Vous êtes sur la page 1sur 84

FAR CRY PRIMAL CCHASSE, PÊCHE,

HASSE, MASTER OF ORION LE RETOUR STARDEW VALLEY QUAND ON


ON DE MAMIE SUPERNOVA EN CHANT IER N’A QUE LABOUR EN TEST
NATURE ET TRADUCTIO EN TEST

- V A C A N C E S À S E R F - C H E V A L I E R
- 1 5 M A R S 2 0 1 6
N ° 3 3 5

L E M A G A Z I N E Q U I A D O U B E L E J EU VID
ÉO
ZELDA
A 30 ANS
ET ON S’EN BRANLE

K I N G D O M
À VENIR

CO ME A N C E
DELIVER
LE G U E U X Q U I V E U T
D É T R Ô NE R S K Y R I M
EP
M 02943 - 335 - F: 4,90 E
BEL/LUX : 5,40 €
CH : 7,80 CHF

’:HIKMTE=XUY^UZ:?k@d@n@f@a"
RCS Bobigny B 422 797 720 – 44-50 Avenue du Capitaine Glarner – Saint-Ouen Cedex. Photos non contractuelles, voir conditions sur site.
LE MAGAZINE QUI ADOUBE LE JEU VIDÉO
Numéro 335 | 15 mars 2016

Édito Plume pudding


38 Au coin du jeu : Fleur, Antonin
et les jeux vidéo
40 Cabinet de curiosités
C ommençons par rappeler les faits.
Début mars, Tim Sweeney, le fondateur
d’Epic Games, a rué dans les brancards façon
41 Que sont-ils pas devenus ?
42 Autopsie Half-Life 2
grand-oncle bourré à la fin du repas de Noël. 44 News Online
Dans une tribune publiée par The Gardian,
il a accusé Microsoft de vouloir prendre en
otage le jeu vidéo sur PC et de transformer
ce qui était jusqu’ici une plateforme ouverte
en écosystème semi-fermé façon Google de décourager
Play. En cause, le nouveau standard UWP leur installation,
(Universal Windows Platform) poussé par par exemple avec
Microsoft, qui permet de développer des un pop-up « êtes-vous sûr de vouloir prendre
applications cross-platform PC/Xbox One/ le risque d’installer un logiciel non certifié
Windows Phone distribuées via le Windows Windows Store » ? C’est déjà plus probable.
Store. La crainte de Sweeney est que Microsoft cherche par tous les moyens à
Microsoft se livre à une concurrence déloyale peupler son Store sur lequel, à l’exception
envers les autres plateformes de distribution, d’Office et autres programmes maison, on
comme Steam, en interdisant l’exécution de
programmes non-UWP ou en décourageant
ne trouve toujours aucun logiciel majeur.
Or, devant le succès… comment dire…
54
fortement leur installation, à la manière de modéré de la Xbox One et des Windows
ce que fait Android avec les applications non Phone, Microsoft a tout intérêt à pousser les À venir
issues du Store. Bon. Tentons d’examiner innombrables développeurs Windows à créer 46 Kingdom Come
la situation en gardant la tête froide. Est-il des logiciels cross-platform qui valoriseront 50 TrackMania Turbo
possible qu’un jour Microsoft verrouille tout l’écosystème Microsoft. On a tendance 52 Deathwing
complètement l’exécution de programmes à l’oublier mais Windows, seule plateforme 53 The Technomancer
non issus de son Store, façon Apple ? Aucune commerciale entièrement décentralisée, est 53 Seasons After Fall
chance, ce serait suicidaire : la grande force aujourd’hui une exception. Dans un monde 54 Call of Cthulhu
de Windows, face à Linux notamment, est où la concurrence entre Google, Apple et 56 Styx : Shards of Darkness
le nombre incroyable de jeux et de logiciels Microsoft est de plus en plus tendue, ça 57 Space Run Galaxy
disponibles. Est-il possible qu’il se contente risque de ne pas durer éternellement. 58 The Surge
59 Remnants of Naezith

Sommaire En chantierr
60 Factorio
62 Master of Orion
64 The Ship :
04 News Remasted
66 Overfall

Tests
sts
12 Far Cry Techno
Primal
16 Stardew
rdew
20 68 News Hardware
72 Le Tour du Périph’ 62
Valley 74 Configs de Canard
18 Shardlight
rdlight 27 Deponia : Doomsday 75 SteamOS
19 Plants
nts vs. 28 Heaven’s Hope
es : Garden
Zombies : 30 Pokkén Tournament
Warfaree 2 12 32 Au doigt et à l’œil À part ça
20 Grim Dawn 78 Je vis des hauts et des bas :
24 Devil Daggers Napoleonic Wars
25 The Walking Dead : Michonne Dossiers 80 Panier garni : Cusader Kings 2
+ Life in Bunker 34 Locomalito : un ami qui vous veut du bien 82 Canard Peinard Grillez-en une
26 The Deadly Tower of Monsters 76 Clash Royale : le coffre et la demande
Canard PC | 03
NEWS D E L A M Ê M E FA Ç O N Q U E L E S M A R T P H O N E P R É V I E N T A U T O M A T I Q U E M E N T Q U A N D O N M O N T E T R O P L E V O L U M E D U C A S Q U E , U N " WA R N I N G " V O U S I N D I Q U E R A , Q

comme une odeur Gode Quantum

de faisandé Vous vous souvenez de


Quantum Break ? Si oui,
c’est assez impressionnant
de vrais acteurs comme
Dominic Monaghan ou
Lance Reddick. Ces scènes

dans l’air vu comme le jeu de


Remedy a l’air générique
mais ça arrange nos
étant susceptibles de
changer selon les actions
du joueur, Remedy a

