Vous êtes sur la page 1sur 6

World Academy of Science, Engineering and Technology

International Journal of Chemical and Molecular Engineering


Vol:11, No:9, 2017

)DWW\$FLGDQG$PLQR$FLG&RPSRVLWLRQLQMene
maculata LQ7KH6HDRI0DOXNX
6HPXHO8QZDNRO\5HLQQHU3XSSHOD0DUHVWK\5XPDOHDQ+HDOWK\.DLQDPD

FRPSRQHQWRIPHPEUDQHVLQWKHEUDLQDQGSRVVLEO\GHOD\VWKH
Abstract²)LVKLVDNLQGRIIRRGWKDWFRQWDLQVPDQ\QXWULWLRQVRQH RQVHWRI$O]KHLPHU¶VGLVHDVH>@0RRQILVK M. maculata LVD
RIWKRVHLVWKHORQJFKDLQRIXQVDWXUDWHGIDWW\DFLGVDVRPHJDDQG RQHRISHODJLFILVKWKDWIRXQGLQWKHVHDRI0DOXNXEXWLWLVOHVV
RPHJDIDWW\DFLGVDQGHVVHQWLDODPLQRDFLGLQHQRXJKDPRXQWIRUWKH
WREHFRQVXPHGEHFDXVHRILWVOLWWOHRIIOHVKTXDQWLW\DQGDOVR
QHFHVVLW\ RI RXU ERG\ /LNH SHODJLF ILVK WKDW IRXQG LQ WKH VHD RI
0DOXNX7KLVUHVHDUFKZDVGRQHWRLGHQWLI\IDWW\DFLGVDQGDPLQRDFLGV WKHUHLVDIHZRIQXWULWLRQLQIRUPDWLRQHVSHFLDOO\DERXWIDWW\DFLG
FRPSRVLWLRQ LQ 0RRQILVK M. maculata  XVLQJ WUDQVHVWHULILFDWLRQ DQG DPLQR DFLGV FRPSRQHQW +HQFH WKH SUHVHQW ZRUN ZDV
UHDFWLRQVWHSVDQG*DV&KURPDWRJUDSK0DVV6SHFWURSKRWRPHWHU *& SODQQHG WR VWXG\ WKH SUR[LPDWH FRPSRVLWLRQ RI 0 maculata
International Science Index, Chemical and Molecular Engineering Vol:11, No:9, 2017 waset.org/Publication/10009175

