dtermination du nombre optimal de poussins dun jour produire dans la Mini-
leveuse du Modle avec le meilleur profit, suite ladoption de technologies
adaptes damlioration. Pourquoi ce type dentreprise se rvle-t-il difficile
grer pour les fermiers ?
x Comparaison entre le caillebotis et la litire profonde pour lunit du Modle de
Reproduction.
x Essais de densit de diffrentes races ou de combinaisons de races afin de
dterminer leffectif optimal pour la meilleure productivit chez le petit exploitant
du Modle.
Aviculture Familiale 121

x Rentabilit de la couveuse Desi tant pour la production de poussins dun jour que
comme mre adoptive de poussins exotiques. Influence positive ou ngative sur le
comportement picoreur des poussins.
x Dtermination du nombre optimal dufs pouvant tre couvs et de poussins
pouvant tre levs avec succs jusqu 8 semaines par les poules Desi.
x Effets sur lconomie de lEleveur Cl du Modle si les poules Desi sont gardes
ensemble fins de couvaison.

CONSIDRATIONS SUR LE DVELOPPEMENT

Plusieurs responsables des politiques agricoles (y compris des spcialistes en levage)


pensent que le systme de petite exploitation doit tre considr comme un simple
moyen de subsistance et na donc nul besoin de coordination, analyse, intervention ou
dveloppement. De telles conceptions doivent tre revises et modifies.

Education et formation
Dans de nombreux pays en dveloppement, seule laviculture commerciale petite
chelle (ponte et chair) fait partie du programme dtudes dans les coles dagriculture.
Laviculture familiale et la production dautres espces de volailles nest envisage
aucun niveau. Pour le dveloppement de laviculture familiale, il est important que ce
sujet soit inclus dans le programme rgulier denseignement et les plans de formation
des agronomes gnralistes, comme chez les zootechniciens et les aviculteurs. Il est
galement important que plus de recherche soit dvolue aux problmes des producteurs
familiaux, car elle prconditionne un dveloppement russi de ce type daviculture.

Une tude mene sur la formation agricole et les institutions pdagogiques en Afrique
(FAO, 1984) a rvl que les institutions pour la formation en levage taient
principalement concentres en Afrique du Nord et dans quelques pays d Afrique
Occidentale. Ce qui signifie que certains pays africains ne possdent pas la capacit
institutionnelle satisfaire leurs besoins en main duvre pour la recherche, la
vulgarisation et le dveloppement en levage. Il est important que les institutions
nationales de formation soient renforces par lutilisation de personnel et dquipements
pour la formation disponibles dans dautres pays. Le lancement dun Programme
Rgional de Formation en Aviculture est un exemple dune telle coopration.

Objectifs socioconomiques
Pour dvelopper des stratgies efficaces daviculture familiale, certains aspects peu
performants de la production traditionnelle doivent tre remplacs par des mthodes
mieux adaptes. Les objectifs socio-conomiques du dveloppement de laviculture
familiale seront:
x Accrotre le rendement du travail rural et pri-urbain ainsi que le revenu familial
travers laugmentation de la productivit de la volaille.
x Assurer un niveau lev de scurit alimentaire et amliorer la situation
nutritionnelle des familles rurales et pri-urbaines.

Objectifs de productivit
Quest-il requis pour maximiser la productivit du systme daviculture familiale ? Tout
dabord, doit tre correctement comprise la complexit des facteurs interactifs affectant
122 Recherche et dveloppement en Aviculture Familiale

les systmes fermiers familiaux, avec leurs avantages et leurs contraintes. Il est certain
que la production villageoise persistera aussi longtemps quexisteront les villages, mais
certains aspects de cette production peuvent tre modifis avec prudence. A titre
dexemple, il nest pas assez connu que la vaccination contre la Maladie de Newcastle
amliore le taux de survie des poussins de 30 70 pour cent; que pour les poussins et
jeunes sujets en croissance, soient ncessaires un logement et une protection contre les
prdateurs;
quun aliment complmentaire soit important; que les autres espces de volaille, telles
canards pintades, pigeons et cailles soient galement dignes dintrt.

Laviculture familiale est porteuse de dveloppement rural, de gnration de revenu et


damlioration de la nutrition. Il est vident que la prsence de fermes avicoles
florissantes de type industriel en milieu pri-urbain ne doit pas dnier le besoin dun
systme parallle de production familiale en rgions rurales. Priorit doit tre accorde
au dveloppement de technologies appropries, la mise en place de services de
vulgarisation, la formation de fermiers, au transport des intrants et des produits, la
commercialisation et la facilitation du crdit.

Il nest pas pertinent de vouloir stimuler tout prix la production alimentaire sans
sinquiter de lidentit des producteurs ni du systme de production. Laviculture
familiale reflte le besoin de multiplier les postes de travail, de stimuler le
dveloppement dactivits rurales en dehors de la ferme, et de gnrer des bnfices qui
retournent dans tous les secteurs sociaux quils soient urbains ou ruraux.

Recherche et formation
La ralisation des objectifs de laviculture familiale ncessite un effort concert,
incorporant recherche, dveloppement et formation. Une stratgie cohrente devra
insister sur, mais non se limiter :
x Lidentification des besoins et programmes de recherche tant stratgiques
quadaptatifs.
x Lidentification des efforts de dveloppement orients vers deux groupes cibles:
rural et pri-urbain.
x Lapport dune assistance technologique aux producteurs en matire de fourniture
dintrants et de commercialisation de produits.
x La formation et le recyclage permanents du personnel technique impliqu tous
les niveaux de la petite aviculture.

Quoique le contrle de la maladie de Newcastle reprsente la contrainte cl, il existe


dautres blocages, dont limportance saccrot au fur et mesure que sont limins les
obstacles jugs les plus cruciaux. Beaucoup de projets daviculture chouent car un seul
problme a t pris en compte et, si plusieurs dentre eux ont t apprhends, ils ont t
mal saisis. Plusieurs projets se concentrent soit sur le contrle des maladies, soit sur
lamlioration gntique. Il est indubitable que la vaccination rduit la mortalit mais,
certaines priodes dans un projet particulier, la mortalit par prdation peut s lever
70 pour cent car leffet de la vaccination est contrecarr par un obstacle jug secondaire
qui se rvle tre un logement inadquat. (Bourzat et Saunders, 1987).
Aviculture Familiale 123

Les cots dune campagne isole de vaccination ne peuvent gnralement tre justifis
si alimentation et logement ne sont pas galement envisags. Lamlioration gntique a
t considre comme une trs grande priorit dans beaucoup de projets avicoles.
Durant les programmes de slection, des vaccinations ont habituellement t prvues,
mais la distribution daliment n a pas reu dattention suffisante, ce qui a rendu
alatoire lexploitation du gnotype suprieur de ces oiseaux.

Par le pass, trop dattention a t accorde linstallation dun systme autonome de


vulgarisation avicole alors qutaient ngliges les relations entre laviculture et les
autres services agricoles. Mme si un tel systme de vulgarisation est bien organis et
travaille efficacement, son impact restera trs faible sur le grand nombre de petits
propritaires de volailles (particulirement en zone rurale). Ceci parce que les budgets
gouvernementaux ne peuvent prendre en charge quun nombre limit de vulgarisateurs
avicoles. Il est, ds lors, ncessaire que des liens soient tablis entre les spcialistes en
volaille et autres institutions en place, tels les services gnraux de vulgarisation
agricole, les services vtrinaires, les collges dagriculture et les services des ONG. Il
est important de revoir les stratgies et activits des stations avicoles existantes et des
spcialistes de telle sorte quune part considrable de leurs capacits soit dvolue une
vulgarisation indirecte par le biais des services gnraux.