O
n a bien réfléchi entre botter en touche… Maintenant, affaires. Alors qu’il faisait choisi de les streamer,
nous, et on pense que ça c’est trop tard, on va y avoir la joie de la partie console histoire de battre Ubisoft
a dû se passer à peu près droit, et ça sortira le 31 mai. du magazine depuis qu’il et Electronic Arts au

News
comme ça : interrogé sur avait été également concours du DRM le plus
l’avenir de Dead Island 2 par un annoncé sur débile. Il faudra donc être
type un peu trop curieux (sans Windows 10, le titre connecté à Internet pour…
doute pas un journaliste de jeu gardait jalousement regarder des cinématiques.
vidéo, donc), un responsable de une petite surprise Plus rigolo encore : il
Deep Silver s’est retrouvé gêné avant sa sortie. Voyez- devrait être possible de
aux entournures, incapable vous, les séquences télécharger l’intégralité
de donner ne serait-ce qu’un de jeu seront des vidéos sur la version
début de nom de studio qui entrecoupées de Xbox One du jeu, mais pas
travaillerait dessus depuis cinématiques sur la version Windows 10.
que Yager a été conduit filmées avec On n’arrête pas le progrès.
vers la sortie par le service
de sécurité l’été dernier.
Le type a dû paniquer
et bredouiller un
Bonjour et bienvenue
truc, genre oh dans le plus petit
là là, ça bouge télex du monde, qui
méchamment du
côté de la licence
contient une toute
Dead Island. petite information. Il
Et improviser y aura des tournesols
une drôle d’idée :
une « Definitive
dans Farming
Edition », réédition Simulator 2017 et, nous
HD du jeu de 2011 et sommes en mesure de vous
son extension Riptide,
pour PC, PS4 et Xbox
LECONŽRMER ILSTOURNERONT
One. Ah, s’il s’était contenté la tête pour suivre le soleil.
de parler de la météo pour
Joyeux anniversaire !
ondé en 1996 par Peter Molyneux,
Tout le monde la croyait F Lionhead avait été racheté par
Microsoft en avril 2006, pour ses
morte dès sa naissance, les dix ans. Et pour ses vingt ans, l’éditeur,
magasins la soldaient toute jamais avare de beaux cadeaux, lui offre une
fermeture. Dans le cadre d’un très impersonnel
l’année à -80 % (dans l’espoir « remaniement des studios européens », Microsoft
d’en vendre un exemplaire, allez, a décidé de mettre à la porte les employés du
studio danois Press Play (réalisateur du chouette
juste un, un seul, s’il vous plaît, Kalimba) et d’« entamer une discussion avec les
pour alléger le stock, tenez si employés de Lionhead en vue d’une fermeture ».
vous en achetez un je vous offre Le TPS multijoueur free-to-play Fable Legends,
sur lequel bossait Lionhead, est annulé au
un second, ça me fait plaisir), eh passage, à la surprise totale de ses développeurs
bien ça y est, la PlayStation TV qui avaient sorti une grosse mise à jour pour
la bêta fermée deux jours plus tôt. Connu
ESTOFŽCIELLEMENTMORTE#EFUT surtout pour Fable et Black & White, Lionhead
bref mais pas du tout intense. n’avait rien produit de bon depuis des années.

04 | Canard PC
U A N D V O U S P R E N D R E Z P L U S D E 1 8 S E L F I E S PA R J O U R , Q U E V O U S S O U F F R E Z D ' U N G R AV E D É F I C I T D E L A P E R S O N N A L I T É E T R I S Q U E Z L A C R I S E D E N A R C I S S I M NEWS

La boîte en kit
Battue à plates coutures (une expression qui
ne veut plus rien dire mais qui est tout de
même restée dans le langage courant, est-ce
donc à ça que servent les réformes de la
langue française ? Répondez maintenant !)
par la PlayStation 4, la Xbox One pourrait
malgré tout rester parmi nous bien plus
longtemps que prévu. Pourquoi ? Parce que,
selon Phil Spencer, le boss de la division Xbox, algré les ventes décevantes 1,5 million de dollars pour un portage de
la maison Microsoft réfléchit à des mises à
jour matérielles pour la console. Le but serait M de Rock Band 4 (qui ont
carrément entraîné une
Rock Band 4 (et du Rock Band Network)
sur PC. Le montant minimum pour
d’upgrader la console comme n’importe vague de licenciements chez obtenir le jeu est de 49 dollars, contre
quel PC (ce qu’elle est déjà) plutôt que de Mad Catz, on vous en parlait dans le dix dollars de plus en accès anticipé à la
sortir de vraies nouvelles machines. En plus, numéro précédent), les développeurs sortie et sûrement deux fois moins lors
Microsoft a de l’expérience dans le domaine : de Harmonix ne se laissent pas des soldes Steam qui suivront. Et si vous
ils avaient déjà tenté le coup sur Xbox 360, démonter. Ils ont donc débarqué sur faites l’erreur de backer le projet, vous
avec un lecteur HD-DVD optionnel externe. Fig, la plateforme mi-crowdfunding, pourrez toujours vous consoler avec une
Bon, un détail : personne ne l’avait acheté. mi-investissement qui a déjà vu passer clé pour A City Sleeps, un shoot-them-up
la campagne pour le financement signé Harmonix qui nous est tombé des
de Psychonauts 2, afin d’y demander mains après 10 minutes de jeu. Miam.