06  DQG +LJK3HUIRUPDQFH /LTXLG &KURPDWRJUDSK\ +3/&  7KH WKURXJKHVWLPDWLQJWKHLUPDMRUELRFKHPLFDOFRPSRQHQWVVXFKDV


UHVXOWVKRZHGWKDWIDWW\DFLGVFRPSRVLWLRQLQ0RRQILVK M. maculata  IDWW\DFLGDQGDPLQRDFLG
FRQWDLQHGWULGHFDQRLFDFLG  SDOPLWROHLFDFLG  SDOPLWLF
DFLG  ROHLFDFLG  VWHDULFDFLG  DQG
HLFRVDWHWUDHQRLF DFLG   DQG  DPLQR DFLGV FRPSRVLWLRQ WKDW ,, 0$7(5,$/6$1'0(7+2'6
FRQVLVW RI  HVVHQWLDO DPLQR DFLGV ZHUH OHXFLQH LVROHXFLQH YDOLQH 7KHPRRQILVKM. maculata ZHUHFROOHFWHGIURPWKHODQGLQJ
SKHQ\ODODQLQH PHWKLRQLQH O\VLQH DQG KLVWLGLQH DQG DOVR  QRQ FHQWHURI$PERQ&LW\0DOXNX3URYLQFH0maculate LVSXUHO\
HVVHQWLDO DPLQR DFLG ZHUH W\URVLQH JO\FLQH DODQLQH JOXWDPLF DFLG
PDULQHILVKWKH\ZHUHEURXJKWWRWKHODERUDWRU\WKHILVKWLVVXH
DQGDUJLQLQH7KXVWKHVHILVKHVFDQEHXVHGE\WKHSHRSOHWRFRPSOHWH
WKHQHFHVVLW\RIHVVHQWLDOIDWW\DFLGDQGDPLQRDFLG  ZDV FROOHFWHG DQG GULHG DW  ƒ& LQ DQ RYHQ DQG XVHG IRU
ELRFKHPLFDO DQDO\VLV 7KH FRPSRVLWLRQV RI WKH H[SHULPHQWDO
Keywords—0RRQILVK M. maculata IDWW\DFLGDPLQRDFLG*& ILVKVDPSOHVZHUHGHWHUPLQHGE\XVLQJVWDQGDUGPHWKRGV
06DQG+3/&
A. Isolation of Oil
,,1752'8&7,21 7KHPHDWRIGULHGILVKZHLJKHGDVPXFKDVJUDPVDQG
WKHQ ZUDSSHG ZLWK ILOWHU SDSHU VKDSHG VOHHYH WKH WRS RI WKH
0 $/8.8 LV RQH RI WKH SURYLQFHV ZLWK DQ DUHD RI RFHDQ
DERXWKDVODUJHILVKHU\UHVRXUFHV+RZHYHUPRVWRI
WKH PDULQH UHVRXUFHV KDYH QRW EHHQ XVHG RSWLPDOO\ E\ WKH
VOHHYHFRYHUHGZLWKFRWWRQSXWLQWKHH[WUDFWRUDQGSXWP/
SHWUROHXP EHQ]HQH 7KH H[WUDFWLRQ LV GRQH XQWLO WKH PL[WXUH
LQVLGH WKH H[WUDFWRU EHFRPHV FOHDU 7KH H[WUDFW REWDLQHG ZDV
FRPPXQLW\ HVSHFLDOO\ IRU QXWULWLRQ DQG KHDOWK FDUH TXDOLW\
WKHQ SRXUHG LQWR D ZHLJKWHG HUOHQPH\HU YDSRUL]HG VROYHQW
LPSURYHPHQW0DULQHQDWXUDOSURGXFWVKDYHORQJEHHQXVHGDV
XVLQJ D YDFXXP SXPS FRYHUHG ZLWK ILOWHU SDSHU DQG VWRUHG
IRRGV IUDJUDQFHV SLJPHQWV LQVHFWLFLGHV PHGLFLQHV HWF
XQWLOWKHUHPDLQGHURIWKHVROYHQWHYDSRUDWHGDQGWKHQZHLJKHG
NQRZOHGJH RQ ELRFKHPLFDO FRPSRVLWLRQ RI DQ\ HGLEOH
RUJDQLVPV LV H[WUHPHO\ LPSRUWDQW VLQFH WKH QXWULWLYH YDOXH LV B. Transesterification
UHIOHFWHGLQLWVELRFKHPLFDOFRQWHQWV>@0DULQH)LVKLVRQHRI )RU IDWW\ DFLG DQDO\VLV WKH VDPSOHV ERG\ WLVVXH  ZHUH
IRRG WKDW FRQWDLQV YDULRXV QXWULHQWV VXFK DV DPLQR DFLG DQG KRPRJHQL]HGZLWKFKORURIRUPPHWKDQRO YY PL[WXUHDQG
SURWHLQ YLWDPLQV HVVHQWLDO PLQHUDOV IDWV DQG FRHQ]\PH 4 WKHVDPSOHVZHUHH[WUDFWHGXVLQJWKHPHWKRG>@,QWRWZRWKUHH
$PLQR DFLGV DUH EXLOGLQJ EORFNV IRU SURWHLQ 2Q WKH EDVLV RI QHFNIODVNVHTXLSSHGZLWKDPDJQHWLFVWLUUHUDQGDEDOOFRROHU
QHHGVIURPWKHGLHWIRUJURZWKWKHDPLQRDFLGZDVWUDGLWLRQDOO\ ZHUHLQWURGXFHGJUDPVRI0maculataRLODGGHGP/
FODVVLILHG DV QXWULWLRQDOO\ HVVHQWLDO LQGLVSHQVDEOH  RU QRQ RI%)LQPHWKDQROWKHQVWLUUHGDQGUHIOX[HGIRUPLQ
HVVHQWLDO LQGLVSHQVDEOH IRUILVK(VVHQWLDODPLQRDFLGLVWKRVH RYHU ZDWHU EDWK DW  R& 7KH UHIOX[ UHVXOWV ZHUH FRROHG DQG
WKDW HLWKHU FDQQRW EH V\QWKHVL]HG RU DUH LQDGHTXDWHO\ DIWHU FRROLQJ DGGHG  P/ RI DTXDGHV WKHQ LQVHUWHG LQWR WKH
V\QWKHVL]HG GH QRYRE\ DQLPDOV UHODWLYH WR QHHGV7KHDPLQR VHSDUDWLQJ IXQQHO WKHQ  P/ RI QKH[DQH ZDV DGGHG DIWHU
DFLGVFRQWHQW YDULHVQRWRQO\IURPVSHFLHVWRVSHFLHVEXWDOVR ZKLFKLWZDVH[WUDFWHG$IWHUIRUPLQJWZROD\HUVWKHWRSOD\HU
IURPVSHFLPHQWRWKHVSHFLPHQDQGEHWZHHQGLIIHUHQWWLVVXHV PHWK\O HVWHU  $  LV VHSDUDWHG DQG WKH ERWWRP OD\HU %  LV
7KLVYDULDWLRQGHSHQGVRQWKHHQYLURQPHQWDOFRQGLWLRQVDQGWKH H[WUDFWHG XVLQJ  P/ RI QKH[DQH WZLFH WR REWDLQ WKH XSSHU
VL]HRIWKHLQGLYLGXDOVSHFLHV,QDGGLWLRQWRIDWW\DFLGVLQILVK PHWK\O HVWHU  $  DQG ERWWRP OD\HU %  OD\HUV 7KH XSSHU
RLO KDYH D YHU\ GLVWLQFWLYH FKDUDFWHU FRPSDUHG WR IDWW\ DFLGV OD\HUV $DQG$ DUHFRPELQHGDQGWKHQZDVKHGZLWKDTXDGHV
IURPRWKHUVRXUFHV7KH\FRQVLVWQRWRQO\HVVHQWLDOIDWW\DFLGV XQWLOWKHS+LVQHXWUDODQGVHSDUDWHG)XUWKHUPRUHWKHPHWK\O
EXWDOVRDVLJQLILFDQWVRXUFHRIRPHJDIDWW\DFLGVHVSHFLDOO\ HVWHU FRDWLQJ LV DGGHG ZLWK DQK\GURXV 1D62 7KH PL[WXUH
HLFRVDSHQWDHQRLF DFLG (3$ &Q  DQG GRFRVDKH[DHQRLF ZDV ILOWHUHG DQG WKH QKH[DQH ZDV HYDSRUDWHG XVLQJ D %XFKL
DFLG '+$&Q 7KHUHDUHUHSRUWVWKDW(3$FDQSUHYHQW HYDSRUDWRU WKHQ WKH UHVXOW RI WKH PHWK\O HVWHU PL[WXUH ZDV
KHDUW GLVHDVH VLQFH LW GHFUHDVHV WULJO\FHULGHV DQG YHU\ ORZ DQDO\]HG XVLQJ *DV &KURPDWRJUDSK\0DVV 6SHFWURPHWHU
GHQVLW\OLSRSURWHLQFKROHVWHURO>@ZKHUHDV'+$LVDSULPDU\ +HZOHWW3DFNDUG86$ 