Bourses et Rseaux
Le dveloppement est un processus continu qui requiert raction et constante interaction
entre les oprateurs et le rseau dispenseur de savoir, soit local soit international. La
restructuration des systmes de vulgarisation de lagriculture et de llevage en fonction
de cette approche est aussi importante pour le dveloppement de laviculture que pour
toute autre stratgie.

Lattribution de bourses de voyage ou lorganisation de visites et de consultations


rgulires en aviculture reprsentent dautres exemples. Le Rseau international pour le
dveloppement de laviculture familiale (RIDAF) support par la FAO, peut ainsi jouer
un rle cet effet, en encourageant:
x lchange et la distribution de publications
x la participation aux congrs rgionaux et internationaux
x la mise sur pied dateliers semestriels sur des sujets spcifiques
Le Rseau danois pour la production et la sant avicoles dans les pays en
dveloppement soutenu par DANIDA, dont linstallation au Danemark a t annonce
antrieurement (Bulletin RIDAF 8 (2) 1998) a t rebaptis: Rseau pour le
dveloppement de la petite aviculture (RPA) et a entam ses activits en aot 1999.
Son objectif gnral est de soulager la pauvret et damliorer le bien-tre du petit
exploitant dans les rgions rurales.

Les trois activits principales du rseau demeurent essentiellement:


x Ltablissement et lentretien dune base internationale de donnes de recherche
en relation avec la production et la sant avicoles rurales.
x Lenseignement du personnel technique, ainsi que des tudiants en matrise et
doctorat originaires du Danemark et des pays en dveloppement dans les
disciplines relatives la production et sant avicoles traditionnelles.
x Ltablissement et le maintien de ressources humaines aptes assister les projets.
124 Recherche et dveloppement en Aviculture Familiale

Pour plus dinformation, prire contacter le directeur du rseau, ou visiter le site Web
sur:
http://www.poultry.kvl.dk

Dans beaucoup de pays, le systme extensif daviculture ou la production de volailles


diffrentes de la poule pondeuse ou de poulet de chair ne fait partie du programme
denseignement agricole aucun niveau. Pour le dveloppement de laviculture
familiale, il est important que:
x Un cours daviculture familiale soit inclus dans les programmes denseignement
et de formation des agronomes gnralistes, des spcialistes en levage et
production avicole.
x Plus de recherche soit consacre aux problmes de la petite aviculture comme
pralable un dveloppement russi de laviculture familiale.

Les spcialistes en levage et aviculture des Pays faible revenu et dficit vivrier
doivent arriver admettre que le systme daviculture familiale possde une importance
significative sur les plans conomique et social pour leurs nations et mrite
considration, investigation, intervention et dveloppement.

Les mots qui suivent proviennent dun minent spcialiste nigrian en levage
(Suleiman, 1990), et ils refltent lapprciation grandissante des ressources gntiques
et environnementales confies aux soins des populations de tous les pays:
Pour nous, le temps est peut-tre venu de redfinir lIdologie la base de lagriculture
(africaine) et, en fait, de lconomie tout entire. Lidologie agricole (africaine) semble
base sur le concept que les ressources gntiques indignes de notre continent soient
infrieures celles trouves ailleurs et doivent par consquent, tre remplaces ou
largement dilues par du matriel gntique tranger. De mme, nous avions considr
notre environnement comme hostile et, de ce fait, comme une menace directe pour notre
existence. Ces prises de position nous ont empchs de capitaliser partir de nos fonds
gntiques et environnementaux. Nous devons voluer dune situation o nous insistons
sur linsuffisance de nos ressources une position o nous soulignons leurs aspects
positifs, tout en recherchant surmonter leurs faiblesses inhrentes.

Elaboration de stratgies
Pour formuler des stratgies oprantes pour le dveloppement de laviculture familiale,
les mthodes traditionnelles mais peu efficaces de production doivent tre remplaces
par des mesures plus adaptes. Les objectifs principaux de telles stratgies seront:
x lamlioration de la fourniture alimentaire;
x la cration de revenu et de possibilits demploi pour les populations rurales;
x la conservation des ressources environnementales;
x le maintien de la biodiversit;
x le respect des valeurs socio-culturelles.
Aviculture Familiale 125

Abrviations

PFRDPV: Pays faible revenu et dficitaires en produits vivriers


EM: Energie Mtabolisable
BARP Base des Aliments Rsiduels Picorables
NSP: Rseau pour le dveloppement de laviculture familiale (Danida).
AsDB: Banque asiatique de dveloppement
AfDB: Banque africaine de dveloppement
PSSA: Programme Spcial pour la Scurit Alimentaire (FAO)
PCT: Programme de Co-operation Technique (FAO)

En relation avec le Bangladesh:


BLRI, Institut de Recherche de lElevage, Savar
DE: Direction de lElevage
FAO: Organisation des Nations Unies pour lAlimentation et lAgriculture
Fayoumi: Race Egyptienne
GoB: Gouvernement du Bangladesh
GVC: Gouvernement Collge Vtrinaire
IBD: Maladie de Gumboro (maladie de la bursite infectieuse)
IBDV: Vaccin contre la Maladie de Gumboro (maladie de la bursite infectieuse)
KVL: LUniversit Royale Vtrinaire et Agricole (Den Kongelige Veterinre
Landbohjskole)
Lentogenic ND: Souche peu virulente lente MN
MN: Maladie de Newcastle
NDV: Vaccin contre la Maladie de Newcastle
ONG: Organisation Non-Gouvernementale
NN: Naked Neck, race local cou nu
PLDP: Participatory Livestock Development Project
RIR: Rhode Island Red
Sonali: Race de poulet du Bangladesh (The Golden bird)
Velogenic: Souche trs virulente MN
Uppazila: sous-district
Aviculture Familiale 126