Et tu tapes, tapes,
tapes… Tape… Allez,
ordure, TAPE !
Alléluia ! Notre magazine a peut-
être trouvé la solution parfaite
pour régler les problèmes de
productivité de ses rédacteurs.
Ça s’appelle The Most Dangerous
Writing App et c’est en quelque
sorte le Rogue-like des traitements
de texte : choisissez une durée de
temps de travail et assignez-y un
rédacteur qui a tendance à trop
traîner sur Twitter ou sur des sites
de phrénologie pour qu’il rende
À en croire l’offre d’emploi qui son papier prévu pour avant-hier.
vient d’apparaître sur le site S’il s’arrête de taper pendant
cinq secondes, tout le travail
de Blizzard, le studio serait à la accompli s’efface définitivement.
recherche d’un artiste spécialisé Une merveille open source
(cpc.cx/eQR), que vous pourrez
DANSLaŅCLAIRAGE AŽNDETRAVAILLER personnaliser en mettant un peu
sur un « projet non annoncé » les mains dans le cambouis. Par
exemple si vous êtes du genre
qui concerne Diablo. Add-on, progressiste qui préfère pousser le
délai à dix secondes pour permettre
nouveau jeu, sextoy démoniaque à vos forces vives de se curer le
rétro-éclairé... tout est possible. nez entre deux paragraphes.

Canard PC | 05
NEWS ERAIT DIRE AUX GAMERS FACÉTIEUX QUE LES MICRO-TRANSACTIONS NE SERAIENT QUE L'ÉQUIVALENT, POUR LE JOUEUR PONCTIONNÉ DANS L'OS, D'UN "WAY-TO-PINEE

Luckey Luke
On savait déjà que Palmer Luckey, le
fondateur d’Oculus VR, avait un nom de
desperado. On sait maintenant qu’il a la
répartie de Billy the Kid. Interrogé par
des journalistes à propos d’une éventuelle
compatibilité Mac OS de son casque à
vomi, Palmer « four fingers » Luckey a
répondu : « La balle est dans le camp d’Apple.
Le jour où ils sortiront un bon ordinateur,
notre casque le supportera. » Puis il est
parti dans une critique acerbe des GPU
mous du genou utilisés par les Mac. Enfin,
après avoir expliqué que même un Mac
Pro à 6 000 dollars n’atteignait pas les
performances graphiques recommandées
par Oculus, il a enfourché son destrier noir
et est parti au galop dans le soleil couchant.

A
lors là, voyez-vous, du complot. En effet, les joueurs
on est bien embêtés. se sont mis à imaginer que
On tenait une news Zagrebelny aurait inséré des
géniale, pleine de sang « bombes à retardement » dans le
et de fureur, où un développeur code de son jeu, pour le saboter
aurait volontairement saboté à distance et emmerder Oovee
son jeu pour faire la nique à à cause d’une histoire de gros
son éditeur. Il y a quelques sous. Très vite, les deux parties
jours, de nombreuses versions ont démenti toute tentative de
de Spintires accusaient bugs sabotage en expliquant qu’il
ETCRASHSĩRŅPŅTITION)LASUFŽ s’agissait tout simplement d’un
d’une poignée de joueurs un peu bug classique qui avait pourri
paranos et au courant des griefs certaines versions du jeu à cause
opposant Pavel Zagrebelny (le d’un dispositif antipiratage mal
développeur) et Oovee (l’éditeur) réglé. Une tempête dans un
pour se vautrer dans la théorie verre de gadoue, en somme.

Je peux pas, j’ai piscine


uand on parle d’E3, il y a deux

Q catégories d’éditeurs : les


enthousiastes précoces, qui tiennent
absolument à vous faire savoir dès
maintenant que leur conférence aura lieu le
13 juin 2016 à 4 heures du matin tapantes
(merci Bethesda, c’est noté), et les ronchons,
qui en ont marre du bruit et des gens et
préfèrent rester au chaud sous la couette.
Seront donc absents de l’E3 cette année des
petites boîtes comme Electronic Arts (qui
organisera en parallèle son propre événement
en face du salon, une tactique adoptée il y a
quelques années par la Ouya, avec le succès
que l’on sait), Disney, Wargaming ou encore
Activision Blizzard. Miracle de la paresse :
l’entreprise de Bobby Kotick est même
parvenue à convaincre Sony de montrer Call
of Duty XIII sur son stand PlayStation.

06 | Canard PC
AHN LUSTH A REFILÉ QUELQUES TÊTES DE CHEVAL DE SON STOCK AUX MEMBRES DU FBI POUR QU'ILS LES DÉPOSENT DANS LE LIT DU PRÉSIDENT D'APPL NEWS

Pour cinqq dollars,


t’as plus rien
Connaissez-vous Fiverr ? C’est un
site où des utilisateurs échangent de
menus services contre une poignée
de dollars : créer un logo pour un
site, corriger un texte ou bien…
écrire une critique Steam. Le site
PCGamesN.com a mené l’enquête
sur ce marché de la review à cinq
dollars. À quelques exceptions
près, les « critiques » contactés
ont répondu que leurs avis étaient
Rain Games, le studio totalement indépendants et qu’ils
norvégien à l’origine du très ne pouvaient garantir qu’ils seraient
positifs – précisant toutefois qu’il
sympathique Teslagrad, vient faudrait vraiment que le jeu soit
d’annoncer World to the West, catastrophique pour échapper au
un adorable jeu d’action qui gros pouce vert. Bien sûr, lorsque
PCGamesN a examiné l’historique
se déroule dans le même des comptes Steam en question,
univers et où il faudra alterner il n’a trouvé que des critiques
entre quatre personnages dithyrambiques de jeux nullissimes
ou inconnus. Pendant ce temps,
pour résoudre des énigmes. dans sa tour d’ivoire, le seigneur
Dieu que c’est mignon. Gaben contemple son royaume
corrompu en se lavant les mains.
NEWS QQUE DOC TB, NOTRE SPÉCIALISTE DU HARDWARE, AVAIT ENCORE DONNÉ UNE EXCUSE À LA CON POUR NE PAS VENIR : "JE PEUX PAS, J’AI WATERCOOLING", A-T-IL DI