International Scholarly and Scientific Research & Innovation 11(9) 2017 681 scholar.waset.org/1307-6892/10009175
World Academy of Science, Engineering and Technology
International Journal of Chemical and Molecular Engineering
Vol:11, No:9, 2017

C. Analysis of Amino Acid Components in Acid Hydrolysis ,,,5(68/76$1'',6&866,21


7KHIDWIUHH0maculataVDPSOHZDVUHIOX[HGDWԨIRU A. Fatty Acid Analysis
KRXUVZLWKFRQFHQWUDWHG+62DIWHUZKLFKWKHVROXWLRQZDV
,VRODWLRQRI0HQHmaculataZDVGRQHE\6R[KOHWH[WUDFWLRQ
QHXWUDOL]HG E\ DGGHG %D 2+   0 VORZO\ WKHQ WKH VROXWLRQ
PHWKRG XVLQJ EHQ]HQH SHWUROHXP VROYHQW $IWHU WKH ZDWHU
ILOWHUHGWRDP/OLPLWRQWKHSXPSNLQPHDVXUHV
FRQWHQW LQ 0 maculata LV UHPRYHG ZKLFK LV GRQH EHIRUH WKH
D. Analysis of Amino Acid Components in Base Hydrolysis H[WUDFWLRQ SURFHVV WKH PRLVWXUH FRQWHQW LV REWDLQHG 
2QHJUDPRIIDWIUHH0maculataPHDWZDVUHIOX[HGDW 7KHUHVXOWVREWDLQHGIURPWKHH[WUDFWLRQRIJRIGULHGILVK
ƒ&IRUKRXUVZLWKP/ %D 2+  0WKHQVORZO\DGGHG PHDWZHUHJ  GDUNEURZQILVKRLO7KHQJ
+62 VORZO\ XQWLO WKH PL[WXUH ZDV QHXWUDO S+    DQG RI ILVK RLO ZDV XVHG IRU WUDQVHVWHULILFDWLRQ XVLQJ D  %)
ILOWHUHG 7KH ILOWUDWH LV DFFRPPRGDWHG LQ (UOHQPH\HU )XUWKHU 0HWKDQROFDWDO\VWWRREWDLQIDWW\DFLGPHWK\OHVWHUDQGDQDO\]HG
K\GURO\VLV UHVXOWV ZHUH XVHG WR LGHQWLI\ DPLQR DFLGV XVLQJ XVLQJ*DV&KURPDWRJUDSK\±0DVV6SHFWURVFRS\ *&06 7KH
+3/& 0HUFN+LWDFKL/ >@ UHVXOWRIWUDQVHVWHULILFDWLRQRI0maculataRLODQDO\]HGXVLQJ
 *&06ZDVREWDLQHGE\HOHYHQFKURPDWRJUDPSHDNVDVLQ)LJ