BIBLIOGRAPHIE

Abdou, F.H., Katule, A.M. & Sukuzi, O.S. 1990. Effect of the pre-incubation storage period of hatching
eggs on the hatchability and post-hatching growth of local chickens under tropical conditions.
Beitrage zur Tropischen Landwirtscahft und Veterinarmedizin 28: 337-342.
Acharya, R.M. and A. Kumar. 1984. Performance of local birds in South Asia. Indian Poultry Industry
Yearbook. 7th Edition.
Adene, D.F. 1990. An appraisal of the health management problems of rural poultry stock in Nigria. In:
E. B. Sonaiya (Ed.), Rural Poultry in Africa - Proceedings of an International Workshop held at Ile-
Ife, Nigria. 89-99.
Adene, D.F., and Ayandokun, J.O. 1992. The unfolding order in diseases of poultry in tropical Africa,
In: Proceedings of the XIX World Poultry Congress, Amsterdam, 2: 152-153.
Adesiyun, A.A., Bishu, G., Adegboye, D.S., & Abdu, P.A. 1984. Serological survey of Salmonella
pullorum antibody in chickens around Zaria, Nigria. Bulletin of Animal Health and Production in
Africa, 32: 81-85.
Adeyanju, S.A., Ogutuga, D.B.A., Sonaiya, E.B. & Eshiett, N. 1978. Evaluation of cocoa husk in
finishing diets for broilers. Turrialba 27: 371-375.
Adeyanju, S.A., Ilori J.O., & Osuntogun, C.A. Poultry Farming in Ondo State, undated. Monograph,
Department of Animal Science, Obafemi Awolowo University, Ile-Ife. 20pp.
Adjovi and Demey, 1992. Unpublished ref in Ch 3 on earthworms for poultry feed
Ahmad, A. & Hasnath, M.A. 1983. In: Proeedings of the SABRAO Workshop on Animal Geneic
Resources in Asia and Oceania, Tropical Agricultural Research Centre, Japan. 418-422.
Ahmed, N. 1987. Strategies for livestock disease control for small farmers. Asian Livestock, 12(10): 110-
113.
Ahmed, N. 1994. Backyard Poultry feeding systems in Bangladesh. Asian Livestock XIX, 7: 73-79.
Aini, I. 1990. Indigenous chicken production in South-east Asia. World Poultry Science Journal, 46: 125-
132
Akinokun, O. 1975. The Ife foundation stock of Nigrian chickens: 1. Body weight, egg weight and
sexual maturity. Nigrian Agric. Journal 12: 232-239.
Akpapunam, M.A. & Markakis, P. 1981. Protein supplementation of cowpeas with sesame and
watermelon seeds. J.Food Sci. 49: 960.
Alao, E.A.O. and E.B. Sonaiya. 1991. Evaluation of cowpea testa as a protein source for poultry
nutrition. Project report to the Department of Animal Science, Obafemi Awolowo University, Ile-Ife,
Nigria.
Alam , J. 1997. Impact of smallholder livestock development project in some selected areas of rural
Bangladesh. Livestock for Rural Development. <www.cipav.org.co/lrrd/lrrd9/bang932.htm>.
Alders, R.G., Inoue, S. & Katongo, J.C. 1994. Prevalence and evaluation of Hitchner B1 and V4
vaccines for the control of Newcastle disease in village chickens in Zambia. Preventive Veterinary
Medicine, 21(2): 125-132.
Asuquo, B.O., Okon B.O. & Ekong, A.O. 1992. Quality parameters of Isa Brown and Nigrian Local
Chicken eggs. Nig. J. Anim Prod 19:1-5.
Atteh, J.O. & Ologbenla, F.D. 1993. Replacement of fishmeal with maggots in broiler diets: effects on
performance and nutrient retention. Nig. J. Anim. Prod. 20: 44-49.
Australian Agricultural Consultancy and Management Company (AACMC), 1984. Livestock
subsector Review, vol. 1, Annex.3.
Ayorinde, K.L. 1987. Changes in anatomical points of the guinea hens in lay. Nig. J. Anim. Prod, 14:
121-123.
Ayorinde, K.L., Ayeni, J.S.O. & Okaeme, A.N. 1984. The production potential of different varieties of
the indigenous helmet guinea fowl (N.m. galeata Pallas) and the exotic Golden Sovereign (N.m.
meleagris) in Nigria. In: Proceedings of the 9th Annual Conference of the Nigrian Society for
Animal Production, Nsukka, Nigria, 65-72.
Ba, A.S. 1982. Lart vtrinaire des pasteurs saheliens.Fondation pour le Progrs de lHomme et ENDA,
Dakar :73-82.
Baksh, I. 1994. Permaculture for Poultry. African Farming, 1994 (January- February), 13-14
Barua, A., Howlider, M.A.R. and Yoshimura, Y. 1998. Indigenous Naked Neck fowl of Bangladesh.
Worlds Poultry Science Journal, 54, September 1998, pp. 279-286.
Beker and Banaerjee, 1990. Cited by Sharnawany and Banerjee, 1991.
Aviculture Familiale 127

Bell, I.G., Nicholls, P.J., Norman, C., Ideris, A., & Cross, G.M. 1991. The resistance of meat chickens
vaccinated by aerosol with a live V4 Newcastle disease virus vaccine in the field to challenge with
velogenic Newcastle disease virus. Australian Veterinary Journal, 68: 97-101.
Bell, J.G. 1990. Strategies for the control of Newcastle disease in village poultry flocks in Africa, In:
Smallholder Rural Poultry Production - Requirements of research and development. Proceedings of
CTA Seminar, Thessaloniki, Greece, 1: 138-143.
Bell, J.G., Belarbi, D.A., & Amara, A. 1990a. A controlled vaccination trial for Newcastle disease
under village conditions. Preventive Veterinary Medicine, 9(4): 295-300.
Bell, J.G., Kane, M., & Le Jan, C. 1990b. An investigation of the disease status of village poultry in
Mauritania. Preventive Veterinary Medicine, 8(4): 291-294.
Bessei, W. 1987. Tendencies of world poultry production. Paper presented at the 3rd International DLG-
Symposium on Poultry Production in Hot Climates, Hameln, Germany.
Bishop, J.P.. Undated. Protected Free-Range: 1. Movable Henhouse with Free-Access Range Run for
Single-Sire Flock of 25. Poultry Development Service, Marysville.
Bishop, J.P.. Undated. Protected Free-Range: 2. Movable Brooderhouse with Free-Access Range Run for
Natural Reproduction of 25 Chicks. Poultry Development Service, Marysville.
Bizimana, N. 1994. Traditional Veterinary Practice in Africa. Deutsche Gessellscahft fr Technische
Zusammenarbeit (GTZ) GmbH. Schriftenreihe der GTZ,No 243, Eschborn.
Bourzat and Saunders, 1987. Improvement of traditional methods of poultry production in Burkina
Faso. In: Proceedings 3rd International Symposium on Poultry Production in Hot Climates, Hameln,
Germany, June 1987: 12-15.
Branckaert, R.D.S. 1968. Nouvelles donnes sur lutilisation des tourteaux de coton en alimentation
animale. Zootechnica 17(1): 42-50.
Branckaert, R.D.S. & Guye, E.F. 1999. FAOs programme for support to family poultry production.
In: F. Dolberg & P.H. Petersen (eds.) Poultry as a Tool in Poverty Eradication and Promotion of
Gender Equality, pp. 244 256. Proceedings of a workshop, March 22-26, 1999, Tune Landboskole,
Denmark (also available at http://www.husdyr.kvl.dk/htm/php/tune99/24-Branckaert.htm
Branckaert, R.D.S., Gaviria, L., Jallade, J. and Seiders, R.W. 2000 Transfer of technology in poultry
production for developing countries. In: FAO Sustainable Development Dimensions of October 2000
and Also in: proceedings of WPC2000 Montreal, Canada, and also available (under the same title)
posted on October 2000 on the website: www.fao.org/ag/aga/AGAP/LPA/fampo1/links.htm
Burgess, G.W. 1992. The development of commercial antigen and antibody detection assays for
Newcastle disease virus. In: P. B. Spradbrow (Ed.), Proceedings of an international workshop
Newcastle Disease in Village Chickens: Control with thermostable oral vaccines. 6-10 October, Kuala
Lumpur, Malaysia, ACIAR Proceedings No. 39: 25-28.
Bussi, B. 1987. Disease as a constraint on productivity in extensively managed poultry. Unpublished
MSc, University of Edinburgh, Edinburgh.
Chabeuf, N. 1990. Disease prevention in smallholder village poultry production in Africa., In
Proccedings of Smallholder rural poultry production - Requirements of research and development.
Thessaloniki, Greece, 1: 129-138.
Chavunduka, D.M. 1976. Plants regarded by Africans as being of medicinal value to animals. Rhodesian
Veterinary Journal, 7(1), 6-12.
Chen, Bao-Ji. 1991. Duck production in the far east and south Pacific. Poultry International. 30 (1): 14-
18.
Chinombo, D., Jere, J., Kapelemer-Phiri, G. & Schleiss, K. (2001). The Malawi smallholder poultry
production model (MSPPM): A Poverty reduction strategy. In: Livestock, Community and
Environment. Proceedings of the 10th Conference of the Association of Institutions for Tropical
Veterinary Medicine, Copenhagen, Denmark, 2001.
Chowdhury, S.D., Roy, C.R. & Sarker, A.K. 1996. Urea in poultry nutrition. Asian-Australasian
Journal of Animal Sciences 9(3): 241-245.
Coligado, B.C., Lambio A.L. & Luis E.S. 1986. U.P.L.B. Res. 5: 10-13.
Country Profile, 1994. Country Profiles or Around the World. Uganda on ducks. Poultry International
Vol 33, 1994.
Copland, J. W. (Ed.). 1987. Newcastle Disease in Poultry: A New Food Pellet Vaccine. Monograph No.
5. ACIAR, Canberra, 119 p.
Creswell, D.C. & Gunawane, B. 1982. Indigenous chickens in Indonesia: Production characteristics in
an improved environment. Research Institute for Animal Production, Bogor, Indonesia. Report No. 2:
9-14.
128 Bibliographie