L’adorable Jotun, sorti il Un pour tous,


y a quelque temps sur nos tous pour un
machines de bourgeois,
C’est par un communiqué
débarquera cet été sur de presse anodin de la
Xbox One, PlayStation 4 CNIL que l’information
parvient sur mon
et Wii U, comme ça, tout le bureau : à cause d’une
monde est content (sauf erreur de la part de son
fournisseur d’accès à
les possesseurs de Ouya, Internet (Numéricable),
comme d’habitude). un usager des autoroutes
de l’information a été
identifié 1 531 fois pour des
délits de contrefaçon par
L’importance la Hadopi et inculpé sept
des maux fois. Le malheureux a été
perquisitionné à répétition,
d’autant qu’il a aussi été
nommé à tort dans une
D’après ceux qui ont arpenté affaire de pédophilie. En
la bêta de The Division,
la présence d’un onglet
d cause : le système mis en
place par Numéricable,
« boutique » dans l’interface ous vous souvenez F-35 dans l'escadrille. Encore qui automatisait les
serait annonciatrice de
micro-transactions et de V du F-35, le super
avion de chasse dont
mieux, le radar se met parfois
à déconner sans raison et ne
demandes d’identification
des adresses IP en
pay-to-win. Petit problème, le développement a retrouve un fonctionnement provenance de la Hadopi
un community manager déjà coûté 1 300 milliards au normal qu'une fois éteint et et de la police… et qui
du titre a expliqué que contribuable américain ? On rallumé, comme une vulgaire en cas d’erreur renvoyait
celui-ci « ne contiendra pas savait déjà qu'il accumulait tablette Android chinoise. toujours le même abonné
de micro-transactions », les problèmes techniques, L'entrée en service du bestiau est au lieu de signaler un
conformément à une on apprend aujourd'hui que toujours prévue pour 2018 et on problème. Magie de la
interview où un développeur son informatique déconne attend avec impatience la sortie Hadopi : malgré tous ces
noyait le poisson : « Je ne à bloc. Prenez le système de des premiers simulateurs sur PC. signalements, le valeureux
sais pas s’il y a une définition partage des données, utilisé Même s'ils sont complètement abonné (resté fidèle à
globalement acceptée du mot lorsque plusieurs avions volent bugués, les développeurs son FAI malgré tout)
micro-transactions, mais vous ensemble : chaque cible est pourront toujours dire que c'est n’avait visiblement pas
ne paierez pas pour gagner, affichée sur l'écran de contrôle une reproduction fidèle perdu son abonnement
avancer ou n’importe quoi autant de fois qu'il y a de du comportement de l'appareil. Internet pour autant.
d’autre dans ce genre. Nous
avons des plans pour des
DLC et, visiblement, vous
paierez pour ça. Mais en
dehors de ça, il n’y aura pas
Frisbee or not to be
de micro-transactions, telles À l’époque où je bossais avec des enfants, parfois on
que je les définis. » D’ailleurs, faisait une partie d’ultimate : un jeu qui opposait deux
permettez-moi de préciser équipes de sept se faisant des passes au frisbee. Quelle
que ceci n’est pas une news, ne fut donc pas ma surprise quand, à l’occasion d’une
telle que je laa définis. interview du directeur financier d’EA, Blake Jorgensen,
j’ai appris que l’équipe d’ultimate d’EA gagnait dans
les 650 millions de dollars par an. Et puis à force de
recherche, j’ai découvert qu’il s’agissait en réalité de
l’ultimate team, autrement dit le mode de jeu, ambiance
cartes à collectionner et surtout micro-transactions
à gogo, intégré à Fifa, Madden NFL, NHL et bientôt,
UFC 2. Qui fait donc office de poule aux œufs d’or pour
EA, puisqu’il représente à lui seul la moitié des revenus
du « contenu supplémentaire » (1,3 milliard de dollars
par an pour des season pass de Star Wars Battlefront ou
des maps de Battlefield). En même temps je comprends,
une fois qu’on a dépensé 60 euros dans un jeu, on a
envie de continuer à aider les développeurs après.

08 | Canard PC
U 8 M A R S , P O U R L A J O U R N É E D E L A F E M M E , L E S H O M M E S A U R O N T L E D R O I T D E L E U R L Â C H E R L A P O R T E S U R L A T R O N C H E P L U T Ô T Q U E L A L E U R T E NI NEWS