International Science Index, Chemical and Molecular Engineering Vol:11, No:9, 2017 waset.org/Publication/10009175


)LJ&KURPDWRJUDPRIWUDQVHVWHULILFDWLRQRI0maculata



)LJ7KHPDVVVSHFWUXPRIWKHFRPSRXQGZLWKDUHWHQWLRQWLPHRIPLQXWHV

$IWHUWKHLGHQWLILFDWLRQRIWKHPDVVVSHFWUXPRIWKHGRPLQDQW %DVHG RQ WKH PDVV VSHFWUXP LQ )LJ  LW FDQ EH PDGH
SHDNV WKHUH DUH VL[ LGHQWLILDEOH FRPSRXQGV DV SUHVHQWHG LQ IUDJPHQWHGDVLQ)LJ
7DEOH, ,Q)LJXUHLWLVVHHQWKDWWKHPROHFXODULRQRIWKHPHWK\O
 HVWHUFRPSRXQGLVQRWSUHVHQW7KHSUHVHQFHRIVDWXUDWHGERQGV
7$%/(, LVLQGLFDWHGE\WKHDSSHDUDQFHRISHDNVRQP] DQG
75$16(67(5,),&$7,215(68/72)00$&8/$7$$1$/<=('86,1**&06
ZKLFKLVDQLRQVHULHVRI&Q+Q:KLOHWKHLRQVHULHV
5HWHQWLRQ7LPH 0HWK\O(VWHUV &RPSRVLWLRQ
1R
PLQXWHV  &RPSRXQGV   RI&Q+Q2IRUWKHDOLSKDWLFHVWHUDSSHDUVWRSHDNDWP] 
  7ULGHFDQRLF  DQG7KHSHDNZLWKP] FRPHV
  3DOPLWROHLF  IURP WKH UHOHDVH RI WKH PHWKR[\ JURXS D  RI PROHFXODU LRQV
  3DOPLWLF  P]    LQGLFDWLQJ WKH SUHVHQFH RI D PHWK\O HVWHU
  2OHLF  FRPSRXQG7KHSHDNZLWKP] FRPHVIURPWKHUHOHDVHRI
  6WHDULF  WKHSURS\OJURXS E IURPWKHPROHFXODULRQ7KHSHDNDWP] 
0HWK\O FRPHV IURP WKHHVFDSH RI±&+ E\P]  7KHEDVH
  
HLNRVDWHWUDHQRDW SHDNDSSHDUVDWP] FRPLQJIURPWKH&+2LRQWKURXJK
 WKH0F/DIIHUW\UHDUUDQJHPHQWRIWKHIUDJPHQWEZKLFKLVWKH
7KH SHDN FKURPDWRJUDP ZLWK D UHWHQWLRQ WLPH RI  UHVXOW RI EUHDNLQJ  RI WKH IUDJPHQW ZLWK P  ]   )LJXUH 
PLQXWHVJLYHVWKHPDVVVSHFWUXPDVLQ)LJ VKRZVWKDWWKHIUDJPHQWDWLRQDQGFRPSDULVRQZLWKWKHVWDQGDUG

International Scholarly and Scientific Research & Innovation 11(9) 2017 682 scholar.waset.org/1307-6892/10009175
World Academy of Science, Engineering and Technology
International Journal of Chemical and Molecular Engineering
Vol:11, No:9, 2017

FRPSRXQG LW FDQ EH DVVXPHG WKDW WKH FRPSRXQG ZLWK D 1H[W ZLOO EH VKRZQ SHDN FKURPDWRJUDP ZLWK D UHWHQWLRQ
UHWHQWLRQWLPHRILVPHWK\OWULGHFDQRDWH WLPHRIPLQXWHVJLYHVWKHPDVVVSHFWUXPDVLQ)LJ

International Science Index, Chemical and Molecular Engineering Vol:11, No:9, 2017 waset.org/Publication/10009175


)LJ)UDJPHQWDWLRQRIWKHFRPSRXQGZLWKDUHWHQWLRQWLPHRIPLQXWHV



)LJ7KHPDVVVSHFWUXPRIWKHFRPSRXQGZLWKDUHWHQWLRQWLPHRIPLQXWHV



)LJ)UDJPHQWDWLRQRIWKHFRPSRXQGZLWKDUHWHQWLRQWLPHRIPLQXWHV

International Scholarly and Scientific Research & Innovation 11(9) 2017 683 scholar.waset.org/1307-6892/10009175
World Academy of Science, Engineering and Technology
International Journal of Chemical and Molecular Engineering
Vol:11, No:9, 2017