Dalziel, J.M. 1937. The useful plants of West Tropical Africa. Crown Agents, London, 612p.
Danida-KVL 2002. Improving the health and productivity of the rural chicken in Africa
(Tanzania).Danida-KVL research results 1996-99 Tanzania Enreca. Improving the health and
productivity of the rural poultry in Africa - 2nd phase of an Enreca project, both in
<http://www.poultry.kvl.dk/IVM_Enreca.htm>
Danvivatanaporn, J. 1987. Thailand - Poultry production. In: J. W. Copland (Ed.), Newcastle Disease in
Poultry: A New Food Pellet Vaccine ACIAR Monograph No. 5: 108-109.
De Vries, H. 1995. Performance of free range hybrids in Nicaragua. ILEIA, p 28.
Egbe, O. 1989. Utilization of palm oil effluent in layer's diet as an alternative source of energy. In:
Babatunde, G.M. (Ed.). Proceedings National Workshop on Alternative Formulations of
Livestock Feeds in Nigria. ARMTI, Ilorin. Economic Affairs Office, The Presidency, pp. 723-734.
Eissa, Y.M. 1987. Prevalent poultry diseases in hot climate zones and problems of their control.
Zootecnica International (Feb): 60-62.
Elson, H.A. 1992. Evaluation of economic aspects of housing systems for layers. Proc. XIX World's
Poultry Congress, Amsterdam, Vol.2: 503-508.
Fabiyi, J.P. 1980. Survey on lice infesting domestic fowl on the Jos Plateau, Northern Nigria. Bulletin
of Animal Health and Production in Africa, 28: 215-219.
FAO, 1961. Marketing eggs and poultry. Stewart and Abbott. FAO Animal Production and Health Series
No. 5 and FAO Marketing Guide No. 4.
FAO, 1984. Rapport de lAtelier FAO sur le dveloppement de laviculture rurale dans les pays
francophones de lAfrique de louest, centrale et de lest. FAO, Rome.
FAO, 1987. Construction and operation of small solid-wall bins. Bodholt, O. & Diop, A. FAO
Agricultural Services Bulletin No.69. FAO, Rome.
FAO, 1988. The role of women in the adoption of new practices. Paper presented at the World
Conference on Animal Production, Helsinki, 1988. 18pp.
FAO/Anonymous, 1989. FAO/UNDP Small Stock Development Project in North Kivu, Zaire.
Monograph, FAO, Rome.
Farina, L., Demey, F. & Hardouin, J. 1991. Production de termites pour l'aviculture villageoise au
Togo. Tropicultura 9 (4): 181-187.
Farrell, D.J. 1986. Energy expenditure of laying ducks: confined and herded. In: Farrell, D.J. and
Stapleton, P.(eds) Duck Production Science and World Practice. University of New England,
Armidale, NSW., 70-82.
Farrell, D.J. 1997. Integrated wetland rice and duck production systems in humid tropics of Asia:
Current and future trends. Proc. 11th European Symposium on Waterfowl, Nantes (France), 483-489.
Fatihu, M.Y., Ogbogun, V.C., Njoku, C.O., & Saror, D.I. 1992. Observations on lesions associated
with some gastrointestinal nematodes of chickens in Zaria, Nigria. Bulletin of Animal Health and
Production in Africa, 40(1), 15-18.
Fattah, K.A., 1999. Poultry as a tool in poverty eradication and promotion of gender equality. In: F.
Dolberg & P.H. Petersen (eds.) Poultry as a Tool in Poverty Eradication and Promotion of Gender
Equality, pp. 16 -28. Proceedings of a workshop, March 22-26, 1999, Tune Landboskole, Denmark
(also available at
http://www.husdyr.kvl.dk/htm/php/tune99/2-Fattah.htm
Forssido, T. 1986. Studies on the meat production potential of some local strains of chickens in Ethiopia.
PhD Thesis, Justus-Liebig University, Giessen, Germany.
French, K.M. 1981. Practical Poultry Raisings. Peace Corps Information Collection and Exchange,
Washington, D.C, 153-168.
Fuan, Liu 1987. The parched rice incubation technique for hatching duck eggs. In: Farrell, D.J. and
Stapleton, P.(eds) Duck Production Science and World Practice,University of New England,
Armidale, NSW, 178-182.
Gaffar Elamin, M.A., Khalafalla, A.I., & Ahmed, S.M. 1993. Observations on the use of Komarov
strain of Newcastle disease vaccine in the Sudan. Tropical Animal Health and Production, 25: 151-
154.
George, J.B.D., Otobo, S., Ogunleye, J., & Adediminiyi, B. 1993. Louse and mite infestation in
domestic animals in northern Nigria. Tropical Animal Health and Production, 25, 121-124.
Gunaratne, S.P., Chandrasiri, A.D.N., Hemalatha, W.A.P.M., & Roberts, J.A. 1993. Feed resource
base for scavenging village chickens in Sri Lanka. Tropical Animal Health and Production 26: 249-
257.
Aviculture Familiale 129