Le conseil
d’administra-
tion de
Gameloft
(composé
essentielle-
ment de
membres
de la famille
Guillemot,
bref les
proprios) ayant
rejeté l’offre
de rachat
de Vivendi,
Vincent
Bolloré en
Citoyen de l’espace a réhaussé
le montant.
Incroyable mais vrai : No Man’s Sky n’est pin’s (woohoo), une boîte (trop fort) et une statuette de Et (tant qu’à
officiellement plus un vaporware, il a une date de vaisseau spatial. Pas mal, pas mal, mais ça reste un peu
sortie, une description officielle, un prix, des bonus timide pour un jeu d’exploration spatiale, surtout face
asticoter les
de précommande (n’oubliez pas : ne précommandez à la concurrence. Pourquoi ne pas proposer à l’achat Guillemot,
jamais)… Le jeu d’exploration spatiale de Hello (et en quantité limitée tant qu’à faire) des vaisseaux autant y aller
Games sortira donc le 21 juin sur Steam et PS4 pour in-game ? Ou tenez, une assurance-vie pour votre à fond) en a
la modique somme de 60 euros. Ou 150 dollars (frais personnage et votre vaisseau ? No Man’s Sky est vendu
de port non inclus) pour l’édition collector, avec un comme un jeu de survie, après tout, ça peut être utile.
PROŽTŅPOUR
prendre
quelques
(4#NaESTPASJOUER La prochaine fois actions de plus
que vos parents ou votre dans Ubisoft,
conjoint vous reprocheront tranquillou.
de passer trop de temps sur des
es
La réalité dépasse souvent la forums internet débiles au lieu
u
fiction, et c’est ainsi que les de faire quelque chose de votre vie,
précommandes du casque vous pourrez leur raconter l'histoire
oire
de réalité virtuelle de HTC, DE#HRISTOPHER0OOLE#EGARĹON 
ON  Obduction, le
le Vive, nous ont permis de surtout connu pour avoir créé le board
découvrir un prix supérieur à 4chan, autoproclamé « trou du cul nouveau jeu
toutes nos anticipations les plus du web », vient d'être embauchéhé des créateurs
délirantes. À 799 dollars (contre PAR'OOGLE#OMMEQUOITOUS S de Myst dont
599 pour l’Oculus Rift), très les chemins mènent à Rome,,
justement convertis en 899 euros même ceux pavés d'images on évoquait
(c’est parfaitement logique puisque scatopornographiques. l’avenir
1 euro vaut 1,10 dollar à l’heure où incertain dans
nous écrivons ces lignes), auxquels
s’ajoutent plus de 70 euros de frais de le Canard PC
port, il en coûtera donc 972 euros à n° 328, semble
un résident bourguignon (ou franc-
comtois ou breton) pour s’équiper
Seppuku d’erreurs pour un seul reportage finalement
en réalité virtuelle compatible Le Japon, terre de traditions où l’on peut vous trancher la main pour avoir sur de bons
Valve. Auxquels il faudra ajouter un donné votre carte de visite dans le mauvais sens, se remet difficilement rails. Le studio
grand salon, si possible sans trop de de l’erreur grossière qui vient d’être faite. En effet, à l’occasion d’un a en effet
meubles sur lesquels se cogner. Cela reportage dans une salle d’arcade, des journalistes ont interviewé un
n’a pas empêché 15 000 personnes quidam, en le présentant comme « un homme d’environ 50 ans » et sans récemment
de se ruer sur le site pendant les dix s’apercevoir que celui-ci n’était autre que Shuhei Yoshida. Soit l’un annoncé une
premières minutes. Ici, on continue des fondateurs de Sony Computer Entertainment qui venait pour sortie au
de mesurer notre enthousiasme promouvoir son dernier gadget de réalité virtuelle. Coup de bol, le grand
en picogrammes. (Pour encore patron préfère l’humour au sang et vient de retoucher sa bio Twitter, mois de juin
plus de mauvaise foi, cf. p. 68). pour y faire apparaître « Shuhei Yoshida : un homme d’environ 50 ans ». prochain.
Canard PC | 09
NEWS ET TRÈS DÉCU PAR SA PROPRE PERSONNE, ALAIN DELON AURAIT EXPLIQUÉ QU'IL AVAIT DÉFINITIVEMENT CESSÉ TOUTE RELATION AVEC LUI-MÊME

ERRATUM :
Dans le test de Superhot
du dernier numéro
de Canard PC, nous
indiquions que le jeu
était vendu 15 euros et «
qu’à ce prix, c’est un peu
de l’arnaque. » Il s’agit
d’une erreur de notre
part, le test ayant été
rédigé avant la sortie du Il y a plusieurs
jeu et l’annonce de son numéros de cela,
prix de vente définitif.
En réalité, Superhot est nous évoquions
vendu 23 euros et à ce la tentative
prix, c’est vraiment de d’Electronic Arts
la grosse arnaque.
de déposer le
nom « Ghost » et
Lemmings Robolution de la contestation
d’Ubisoft qui
être humain n’est-il en réalité qu’une
mettait en avant
L’ évolution du lemming ? C’est en tout
cas la conclusion que l’on peut tirer sa licence Ghost
d’une récente expérience menée par Recon. Eh bien,
l’institut de recherche Georgia Tech
(GTRI). Dans le cadre d’un vaste programme
c’est de l’histoire
voué à étudier les rapports de confiance ancienne, tout
qu’entretiennent les humains vis-à-vis des a été résolu
robots, des chercheurs du GTRI ont demandé à
un groupe composé principalement d’étudiants
« à l’amiable »
de suivre un spécimen manifestement pas et rien n’aura
très malin, avant de simuler un incendie et été déposé.
de voir les étudiants continuer à suivre ledit
robot, malgré ses instructions sans grand
À part peut-être
rapport avec le bon sens et la proximité des menaces
d’une sortie de secours. Il semblerait que les de mort, mais
robots aient désormais été investis d’une telle
autorité que le jour de leur grande révolte, ils
on n’est pas
n’auront même pas besoin de pistolet laser. au courant.