%DVHGRQWKLVFKURPDWRJUDPLQLWFDQEHPDGHIUDJPHQWHG ZKHQ XVHG DV D VXEVWLWXWH IRU VDWXUDWHG IDWW\ DFLGV 08)$ LV
DVLQ)LJ PRUHVWDEOHDQGPRUHHIIHFWLYHIRUORZHULQJEORRGFKROHVWHURO
7KH SHDN FKURPDWRJUDP ZLWK D UHWHQWLRQ WLPH RI  OHYHOVWKDQSOXUDOXQVDWXUDWHGIDWW\DFLGV 38)$ VRLWLVPRUH
PLQXWHVLVPHWK\OSDOPLWROHDWH7KHSUHVHQFHRI& &ERQGLV SRSXODUO\ XVHG IRU SURFHVVLQJ IRRGVWXIIV 08)$ FDQ ORZHU
LQGLFDWHGE\WKHHPHUJHQFHRIWKH&Q+QD&LRQVHULHVDW /'/FKROHVWHURODQGLQFUHDVH+'/FKROHVWHURO>@,QDGGLWLRQ
WKHSHDNRIP] DQGIROORZHGE\ WR 6)$ DQG 08)$ 0 maculata DOVR FRQWDLQV SOXUDO
DVPDOOVSLOORIWKH&Q+QSHDN& &ERQGP]  XQVDWXUDWHG IDWW\ DFLGV 38)$  QDPHO\ DFLG
DQG,QDGGLWLRQWRWKHSUHVHQFHRIRQH&LVDOVRLQGLFDWHG HLFRVDWHWUDHQRDWH DUDFKLGRQLFDFLG 38)$LVIRXQGLQILVKLV
E\WKHDSSHDUDQFHRIWKH&Q+QLRQVHULHVDWWKHSHDNRIP] QRWDUHVXOWRIV\QWKHVLVLQWKHERG\EXWFRPHVIURPWKHIRRG
DQGZLWKP] GHULYHGIURP FKDLQ WKDW LQFOXGHV SK\WRSODQNWRQ ]RRSODQNWRQ DOJDH DQG
&+2LRQVUHVXOWLQJIURPWKHUHOHDVHRIPHWKR[\ x2&+  VKHOOILVK VKHOOILVK  7KH FRQWHQW RI 38)$ LQ SK\WRSODQNWRQ
JURXSVIURPPROHFXODULRQV P]  LQGLFDWLQJWKHSUHVHQFH ]RRSODQNWRQDQGDOJDHUHVSHFWLYHO\IURPWRWR
RID PHWK\OHVWHUFRPSRXQG)UDJPHQWVZLWK P] DUH DQGWRRIWKHGU\ZHLJKW>@,Q7DEOH,,,
GHULYHGIURPWKHUHOHDVHRIWKHSURS\OJURXSIURPWKHPROHFXODU WKHUH LVD FRPSDULVRQ RIWKH FRPSRVLWLRQ RIIDWW\DFLGVLQ0
LRQ)UDJPHQWVZLWKP] DUHGHULYHGIURPWKHUHOHDVHRI maculataZLWKUHVXOWVRISUHYLRXVVWXGLHVWKDWKDYHEHHQGRQH
International Science Index, Chemical and Molecular Engineering Vol:11, No:9, 2017 waset.org/Publication/10009175