Gunaratne, S.P, Chandrasiri, A.D.N., Wickramaratne, S.H.G. & Roberts, J.A. 1994. The utilisation
of scavenging feed resource base for village chicken production. Proc.Seventh Asian Australasian
Association for Animal Production Congress, Bali, Indonesia, 2: 67-68.
Guye, E.F. 1998. Village egg and fowl meat production in Africa. Worlds Poultry Science Journal 54
(1), 73-86
Haaren-Kiso, A., Horst, van, P. & Valle Zarate, A. 1995. Direct and Indirect effects of the frizzle gene
on the productive adaptability of laying hens. Animal Research and Development, 42: 98-114.
Hahn, D.T., Hai L.T., Hung D.S., & Tinh, N.H. 1995. Improving the productivity of local Muscovy
duck with high yielding exotic Muscovy duck and the initial production experiment of Mullard in
Vietnam. Proc.10th European Symposium on Waterfowl, Halle, Germany. World's Poultry Science
Association, 31-39.
Huque, Q.M.E. 1999. Poultry research in Bangladesh: present status and its implication for future
research. In: F. Dolberg & P.H. Petersen (eds.) Poultry as a Tool in Poverty Eradication and
Promotion of Gender Equality, pp. 151 - 164. Proceedings of a workshop, March 22-26, 1999, Tune
Landboskole, Denmark (also available at http://www.husdyr.kvl.dk/htm/php/tune99/15-Haque.htm
Horst, P. 1989. Native fowl as reservoir for genomes and major genes with direct and indirect effect on
adaptability and their potential for tropical orientated breeding plans. Arch. Geflgelkd. 53: 93-101.
Horst, P. 1990a. Waterfowl in China. Poultry International , 29(4): 16-20.
Horst, P. 1990b. Research and development perspectives. Proc. Seminar on smallholder rural poultry
production, Thessaloniki, Greece, 61-69.
Huchzermeyer, F.W. 1973. Free-ranging hybrid chickens under African tribal conditions. Rhodesian
Agricultural Journal, 70:73-75.
Horst, P., Mathur P.K. & Valle Zarate, A. 1996. Breeding policies for specific tropical environments
using appropriate combinations of major genes. Proc. XX World Poultry Congress, New Delhi, India,
Vol. 1: 633-640.
Hutagalung, R.I. 1981. The use of tree crops and their by-products for intensive animal production. In:
Smith, A.J. & Gunn, R.G. (Eds.). Intensive animal production in the developing countries. Occasional
Publication No. 4. British Society of Animal Production, 151-184.
Ideris, A., Ibrahim, A. L., & Spradbrow, P. B. 1990. Vaccination of chickens against Newcastle
disease with a food pellet vaccine. Avian Pathology, 19(2), 371-384.
Jagne, J., Aini, I., Schat, K. A., Fennell, A., & Touray, O. 1991. Vaccination of village chickens in the
Gambia against Newcastle disease using the heat-resistant, food-pelleted V4 vaccine. Avian
Pathology, 20(4), 721-724.
Janviriyasopak, O., Thitisak, W., Thepkraiwan, L., Jongsathien, K., Mekapratheep, M., von
Kruedner, R. & Morris, R.S. 1989. A health and productivity study of village poultry. Proc. of the
International Seminar on Animal Health and Production Services for Village Livestock. Khon Kaen
Thailand. 161-171.
Jayawardane, G.W.L., Alwis, M.C.L.D., & Bandara, D.A.W.W.D.A. 1990. Oral vaccination of
chickens against Newcastle disease with V4 vaccine delivered on processed rice grains. Australian
Veterinary Journal, 67(10): 364-366.
Jensen, H.A., 1999 Paradigm and Visions: Network for Poultry Production and Health in Developing
Countries. In: F. Dolberg & P.H. Petersen (eds.) Poultry as a Tool in Poverty Eradication and
Promotion of Gender Equality, pp. 31 - 38. Proceedings of a workshop, March 22-26, 1999, Tune
Landboskole, Denmark (also available at
http://www.husdyr.kvl.dk/htm/php/tune99/3-AJensen.htm
Kabatange, M.A. and Katule, A.M. 1989. Rural poultry production systems in Tanzania. In: E. B.
Sonaiya (Ed.) Rural Poultry in Africa. Proc. of an International Workshop, Ile-Ife, Nigria, 13-16
November, 1989: 171-176.
Katule, A.M. 1991. Performance of local chickens under scavenging and intensive management systems.
Entwicklung + lndlicher raum 5: 26-28.
Kelly, P. J., Chitauro, D., Rohde, C., Rukwava, J., Majok, A., Davelaar, F., & Mason, P. R. 1994.
Diseases and management of backyard chicken flocks in Chitungwiza, Zimbabwe. Avian Diseases,
38(3), 626-629.
Khadijah, E. 1988. Ph.D. Thesis, Univ. Malaya, Kuala Lumpur. 212.
Khalafalla, A..I. 1994. Isolation and characterization of lentogenic Newcastle disease viruses from
apparently healthy chickens in the Sudan. Bulletin of Animal Health and Production in Africa, 42(3):
179-182.
130 Bibliographie

Khomari, L. 2000 (Chairperson) Final Discussion: Lessons for Future Research and Development: How
do we use data to develop a rural poultry development programme? In: Issues in Family Poultry
Development Research. Sonaiya, E.B. (ed). 2000. Proceedings of an International workshop held on
December 9-13, 1997 at MBour, Senegal. Published by the INFPD, c/o Prof. E.B. Sonaiya (Coordinator),
Department of Animal Science, Faculty of Agriculture, Obafemi Awolowo University, Ile-Ife, Nigria.
pp204. Also available on the FAO /INFPD website: http://www.fao.org/ag/aga/AGAP/LPA /fampo1
/proceed.htm
Kim, S.J., & Spradbrow, P.B. 1978. Some properties of lentogenic Australian Newcastle disease virus.
Veterinary Microbiology, 3: 129-141.
Kingston, D.J. 1980. The productivity of scavenging chickens in some villages of West Java, Indonesia.
Proc. of the South Pacific Poultry Science Convention, Auckland, New Zealand. 228-236.
Kingston, D.J & Creswell, D.C 1982. Indigenous chickens in Indonesia: population and production
characteristics in five villages in West Java. Research Institute for Animal Production, Bogor,
Indonesia, Report No. 2, 3-8.
Kobling, S. 1989. Abschlubericht, Station Avicole Dosso, Niger. GTZ. 8pp.
Koeslag, G.J. 1992. The role of poultry in the rural areas. Proc.of the Introductory Seminar on Poultry
Development Policy, Barneveld College, 7-16 September 1992, Barneveld, The Netherlands. 17-23.
Koster, E. (Ed.) 1996. Poultry Farming Systems for Small Commercial Farmers. Proc. of a Poultry
Workshop held at the Animal Improvement Institute, Irene, South Africa.
Mack, S. 1998. Type and sources of information on family poultry. In INFPD Newsletter Vol. 8 No. 2,
February - March 1998. From Guidelines for the inclusion of improved household poultry production,
Special Programme For Food Security (SPFS), May 1997: pp. 13-14. AGA Divisional SPFS Focal
Point, FAO, Rome, Italy.
Majiyagbe, K.A., & Nawathe, D.R. 1981. Isolation of virulent Newcastle disease virus from apparently
normal ducks in Nigria. Veterinary Record, 108(9): 190.
Mathur, P.K. and Horst, P. 1989. Temperature stress and tropical locations as factors for genotype x
environment interactions in poultry production. Proc. Genotype and environment interactions in
poultry production, INRA, Jouy-en-Josas (France): 83-96.
Matthewman, R.W. 1977. A survey of Small Livestock at the village level in derived Savanna and
Lowland Forest Zones of South West Nigria. Study No. 4, University of Reading.
Mavale, A.P. 1995. Epidemiology and control of Newcastle disease in rural poultry in Mozambique.
Unpublished MSc., University of Reading, Reading.
Mbugua P.N. 1990. Proc Rural small-holder poultry production in Kenya. Vol. 2: 119-131.
McInerney, J. 1992. Economic aspects of disease in poultry production. Proc. XIX World Poultry
Congress, Vol 2: 561-566.
Meulemans, G., Letellier, C., Gonze, M., Carlier, M.C., & Burny, A. 1988. Newcastle disease virus F
glycoprotein expressed from a recombinant vaccinia virsu vector protects chickens against live-virus
challenge. Avian Pathology, 17: 821-827.
Mkangare, M.M.J. 1989. Collection of Tanzanian medicinal plants for biological activity studies. Paper
presented at the 7th Tanzania Veterinary Association, Dar es Salaam.
Moerad, B. 1987. Indonesia: Disease Control. In: J. W. Copland (Ed.), Newcastle Disease in Poultry: A
New Food Pellet Vaccine. ACIAR Monograph No. 5: 73-76.
National Research Council 1984. Nutrient Requirements of Poultry. Subcommittee on Poultry Nutrition,
National Academy Press, Washington, D.C.
Nawathe, D. R. 1982. Isolation of poxvirus from an outbreak in turkey poults. Sudan Journal of
Veterinary Science and Animal Husbandry, 23(2), 140-141.
Negesse, T. 1991. Survey of internal parasites of local chickens of southern Ethiopia. Indian Journal of
Poultry Science, 26(2): 128-129.
Nielsen, H. (2000) Food and nutrient intake among females in rural Bangladesh - How does a poultry
project benefit women and girls? Master Thesis in Human Nutrition. Research Department of Human
Nutrition. The Royal Veterinary and Agricultural University. Copenhagen, Denmark.
Nwokolo, E.N., Bragg, D.B. & Saben, H.S. 1977. A nutritive evaluation of palm kernel meal for use in
poultry rations. Tropical Science 19: 147-154.
Nwosu, C.C. 1979. Characterization of the local chicken of Nigria and its potential for egg and meat
production. In: Proceedings 1st national Seminar on Poultry Production in Nigria, Ahmadu Bello
University, Zaria, December 11-13. National Animal Production Research Institute, 187-210.
Nwude, N., & Ibrahim, M.A. 1980. Plants used intraditional veterinary medical practice in Nigria. J.
Vet. Pharmacol. & Therapeutics, 3: 261-273.
Aviculture Familiale 131