La bourse ou la vie
toppez les rotatives ! La nouvelle tombe à quelques heures du

S bouclage : « Paradox Interactive är en av Sveriges snabbast växande


spelutvecklare. Vd Fredrik Wester, som äger drygt 39 procent… »
Ah pardon, vous ne lisez pas le suédois ? Même pas un peu de patois
stockholmois ? OK, alors je vous résume cette phrase tirée du magazine
Di Digital : le boss de Paradox Interactive, le sémillant Fredrik Wester,
annonce que sa boîte va entrer en bourse, du moins pour une partie (non
majoritaire) du capital. Ce genre d’opération permet à la société d’engranger
un paquet de cash, mais elle est souvent périlleuse – demandez donc aux
frères Guillemot, qui sont en train de se faire croquer Ubisoft par Bolloré,
ce qu’ils en pensent… Paradox devrait utiliser l’argent pour accélérer son
développement et s’aventurer sur deux nouveaux terrains : la console et
le mobile. Que les choses soient claires : si les prochains Crusader Kings
et Hearts of Iron nous arrivent en version « casual gamer » sur iPhone
et Nintendo DS, je m’immole par le feu devant l’ambassade de Suède.

10 | Canard PC
T
Test

12 | Canard PC
TEST PC

Far Cry Primal


Cro-magnon des sources
Si je devais résumer Ubisoft en une phrase, ce ne serait pas « le plus grand éditeur français » ou
bien « la boîte qui a été liquidée par Bolloré en 2017 et reconvertie dans la fabrique de chaussettes
de ski ». Non, ce serait « ce studio qui préfère embaucher des linguistes pour recréer trois dialectes
de proto-indo-européen plutôt que des designers pour corriger les failles de gameplay de son jeu. »
par Louis-Ferdinand
Sébum

M
algré la normalisation générale, on chasse des animaux, on cueille des plantes, on
malgré la déclinaison ad nauseam récolte différentes variétés de bois et de pierre.
d’Assassin’s Creed plus médiocres Comme dans tout bon Far Cry, les matériaux ainsi
chaque année, Ubisoft a su accumulés servent à fabriquer des consommables
garder un grain de folie, un côté (soins, pièges…), de l’équipement (sacs pour
mi-visionnaire mi-obsessionnel qu’on ne trouve plus porter plus de munitions ou d’objets…) et, grande
guère chez les autres grands éditeurs. Imagine-t-on nouveauté, des armes. En effet, contrairement aux
Activision ou Electronic Arts décider subitement épisodes précédents où les pétoires devaient être
de transposer Call of Duty ou Battlefield à la ramassées ou achetées, ici tout ce dont dispose
préhistoire ? Bien sûr que non, le risque financier Takkar, notre héros des âges farouches, a été
serait trop grand. C’est pourtant ce qu’a fait Ubi, fabriqué à la main, comme dans une boutique Genre : ĀųŸƋ
comme ça, sur un coup de tête. Adieu veaux, Artisans du Monde. Vous voulez une meilleure ŞųåĘĜŸƋŅųĜÏ
vaches, cochons et AK-47, bonjour mammouths, massue ? Eh bien, récupérez du petit bois, de la ŸĘŅŅƋåų
rhinocéros laineux et lances en os de yak. Au mépris peau animale et du silex. Cette importance nouvelle Développeur :
du danger et de tout bon sens, ce nouveau Far Cry du crafting, qui n’est plus un vague prétexte pour ŽÆĜŸŅüƋaŅĹƋųæ±Ĭ
se déroule donc au mésolithique, 10 000 ans avant occuper le joueur (pourquoi diable se faire chier à Š±Ĺ±Ú±š
fabriquer une gibecière en peau de mouton quand Éditeur : ŽÆĜŸŅüƋ
on vit au XXIe siècle et qu’on pourrait en acheter
une au marché ?) placé au cœur du gameplay,
Ubisoft a su garder un est l’une des trois excellentes idées de Primal, la
suivante étant la gestion du feu.
grain de folie avec ce Une aventure de Julie Lascaux. Si vous avez déjà
Far Cry préhistorique. joué à un Far Cry, vous vous souvenez sans doute de
son excellent système de propagation des flammes.
Une fusée de détresse atterrissant dans l’herbe
qu’un célèbre poupon nazaréen ne fasse le couillon sèche peut dégénérer en feu de forêt gigantesque.
dans une mangeoire. Cela dit, même s’il convient Primal pousse l’idée encore plus loin. Il est possible
de saluer le courage d’Ubisoft qui aurait pu se d’embraser n’importe quelle arme à l’aide d’un peu
contenter de nous pondre un nouveau clone de Far de graisse animale ou de toute source de feu croisée
Cry 3, il faut être honnête : Primal n’est pas un pari dans le monde. Un bête gourdin enflammé peut
aussi risqué qu’on pourrait le croire de prime abord. servir à s’éclairer la nuit, à se réchauffer dans les Plateformes :
zones enneigées, à cramer les ennemis, à détruire {œĜĹÚŅƵŸØ
Une émission de Jean-Jacques Gourdin. des obstacles végétaux ou à faire fuir les animaux {Ĭ±Ƽ„Ƌ±ƋĜŅĹĉØ
Tout d’abord, les mécanismes de Far Cry ne sauvages. Enflammez une flèche ou une sagaie et £ÆŅƻkĹå
nécessitaient pas beaucoup de modifications pour vous pourrez foutre le feu à un village ennemi sans (SRǻK
être transposés à l’âge de pierre. Cela fait déjà même avoir besoin d’approcher. Enfin, troisième VIGSQQERH³Ic
deux épisodes que leur gameplay consiste pour et dernière nouveauté largement vantée par les {ÚåģŅƚåƚų
partie à chasser des animaux et à les éviscérer développeurs, la possibilité d’apprivoiser les bêtes 8³P³GLEVKIQIRXc
pour fabriquer bandoulières et autres carquois. sauvages. N’importe quel prédateur, du chien Ŏƅ:Ņ
Mais surtout, si Primal s’éloigne des sentiers battus sauvage à l’ours des cavernes, peut être domestiqué. 1ERKYI
par Far Cry, il n’en vise pas moins un marché Il suffit pour cela de lui jeter un appât, de presser škƤĵæŸŅĬĜƋĘĜŧƚ±ĜŸ
particulièrement porteur en ce moment : le jeu un bouton pour le calmer pendant qu’il mange et ŸŅƚŸěƋĜƋųæüų±ĹÓ±ĜŸ
de survie à monde ouvert. En effet, malgré un pouf, voilà, la bête apparaît dans un petit menu DRM : ƚ{Ĭ±Ƽ
semblant de scénario, le gros du gameplay de Primal façon Pokedex depuis lequel il est possible d’appeler
consiste à explorer librement la vallée d’Oros, belle, le poilu pour qu’il nous file un coup de main au
grande et variée. En chemin, on croise des PNJ, combat ou à la chasse. Chaque bestiau dispose de