&+2UDGLFDOV IURP&+ JURXSRIIUDJPHQWVZLWK P ]  E\(GLULVLQJKHREWDLQHGIURPWKHZDWHUVRI6UL/DQND


:LWKWKHUHOHDVHRIWKHIUDJPHQWVP] \LHOGVP]  
7$%/(,,,
DQGWKHUHOHDVHRIJURXSUDGLFDOV‡&+RIWKHP]  &203$5,6212))$77<$&,'&20326,7,212)0MACULATA:,7+5(68/76
SURGXFHVIUDJPHQWVZLWKP] )UDJPHQWVZLWKP] DUH 2)35(9,286678',(6%<(',5,6,1*+(
UHDUUDQJHG DQG UHOHDVH UDGLFDOV ‡&+ UHVXOWLQJ LQ IUDJPHQWV 1R )DWW\$FLGV IDWW\DFLG
ZLWKP] ZKLFKLVWKHEDVHSHDN  7HWUDGHFDQRLFDFLG D 
7KH UHVXOWV VKRZ WKDW VL[ GLIIHUHQW IDWW\ DFLGV ZHUH IRXQG  0\ULVWLFDFLG  E
7KH\ DUH WKUHH VDWXUDWHG IDWW\ DFLGV 6)$  WZR  3HQWDGHNDQRDWDFLG  E
D
PRQRXQVDWXUDWHGIDWW\DFLGV 08)$ DQGRQHSRO\XQVDWXUDWHG  3DOPLWLFDFLG  E
IDWW\ DFLGV 38)$  LQ 0 maculate 7KH SHUFHQWDJH    +HSWDGHNDQRDWDFLG  E
FRPSRVLWLRQRIDIDWW\DFLGRIM. maculataDUHJLYHQLQ7DEOH  6WHDULF$FLG D E
,, 66)$  
  3DOPLWROHLFDFLG D E
7$%/(,,  2OHLFDFLG D E
7+(3(5&(17$*(  &20326,7,212))$77<$&,'2)M. MACULATA 608)$  
&DUERQ$WRP RI  RNWDGHNDGLHQRDWDFLG  E
)DWW\$FLGV
Q  IDWW\ DFLG
 RNWDGHNDWHWUDHQRDWDFLG  E
7ULGHFDQRLFDFLG & 
6)$ 3DOPLWLFDFLG &   HLNRVDWHWUDHQRDWDFLG D E
6WHDULFDFLG &   HLNRVDSHQWDHQRDWDFLG  E
3DOPLWROHLFDFLG &   GRNRVDWHWUDHQRDWDFLG  E
08)$
2OHLFDFLG & 
 GRNRVDSHQWDHQRDWDFLG  
$VDP
38)$ &   GRNRVDKHNVDHQRDWDFLG  E
HLNRVDWHWUDHQRDW
 638)$  
D
6DWXUDWHGIDWW\DFLGV 6)$ FRQWDLQHGLQWKH0maculataLV 68QZDNRO\
E
(GLULVLQJKHet al  
WULGHFDQRLFDFLGSDOPLWLFDFLGDQGVWHDULFDFLG7KHFRQWHQWRI 
VDWXUDWHGIDWW\DFLGVLVGXHWRWKHVDPHUHODWLYHIDWW\DFLGVDUHD ,Q7DEOH,,,VKRZVWKDWWKHUHDUHVRPHFRPSRQHQWVRIIDWW\
EDVLFFRPSRQHQWRIWKHV\VWHPLVWKHIRUPDWLRQRIIDWLQOLYLQJ DFLGV LQ WKH VDPH M.maculata QDPHO\ SDOPLWLF DFLG VWHDULF
RUJDQLVPV 7KH FRQVXPSWLRQ RI VDWXUDWHG IDWW\ DFLGV PD\ DFLG SDOPLWROHLF DFLG ROHLF DFLG DQG WKH DFLG
LQFUHDVHWKHULVNRIFDQFHUDQGGLVRUGHUVRIWKHLPPXQHV\VWHP HLFRVDWHWUDHQRDWH 0HDQZKLOH P\ULVWLF DFLG SHQWDGHFDQRLF
6RPH UHVHDUFK DOVR VXJJHVWV WKDW WKH GRPLQDQW HIIHFW RI WKH DFLG KHSWDGHFDQRLF DFLG DFLGRFWDGHFDGLHQRDWH DFLG
FRQVXPSWLRQ RI VDWXUDWHG IDWW\ DFLGV HVSHFLDOO\ ORQJFKDLQ RNWDGHFDWHWUDQRDWH HLFRVDSHQWDHQRLF
VDWXUDWHG IDWW\ DFLGV DWRP &!   LV DQ LQFUHDVH LQ OHYHOV RI DFLGDQGGRFRVDKH[DHQRLFDFLGIDWW\DFLGVDUH
WRWDO FKROHVWHURO DQG /'/FKROHVWHURO /RZ'HQVLW\ QRWREWDLQHGIURPWKHVHDRI0DOXNX
/LSRSURWHLQ &RQVXPSWLRQRIVDWXUDWHGIDWVFDXVHVWKHOLYHUWR
SURGXFHODUJHDPRXQWVRI/'/DUHDVVRFLDWHGZLWKKHDUWGLVHDVH B. Amino Acid Analysis
DQG LPSURYH FKROHVWHURO OHYHOV WKXV DOORZLQJ DWKHURVFOHURVLV 7KH DPLQR DFLG DQDO\VLV XVHG +3/& PHWKRG IRU DFLG
>@%HVLGHV6)$0maculataDOVRFRQWDLQVPRQRXQVDWXUDWHG K\GURO\VLV )LJ ZLWK+620DWDR&IRUKRXUVDQG
IDWW\ DFLGV 08)$  LHSDOPLWROHLF DFLG DQG ROHLF DFLG ,Q EDVHV K\GURO\VLV )LJ   XVLQJ %D 2+   0 ZLWK D VDPSOH
JHQHUDO08)$FDQORZHUEORRGFKROHVWHUROOHYHOVHVSHFLDOO\ ZHLJKWRIJUDP

International Scholarly and Scientific Research & Innovation 11(9) 2017 684 scholar.waset.org/1307-6892/10009175
World Academy of Science, Engineering and Technology
International Journal of Chemical and Molecular Engineering
Vol:11, No:9, 2017
International Science Index, Chemical and Molecular Engineering Vol:11, No:9, 2017 waset.org/Publication/10009175