Obi, O.O. and E.B. Sonaiya. 1995. Gross margin analysis of smallholder rural poultry production in
Osun State. Nigrian Journal of Animal Production, 22: 95-107.
Odi, H. Diambra. 1990. State of smallholder rural poultry production in Cote d'Ivoire. Proceedings of
CTA International Seminar on Smallholder Rural Poultry Production, 9-13 October, 1990,
Thessaloniki, Greece, pp 105-116.
Oh, B.T. 1987. Malaysia: Economic importance. In: Copland, J.W. (ed.) 1987. Newcastle Disease in
Poultry: A New Food Pellet Vaccine. ACIAR Monograph No. 5, Canberra, pp. 83-85.
Ojeniyi, A. 1984. "Salmonella hirschfeldii" in poultry and man in Ibadan, Nigria. Bulletin of the World
Health Organization, 62(5), 773-775.
Ojeniyi, A. A. 1985. Comparative bacterial drug resistance in modern battery and free-range poultry in a
tropical environment. Veterinary Record, 117(1), 11-12.
Olawoye, J.E. and D.C. di Domenico, 1990. Socio-cultural factors related to livestock production in
southern Nigria. Paper presented at the National conference on Nigrian livestock industry and
prospects for the 1990s, Kaduna, Nov. 19-22, 1990, NISER, 18pp.
Olori, V. E. and E. B. Sonaiya. 1992a. Composition and shell quality of white and brown eggs of the
Nigria Indigenous chicken. Nigrian Journal of Animal Production 19:12-14.
Olori, V. E. and E. B. Sonaiya. 1992b. Effect of length of lay of Nigria Indigenous chickens on their
egg composition and shell quality. Nigrian Journal of Animal Production 19:95-100.
Oluyemi, J.A. 1979. Potentials of the indigenous species of poultry for meat and egg production in
Nigria. In: Proceedings 1st national Seminar on Poultry Production in Nigria, Ahmadu Bello
University, Zaria, December 11-13. National Animal Production Research Institute, pp. 163-186.
Oluyemi, J.A. and Roberts F.A. 1988. Manure parameters In Poultry production in warm wet climates,
p.113. Macmillan, London.
Omeje, S.S.I. and Nwosu, C.C. 1986. 3rd World Cong. Genet. Appl. Livest. Prod.. Nebraska. Vol. X:
304-310.
Onwudike, O.C. 1986. Palm kernel as a feed for poultry. Animal Feed Science and Technology 16: 179-
202.
Ouandaogo, Z.C. 1990. Programme de dveloppement des animaux villageois (PDAV), In Proc.of
Smallholder rural poultry production - Requirements of research and development, Thessaloniki,
Greece, 9-13 October, 1990. Vol. 2, 27-36.
Permin, A. 2002. Draft Report on results from field-based research related to the production and health
of rural scavenging poultry in Bangladesh. August 2002. Personal Communication.
Prasetyo, T., Subiharta, W.D., & Sabrani, M. 1985. The effect of chick and hen separation on village
chicken egg productivity. 1984/1985 Research Report, Research Institute for Animal Production,
Indonesia, p22.
Prawirokusumo, S. 1988. Problems to improve small scale native chickens management in South-east
Asian countries. Proc XVIII World's Poultry Congress, Japan, 113-116.
Ramm G., Balzer, G., Eckert, M. v., Hugo, R., Massler, B., Mller, R., & Richter, J. 1984. Animal
Husbandry in East Kalimantan: Integration of animal husbandry into transmigrant farming systems in
the middle Mahakam area in East Kalimantan, Indonesia.Fachbereich Internationale Agraentwicklung,
Technische Universitt Berlin, Berlin, Publication No.84, 4-5.
Ratanasethakul, C. 1988. Study of Newcastle disease vaccination one to four times a year in native
chickens raised in the village. Thai Journal of Veterinary Medicine, 18(1): 3-7.
Rauen, H.W, de los Santos, M. and Fabian, P. 1990. Actual situation of the small scale poultry
production in rural areas in the Dominican Republic and improving perspectives for the future. Proc.
Seminar on Smallholder Rural poultry Production, Thessaloniki, Greece 9-13 October 1990.
Roberts, J.A., 1999. Utilisation of Poultry Feed Resources by Smallholders in the Villages of
Developing Countries. In: F. Dolberg & P.H. Petersen (eds.) Poultry as a Tool in Poverty Eradication
and Promotion of Gender Equality, pp. 311 - 336. Proceedings of a workshop, March 22-26, 1999,
Tune Landboskole, Denmark (also available at
http://www.husdyr.kvl.dk/htm/php/tune99/28-Roberts.htm
Roberts, J.A., Gunaratne, S.P., Wickramaratne, S.H.G & Chandrasiri, A.D.N. 1994. Proc. of the
Seventh Asian-Australasian Association for Animal Production Congress, Bali, Indonesia, 2: 34-35.
Roberts, J.A. & Senaratne, R. 1992. The successful introduction of hybrid egg laying chickens into a
Sri Lankan village. Proc. 19th World Poultry Congress, Amsterdam, 1: 818-821.
Sa' idu, L., Abdu, P.A., Umoh, J.U., & Abdullahi, U.S. 1994. Diseases of Nigrian indigenous
chickens. Bulletin of Animal Health and Production in Africa, 42(1): 19-23.
132 Bibliographie