Canard PC | 13
TEST PC FAR CRY PRIMAL

trois scores de caractéristiques (force,


vitesse et discrétion) ainsi que d’une
capacité spéciale, comme de tuer sans
faire de bruit, de détecter les ennemis
à proximité ou de récupérer du loot
supplémentaire.

Takkar ta gueule à la récré. Crafting,


feu, dressage. Ces trois systèmes, aussi
différents soient-ils, reposent sur un
même principe : faire de tout élément du
monde à la fois un obstacle et un outil
potentiel. Contrairement à la plupart des
jeux et aux précédents Far Cry, il n’y a
aucune raison dans Primal de revenir à
la civilisation, ici un village dans lequel
on ne trouve d’ailleurs aucun marchand.
Il faut constamment aller de l’avant
et apprendre, peu à peu, à conquérir
la nature sauvage. Les élans sont trop
dangereux ? Il faut pousser jusque dans
les terres du sud pour trouver de la pierre
dure, qui nous permettra de fabriquer une
sagaie assez résistante pour les blesser. Le
climat des montagnes est trop froid ? Il
faudra combattre des loups et utiliser leur
peau pour fabriquer des vêtements plus Chasse à court. À l’exception notable choisi entre son gameplay survivaliste et
chauds. Même les PNJ les plus importants, du deuxième épisode, les Far Cry n’ont son goût pour les poursuites à la Benny
guerriers et artisans prêts à enseigner jamais été des jeux particulièrement Hill, Primal a fait fausse route. On se
à Takkar leurs précieuses compétences hardcore et ont toujours assumé leur remémore les premières parties de chasse,
(fabrication d’objets, techniques de côté bac à sable bourrin. Leur intérêt celle du tutoriel, où l’on traquait un
combat avancées…), doivent être trouvés était ailleurs : dans leurs fusillades animal blessé en suivant ses traces de sang
à grand renfort d’acrobaties et de coups particulièrement violentes, dans leur jusqu’à retrouver sa carcasse exsangue.
de gourdins. Cette approche entièrement scénario astucieux, dans la capacité On se demande pourquoi Ubi n’a pas
basée sur l’exploration, ce monde qui de leur gameplay émergent à produire gardé ce rythme posé tout au long de la
révèle ce qu’il a à offrir à mesure que le une foule d’anecdotes hilarantes. Sur ce partie. Pourquoi les développeurs ont
joueur le découvre, où seuls quelques « dernier point au moins, Primal ne déçoit tenu à créer un monde aussi densément
points d’intérêt » affichés sur la carte pas. Les premières fois qu’on course une peuplé, où l’on ne peut pas faire trois pas
font office de journal des quêtes, est une poule d’eau à coups de massue, qu’on sans tomber sur douze sangliers et cinq
immense réussite. Pour peu qu’on y joue voit les membres de trois tribus rivales guerriers ennemis, où les troupeaux sont
en désactivant le HUD, la carte et les se mettre sur la gueule avant de courir si nombreux qu’il est possible de chasser
assistants, Primal nous offre deux ou trois dans tous les sens, prises en sandwich en fonçant au milieu et en tapant au
heures bluffantes où il nous plonge dans entre une meute de loups et un ours gourdin dans tous les sens – il ne reste
une nature sauvage, extraordinaire… brun, on rigole bien. Et puis, peu à peu, plus ensuite qu’à voir ce qu’on a assommé
Jusqu’à ce que le masque tombe. on se lasse. On se dit qu’à ne pas avoir et ramasser la viande par terre.