)LJ&KURPDWRJUDPDQDO\]HVWKHDPLQRDFLGFRPSRVLWLRQVRIDFLGK\GURO\VLV



)LJ&KURPDWRJUDPDQDO\]HVWKHDPLQRDFLGFRPSRVLWLRQVRIEDVHVK\GURO\VLV

7KHSHUFHQWDJHFRPSRVLWLRQVRIHVVHQWLDODQGQRQHVVHQWLDO 7KH UHVXOWV RI DPLQR DFLG FRPSRQHQWV DQDO\VLV LQ WDEOH 
DPLQRDFLGVDUHSUHVHQWHGLQ7DEOH,97KHWRWDODPLQRDFLGV VKRZVWKDWWKHUHLVDGLIIHUHQFHEHWZHHQDPLQRDFLGVSURGXFHG
REWDLQHG E\ DFLG K\GURO\VLV ZDV  DQG  E\ EDVH E\WKHDFLGK\GURO\VLVDQGEDVHK\GURO\VLV2IWZHOYHW\SHVRI
K\GURO\VLVDPRQJZKLFKHVVHQWLDODPLQRDFLGVZHUHIRXQGWR DPLQR DFLGV FRQWDLQHG LQ 0 maculata JOXWDPLF DFLG DQG
EH DV  DQG QRQHVVHQWLDO DPLQR DFLGV ZHUH  IURP DUJLQLQH DUH DQ DPLQR DFLG IRXQG RQO\ LQ DFLG K\GURO\VLV
DFLG K\GURO\VLV ZKLOH WKH EDVH K\GURO\VLV REWDLQHG  RI ZKHUHDV KLVWLGLQH OHXFLQH DQG PHWKLRQLQH DUH IRXQG RQO\ LQ
WKHHVVHQWLDODPLQRDFLGVDQGQRQHVVHQWLDODPLQRDFLGV EDVH K\GURO\VLV *OXWDPLF DFLG RQ DFLG K\GURO\VLV FDQ EH
 SURGXFHGJOXWDPLQHDVLQWKHIROORZLQJUHDFWLRQ
7$%/(,9 
7+(3(5&(17$*(  2)$0,12$&,')281',10MACULATA
RIDPLQRDFLG
$PLQR$FLG
$FLG+\GURO\VLV %DVH+\GURO\VLV
*OXWDPLFDFLG  
+LVWLGLQH    
*O\FLQH   *OXWDPLFDFLG 
$UJLQLQH   *OXWDPLQ
$ODQLQH   
7\URVLQH  
)LJ5HDFWLRQRISURGXFHGJOXWDPLQHIURPJOXWDPLFDFLG
0HWKLRQLQH   
9DOLQH    
3KHQLODODQLQH    $FLG K\GURO\VLV UHVXOWHG LQ VRPH FRPSRQHQWV DPLQR DFLG
,VROHXFLQH    VXFKDVWKHWU\SWRSKDQJOXWDPLQHDQGRWKHUDPLQRDFLGVZLOOEH
/HXFLQH   
/\VLQH    GDPDJHG DQG QHHGHG IXUWKHU K\GURO\VLV WR UHVWRUH DOO RI WKH
HVVHQWLDODPLQRDFLG DPLQR DFLGV ,Q DGGLWLRQ DFLG K\GURO\VLV DOVR OHDG WR WKH

International Scholarly and Scientific Research & Innovation 11(9) 2017 685 scholar.waset.org/1307-6892/10009175
World Academy of Science, Engineering and Technology
International Journal of Chemical and Molecular Engineering
Vol:11, No:9, 2017

IRUPDWLRQ RI KXPLQ FRPSOH[ ZKLFK FDQ VHSDUDWH WKH DPLQR


DFLGVRIWKHK\GURO\]HG7KHUHIRUHEDVHK\GURO\VLVLVUHTXLUHG
WR LGHQWLI\ WKH DPLQR DFLGV WKDW ZHUH GDPDJHG E\ DFLG
K\GURO\VLV DQG WKDW FDQ EH LGHQWLILHG E\ EDVH K\GURO\VLV  ,Q
JHQHUDO WKH 0 maculate KDYH D EDODQFHG GLVWULEXWLRQ RI DOO
HVVHQWLDO DPLQR DFLGV UHTXLUHG IRU DQ DGXOW SHU GD\ ,Q WKH
SUHVHQWVWXG\WKHHVVHQWLDODPLQRDFLGVLQ0maculataYDOLQH
 ZDVPD[LPXPDQGWKHPLQLPXPKLVWLGLQH  
DQGQRQHVVHQWLDODPLQRDFLGJO\FLQH  ZDVPD[LPXP
DQGPLQLPXPDVJOXWDPLFDFLG  ,QJHQHUDOIURPWKH
DERYHREVHUYDWLRQLWLVFOHDUWKDWWKHWLVVXHRIWKH0maculata
ZLWKULFKQXWULWLYHYDOXHFDQEHXVHGIRUDOWHUQDWHVRXUFHDVD
UHJXODU VHD IRRG ZKLFK VXSSOLHV QXWULHQWV IRU WKH JURZLQJ
FKLOGUHQ SUHJQDQW ZRPHQ DQG SHRSOH VXIIHULQJ IURP
PDOQXWULWLRQ
International Science Index, Chemical and Molecular Engineering Vol:11, No:9, 2017 waset.org/Publication/10009175