Sagild, I.K., Haresnape, J.M. 1987. The status of Newcastle disease and the use of V4 vaccine in
Malawi. Avian Pathology, 16(1): 165-176.
Sagild, I.K., & Spalatin, J. 1982. Newcastle disease vaccination with the V4 strain in Malawi.
Laboratory and field studies. Avian Diseases, 26: 625.
Salatin, J. 1993. Pastured Poultry Profits. PolyfaceInc., Swoope, Virginia.
Saleque, M.A. 1999. Scaling-up: Critical factors in leadership, management, human resource
development and institution building in going from pilot project to large-scale implementation: The
BRAC poultry model in Bangladesh. In: F. Dolberg & P.H. Petersen (eds.) Poultry as a Tool in
Poverty Eradication and Promotion of Gender Equality, pp. 51 - 71. Proceedings of a workshop,
March 22-26, 1999, Tune Landboskole, Denmark (also available at
http://www.husdyr.kvl.dk/htm/php/tune99/5-Saleque.htm
Sall, B. 1990. Contribution a letude des possibilites damelioration de la production en aviculture
traditionnelle: mesure du potentiel de la race locale et des produits dun croisement ameliorateur.
MSc. thesis, Institut National de Developpement Rural, St. Louis, Senegal. p 32
Samson, A.C.R. 1988. Virus structure. In: D. J. Alexander (Ed.), Newcastle Disease. Kluger Academic
Publishers, London, 23-44.
Samuel, J.L., Bensink, Z., & Spradbrow, P.B. 1993. Oral vaccination of chickens with the V4 strain of
Newcastle disease virus: Cooked and raw white rice as a vehicle. Tropical Animal Health and
Production, 25: 3-10.
Samuel, J.L., & Spradbrow, P.B. 1989. Persistence of the V4 strain of Newcastle disease virus in open-
range flock of chickens. Veterinary Records, 124: 193-196.
Sani, R.A., Harisah, M., Ideris, A., & Shah-Majid, M. 1987. Malaysia: Fowl diseases. In: J. W.
Copland (Ed.), Newcastle disease in poultry: A new food pellet vaccine. ACIAR Monograph No. 5:
89-92.
Saunders, M.J. 1984. La trichose de la pintade en Haute-Volta: une protozoose meutriere et meconnue.
Projet de Dveloppement de lAviculture Villageoise, Ministre du Dveloppement Rural,
Ouagadougou, Burkina Fase.
Sazzad, M.H, Ebadul, M.H. & Asaduzzaman, M.U. 1990. Egg peroduction by desi (indigenous) hens
in rural Bangladesh. Tropical Animal Health and Production 22:22.
Setioko, A.R. 1997 Recent study on traditional system of duck layer flock management in Indonesia.
Proc. 11th European Symposium on Waterfowl, Nantes (France), Sept. 8-10, 1997. 491-498.
Sharma, R.N., Hussein, N.A., Pandey, G.S., & Shandomo, M.N. 1984 A study on Newcastle disease
outbreaks in Zambia, 1975-1984. Revue Scientifique et Technique, Office International des Epizooties,
5(1): 5-14.
Shingari, B.K., Sapra, K.L. and Mehta, R.K. 1994. Guinea fowl in the Punjab. Poultry International,
Vol.33(7): 54.
Siddiqui, S., Tarik, N., Bina, S.S. and Shaheen, F. 1986. Isolation of a triterpenoid from Azadirachta
indica. Phytochemistry 25 (9): 2183-2186.
Simmons, G.C. 1967. The isolation of Newcastle disease in Queensland. Australian Veterinary Journal,
43, 29 -.
Smith, A.J. 1990. Poultry _ Tropical Agriculturist Series. CTA, Macmillan Publishers, London, pp 179-
184.
Smith, O.B., Ilori, J.O. & Onesirosan, P. 1984. The proximate composition and nutritive value of the
winged bean Phosphocarpus tetragonolobus (L) DC. for broilers. Animal Feed Science & Tech. 11:
231-237.
Sonaiya, E.B. 1989. Animal by-products and their potential for commercial livestock feed production. In:
Babatunde, G.M. (Ed.). Proc. National Workshop on Alternative Formulations of Livestock Feeds in
Nigria. ARMTI, Ilorin, Nigria, Nov. 21-25, 1988, Economic Affairs Office, The Presidency, 298-
315.
Sonaiya, E.B. 1990a. The context and prospects for development of smallholder rural poultry production
in Africa. Proc.Seminar on Smallholder Rural Poultry Production, Thessaloniki, 9-13 October, 1990,.
Vol.1: 35-52.
Sonaiya, E.B. 1990b, ANRPD Proc. as cited in The International Network for Family Poultry
Development (INFPD): origins, activities, objectives and visions. In: F. Dolberg & P.H. Petersen
(eds.) Poultry as a Tool in Poverty Eradication and Promotion of Gender Equality, pp. 39 - 50.
Proceedings of a workshop, March 22-26, 1999, Tune Landboskole, Denmark (also available at
http://www.husdyr.kvl.dk/htm/php/tune99/4-Sonaiya.htm
Sonaiya, E.B. 1990c. Poultry husbandry in small rural farms. Entwicklung + lndlicher raum 4: 3-6.
Aviculture Familiale 133

Sonaiya, E.B. 1992. The Guinea fowl: the status of knowledge in the arid to the sub-humid zones of West
Africa. Paper presented to the FAO workshop on Guineafowl Development in African Dry Areas,
Ouagadougou (Burkina Faso), October 18-24, 1992
Sonaiya, E.B. 1993. Evaluation of non-conventional feed ingredients as supplements for scavenging
chicken. Proc. VII World Conference on Animal Production, Edmonton, Alberta, 1993, 28-29.
Sonaiya, E.B. 1995. Feed resources for smallholder poultry in Nigria. World Animal Review, 82 (1): 25-
33.
Sonaiya, E.B. (ed). 2000. Issues in Family Poultry Development Research. Proceedings of an International
workshop held on December 9-13, 1997 at MBour, Senegal. Published by the INFPD, c/o Prof. E.B.
Sonaiya (Coordinator), Department of Animal Science, Faculty of Agriculture, Obafemi Awolowo
University, Ile-Ife, Nigria. pp204. Also available on the FAO/INFPD website:
<http://www.fao.org/ag/aga/AGAP/LPA/fampo1/fampo.htm>
Sonaiya, E.B. Branckaert, R.D.S. & Guye, E.F. 1999. Research and development options for family
poultry. In: Introductory paper to the First INFPD/FAO electronic conference on family poultry,
December 1998 to July 1999 (extended). Also available at the FAO/INFPD website:
<http://www.fao.org/ag/aga/AGAP/LPA/fampo1/fampo/Intropap.htm
Sonaiya, E.B. & Omole, T.A. 1977. Cassava peels for finishing pigs. Nutrition Reports International 16
(4): 479-486.
Soukossi, A. 1992. Maggot production for fish and poultry production. ANRPD Newsletter Vol. 3 (2): 6.
Spradbrow, P.B. 1993/94. Newcastle disease in village chickens. Poultry Science Review, 5(2): 57-96.
Ssenyonga, G. S. 1982. Prevalence of helminth parasites of domestic fowl (Gallus domesticus) in
Uganda. Tropical Animal Health and Production 14:201-204.
Sugrim, A.M. 1987. Role of livestock in socio-economic development of small farmers in the Pacific
Island countries. Asian Livestock (October 1987): 127-131.
Suleiman, H. 1990. An address to the International workshop on Rural Poultry Development. In: E. B.
Sonaiya (Ed.), Rural Poultry in Africa. Proceedings of an International Workshop, Ile-Ife, Nigria,
13-16 November, 1989. African Network on Rural Poultry Development (ANRPD), 7-8.
Supramaniam, P. 1988. Economic importance of Newcastle disease vaccine to the village poultry
industry in Malaysia. In: Proceedings of the Second Asian/Pacific Poultry Health Conference,
Surfers Paradise, Australia, 23-25 September 1988: 511-516.
Tadelle, D., Alemu, Y., & Peters, K.J. 2000. Indigenous chickens in Ethiopia: genetic potential and
attempts at improvement. World Poultry Science Journal, 56(1): 45- 54.
Tantaswasdi, U., Danvivatanaporn, J., Siriwan, P., Chaisingh, A. & Spradbrow, P.B. 1992.
Evaluation of an oral Newcastle disease vaccine in Thailand. Preventive Veterinary Medicine, 12, 87-.
ter Horst, K. 1986. Poultry Management in rural areas of developing countries: Matching technical
demands with social facts. Unpublished report, Department of Livestock Services, Ministry of
Livestock and Fisheries, Bangladesh.
ter Horst, K. 1987 Some remarks on poultry improvement in Bangladesh as related to socio-economic
factors. Paper presented to the FAO Expert Consultation on Rural Poultry Development in Asia,
Dhaka, Bangladesh.
The Bin, N. 1996. Economic efficiency of duck raising in the Mekong River Delta, ACIAR Proceedings
(Ed. Pryor, W.J.), ACIAR, Canberra, No. 68: 138-145.
Thitisak, W. 1992. Untersuchungen ber die Hufigkeit und Ursachen der Abgnge bei der
kleinbuerlichen Geflgelhaltung in Nordosten Thailands. Unpublished Dr. Med. Vet., Tierrtzlichen
Hochschule Hannover, Hannover. 84p.
Thitisak, W., Janviriyasopak, O., Morris, R.S., Srihakim, S., & Kruedener, R. v. 1989. Causes of
death found in an epidemiological study of native chickens in Thai villages. Acta Veterinaria
Scandinavia, 84(Suppl.): 200-202.
Tucker,S. 1989. Alternatives?, ADAS Poultry Journal 3 (1): 15-30.
Udedibie, A.B.I. 1991. Relative effects of heat and urea-treated jackbean (Canavalia ensiformis) and
swordbean (Canavalia gladiata) on the performance of laying hens. Livestock Research for Rural
Development Vol. 3 (3): 68-76.
Udo, H. 1992. Are free range poultry relevant? N-CT-R Livestock Newsletter 5 (2): 2.
van Veluw, K. 1987. Traditional poultry keeping in Northern Ghana. ILEIA-December 1987, Vol. 3(4):
12-13.
Verger, M. 1986. La prophylaxie de la maladie de Newcastle dans les levages villageois en Afrique.
Laviculteur, 465: 44-48.
134 Bibliographie