,9&21&/86,21
%DVHGRQUHVHDUFKUHVXOWVREWDLQHGLWFDQEHFRQFOXGHGWKDW
IDWW\ DFLGV FRPSRVLWLRQ LQ M. maculata FRQWDLQHG WULGHFDQRLF
DFLGSDOPLWROHLFDFLGSDOPLWLFDFLGROHLFDFLGVWHDULFDFLGDQG
HLFRVDWHWUDHQRLF DFLG DQG  DPLQR DFLGV
FRPSRVLWLRQ WKDW FRQVLVWV RI  HVVHQWLDO DPLQR DFLGV ZHUH
OHXFLQH LVROHXFLQH YDOLQH SKHQ\ODODQLQH PHWKLRQLQH
O\VLQHDQGKLVWLGLQHDQGDOVRQRQHVVHQWLDODPLQRDFLGZHUH
W\URVLQHJO\FLQHDODQLQHJOXWDPLFDFLGDQGDUJLQLQH

5()(5(1&(6
>@ 1DJDEKXVKDQDP 5 0DQH 9+ 6HDVRQDO YDULDWLRQ LQ WKH ELRFKHPLFDO
FRPSRVLWLRQ RI 3HUQDYLULGLVDW 5DWQDJLUL RQ WKH :HVW &RDVW RI
,QGLDHydrobiologia  
>@ )UHQRX[-03URVW('3URVW-/$SRO\XQVDWXUDWHGIDWW\DFLGGLHWORZHUV
EORRG SUHVVXUH DQG LPSURYHV DQWLR[LGDQW VWDWXV LQ VSRQWDQHRXVO\
K\SHUWHQVLYHUDWVJ Nutr
>@ &XQQDQH6&3ORXUGH03LIIHUL)%HJLQ0)HDUW&%DUEHUJHU*DWHDX
3 )LVK GRFRVDKH[DHQRLF DFLG DQG $O]KHLPHU¶V GLVHDVH Prog Lipid
Res
>@ %DNHU'++DQ<,GHDODPLQRDFLGSURILOHIRUFKLFNVGXULQJILUVWWKUHH
ZHHNVSRVWKDWFKLQJ3RXOW Sci
>@ %OLJK (* '\HU :- $ UDSLG PHWKRG RI WRWDO OLSLG H[WUDFWLRQ DQG
SXULILFDWLRQCan J Biochem3K\VLRO
>@ $VVRFLDWLRQ RI 2IILFLDO $JULFXOWXUDO &KHPLVWV 2IILFLDO PHWKRGV RI
DQDO\VLVRIWKHDVVRFLDWLRQRIRIILFLDODJULFXOWXUDOFKHPLVWVWKHG
:DVKLQJWRQ'&86$$2$&
>@ 0XOOHU+/LQGPDQ$6%UDQWVDHWHU$/ 3HGHUVHQ-,7KH6HUXP
/'/+'/ &KROHVWHURO 5DWLR LQ ,QIOXHQFHG 0RUH )DYRUDEO\ E\
([FKDQJLQJ6DWXUDWHGZLWK8QVDWXUDWHG)DW7KDQE\5HGXFLQJ6DWXUDWHG
)DWLQ7KH'LHWRI:RPHQThe Journal of Nutrition
>@ GF 5RRV 10 %RWV 0/  .DWDQ 0% 5HSODFHPHQW RI 'LHWDU\
6DWXUDWHG )DWW\ $FLGV E\ 7UDQV )DWW\ $FLGV /RZHUV 6HUXP +'/
&KROHVWHURO DQG ,PSDLUV (GLWKHOLDO )XQFWLRQ LQ +HDOWK\ 0HQ DQG
:RPHQJournal of Arterioscler Throm Vasc. Biol  
>@ /DW\VKHY 1$ .DV\DQRY 63 .KDUODPHQNR 9, 6YHWDVKHY 9,
/LSLGV DQG )DWW\ $FLGV RI (GLEOH &UDEV RI 7KH 1RUWK:HVWHUQ 3DFLILF
Journal of Food Chemistry±

International Scholarly and Scientific Research & Innovation 11(9) 2017 686 scholar.waset.org/1307-6892/10009175