Vorster, A., Adjovi, A., Demey, F. 1992. Protines dans les aliments des poules. Lutilisation dEudrilus
eugeniae et Eisenia fetida dans des conditions tropicales. Bulletin du R.A.D.A.R., 2(1):3.
Watt, J.M., & Breyer-Brandwijk, M.G. 1962. The Medicinal and Poisonous Plants of Southern and
Eastern Africa.E & S Livingstone Ltd, Edinburgh and London,
Wibberley, G. 1994. Monitoring of highly virulent infectious bursal disease in Botswana 1989 to 1993.
Tropical Animal Health and Production, 26(3): 161-162.
Wickramaratne, S.H.G., Gunaratne, S.P., Chandrasiri, A.D.N, & Roberts, J.A. 1994. Chick
mortality in scavenging village chickens in Sri Lanka. Proc.of the Asian-Australasian Association for
the Advancement of Animal Production, Bali, Indonesia, 2: 71-72.
Young, J.R. 1987. Training of Community Animal First Aid Workers. ILEIA-December Vol.3(4): 14-15.
Young, P. 1991. The use of heat resistant V4 Newcastle disease vaccine in Asia. In: F. Demey & V. S.
Pandey (Eds.), Newcastle disease vaccination of village poultry in Africa and Asia. Proceedings of
seminar held in Antwerp, Belgium, 13-14 February, 1991, 19-27.
Zoungrana, B. & Slenders, G., 1993. Poultry in the Backyard in Burkina Faso. ILEIA, 18 (3): 17
/#07'.5(#1&'241&7%6+10'65#06#0+/#.'5

 2TQFWEVKQPGPCXKEWNVWTGHCOKNKCNG
(

&KURQPKDKNKVLCPXKGT

# #PINCKU /WNVKN /WNVKNKPIWG


#T #TCDG 'RWKU
% %JKPQKU 'PRTRCTCVKQP
' 'URCIPQN
( (TCPCKU
2 2QTVWICKU

1PRGWVUGRTQEWTGTNGU/CPWGNU(#1FGRTQFWEVKQPGVUCPVCPKOCNGUCWRTUFGURQKPVUFGXGPVGFGURWDNKECVKQPUFGNC(#1QWGP
UCFTGUUCPVFKTGEVGOGPVCW)TQWRGFGUXGPVGUGVFGNCEQOOGTEKCNKUCVKQP(#18KCNGFGNNG6GTOGFK%CTCECNNC4QOG+VCNKG

/#07'.5(#1&'5#06#0+/#.'

 /CPWCNQPVJGFKCIPQUKUQHTKPFGTRGUV
 /CPWCNQPDQXKPGURQPIKHQTOGPEGRJCNQRCVJ[
 'RKFGOKQNQI[FKCIPQUKUCPFEQPVTQNQHJGNOKPVJRCTCUKVGUQHUYKPG
 'RKFGOKQNQI[FKCIPQUKUCPFEQPVTQNQHRQWNVT[RCTCUKVGU
 4GEQPPCVTGNCRGUVGFGURGVKVUTWOKPCPVU/CPWGNFGVGTTCKP
 /CPWCNQPVJGRTGRCTCVKQPQHPCVKQPCNCPKOCNFKUGCUGGOGTIGPE[RTGRCTGFPGUURNCPU
 /CPWCNQPVJGRTGRCTCVKQPQHPCVKQPCNTKPFGTRGUVEQPVKPIGPE[RNCPU
 /CPWCNQPNKXGUVQEMFKUGCUGUWTXGKNNCPEGCPFKPHQTOCVKQPU[UVGOU
 +FGPVKGTNCRGUVGRQTEKPGCHTKECKPG7POCPWGNFGVGTTCKP
 /CPWCNQPRCTVKEKRCVQT[GRKFGOKQNQI[/GVJQFUHQTVJGEQNNGEVKQPQHCEVKQPQTKGPVGFGRKFGOKQNQIKECNKPVGNNKIGPEG
 /CPWCNQPVJGRTGRCTCVKQPQH#HTKECPUYKPGHGXGTEQPVKPIGPE[RNCPU
 /CPWCNQPRTQEGFWTGUHQTFKUGCUGGTCFKECVKQPD[UVCORKPIQWV
 4GEQPPCVTGNCRTKRPGWOQPKGEQPVCIKGWUGDQXKPG
 2TRCTCVKQPFGURNCPUFKPVGTXGPVKQPEQPVTGNCRTKRPGWOQPKGEQPVCIKGWUGDQXKPG
 2TRCTCVKQPFGURNCPUFKPVGTXGPVKQPEQPVTGNCXTGFGNC8CNNGFW4KHV
 2TGRCTCVKQPQHHQQVCPFOQWVJFKUGCUGEQPVKPIGPE[RNCPU
 4GEQIPK\KPI4KHV8CNNG[HGXGT
1
Pr oduction en avicultur
Lobjectif de ce livre est de procurer au lecteur un guide technique pour la mise en uvre
dune production de volaille domestique rentable et durable dans les pays en
dveloppement. Louvrage tente de couvrir tous les aspects de production spci lis aux
dif frences rgionales et aborde galement de nombreuses questions lies la production,
notamment dans les domaines de lalimentation, du logement, de la gestion et de la
pratique dlevage, de la sant et de la reproduction. Cet ouvrage possde une grande
valeur pratique pour ceux qui souhaiteraient entreprendre un levage de volaille petite

e familiale
chelle, ainsi que pour ceux qui en possdent dj et galement pour les tudiants o les
organismes de dveloppement qui veulent promouvoir ce type dlevage.

ISBN 92-5-205082-5 ISSN 1810-1127


FAO

9 789252 050827
TC/M/Y5169F/1/01.04/1200

Vous aimerez peut-être aussi