14 | Canard PC
Notre Avis :
ŅĵĵåÚĜƋĬå
ĵƚŞŞåƋÚåŸ
ĵ±ųæϱčåŸÚ±ĹŸ
ĬåĀĬĵ±ƴåÏĬå
ųŅÆŅƋ±ŸƋĘĵ±ƋĜŧƚåØ
ĔƤfais-le ou ne le
fais pas, il n’y a pas
d’essaiƤĕţeƴåÏFar
Mamouth écrase l’esprit. Primal, sachez-le,
Ma du jeu. C’est comme si Primal s’acharnait à se Cry PrimalØŽÆĜŸŅüƋ
e désespérément facile, même dans le mode de
est saboter lui-même. À quoi bon faire fuir les loups ±域±Ƽæţ)ŸŸ±Ƽæ
difficulté le plus élevé. Une fois sa sagaie et son en agitant une torche enflammée, idée pourtant ÚåųåĹŅƚƴåĬåųĬ±
arc entièrement upgradés, ce qui ne lui prendra géniale, puisqu’il est possible de les massacrer par ĬĜÏåĹÏåØ域±Ƽæ
qu’une poignée d’heures, Takkar devient une paquet de douze ? Quel attachement émotionnel ĵéĵåÚåųæĜĹƴåĹƋåų
véritable machine à tuer, capable d’étaler n’importe est-on censé ressentir envers un animal que l’on Ĭå8{„ºĵŅĹÚå
quel animal avec une facilité dont auraient a apprivoisé puisque, le jour où il crève, on peut ŅƚƴåųƋåĹĵåƋƋ±ĹƋ
rêvé les protagonistes des épisodes précédents, le ressusciter à tout moment d’un simple clic de ĬűåƻŞĬŅų±ƋĜŅĹĬĜÆųå
qui disposaient pourtant de lance-grenades. Et souris, ce qui ravale la pauvre bête au rang de ±ƚÏŊƚųÚåƋŅƚŸ
ne parlons pas des ennemis humains. Entre la power-up réutilisable ? Beau gâchis. ĬåŸĵæϱĹĜŸĵåŸţ
possibilité d’esquiver les attaques adverses (il est a±ĬĘåƚųåƚŸåĵåĹƋØ
bien plus facile d’éviter une lance qu’une balle), Dura lex, silex. Mais pire que le gâchis, il y a ƋųŅŞåĵŞéƋųæ
le très faible drop des flèches qui garantit des l’ennui. Car en dehors de son monde ouvert dont Ú±ĹŸĬűĘæųĜƋ±čå
headshots silencieux à 25 mètres, la possibilité il prend vite soin de ruiner le potentiel, Primal ÚåŸæŞĜŸŅÚåŸ
de récupérer les munitions utilisées ou d’en ne nous met pas grand-chose sous la dent. Son ŞųæÏæÚåĹƋŸØ
crafter d’autres instantanément, les sagaies qui scénario, qui aurait pourtant pu permettre de ĜĹϱޱÆĬå
one-shottent n’importe quoi, l’omniprésence de très farcryesques réflexions sur l’origine de la Úű±ŸŸƚĵåų
la viande qui permet de regagner tous ses points violence, est d’une platitude qui force le respect : ģƚŸŧƚű±ƚÆŅƚƋ
de vie aussi souvent qu’on le désire, la chouette trois tribus se font la guerre, l’une plus primitive ŸåŸĹŅĵÆųåƚŸåŸ
domestique qui lâche des bombes incendiaires que la nôtre, l’autre plus avancée, et c’est à ÆŅĹĹåŸĜÚæåŸØ
sur les camps ennemis, les boss cons comme des peu près tout. Les missions, primaires comme PrimalåŸƋƚĹ
briques qu’on peut tuer simplement en tournant secondaires, sont dignes d’un MMORPG : æƋų±ĹčåĵæĬ±Ĺčå
autour et en décochant des flèches enflammées, « Takkar, va là-bas prendre objet », « Takkar, ÚåŸƚųƴĜƴ±ĬĜŸĵååƋ
viens ici tuer chef ennemi ». L’amélioration du ÚåÆŅƚųųĜűčåŧƚĜ
village, qui permet de débloquer compétences Ÿ±ÏųĜĀåĬåŸŞŅĜĹƋŸ
et équipement avancés, nécessite de grinder üŅųƋŸÚåĬ±ĬĜÏåĹÏåØ
Primal semble s’acharner bêtement des quintaux de ressources.
Rapidement, on oublie tout ça. On fuit les PNJ,
üƚŸĜĬĬ±ÚåŸåþϱÏåŸ
åƋŸÏæűųĜŅŸ
à se saboter lui-même. les quêtes, on part se promener dans les bois à
la recherche, malgré tout, d’un instant de grâce
ĵ±ĬĜĹŸØ±ƚŞųŅĀƋ
ÚåĹŅƚƴå±ƚƻ
au milieu de ce Disneyland préhistorique. Un ĵæϱĹĜŸĵåŸƋųŅŞ
Primal est d’une facilité déconcertante. Ce ne oiseau abattu d’une flèche précise. Une partie ŸĜĵŞĬåŸåƋųæŞæƋĜƋĜüŸţ
serait pas un mal (aucun gameplay n’est mauvais de chasse où l’on envoie son lion apprivoisé à
par essence, il y a de la place en ce bas monde la gorge d’un mammouth laineux avant de le
pour les défouloirs crétins comme pour le reste) féliciter d’une caresse et d’un bout de viande. Un
si cette approche ultra-casual, où l’on ne se sent de ces moments où, caché sous tous ses défauts, Environ
jamais en danger, ne réduisait pas à néant l’intérêt
des mécanismes qui font la force et l’originalité
on discerne le jeu exceptionnel que Far Cry
Primal aurait pu être.
60 €
Canard PC | 15
TEST PC

Stardew Valley
Le bonheur est dans le pré
Ma compagne est passée derrière moi lorsque je testais Stardew
Valley*PPIEcVIKEVH³Pƶ³GVERPƶEMVTIVTPI\IIXQƶEHMXnMais à quoi
tu joues là ? Y a pas de tanks, pas d’avions de chasse, pas de torpilles
spatiales... Tu joues à Animal CrossingƐŇƣƐŭƣŇĞƭůc~5YMWIPPIWƶIWX³PSMKR³I
IRQEVQSRRERXnTu as changé, ackboo... tu as changé...~
par ackboo

C
’est vrai que Stardew Valley, ça n’est pas du tout vie : un coffre, des petites barrières, un épouvantail, des arroseurs
mon style de jeu. C’est même ma kryptonite : des automatiques… Tout est mignon. Tout est beau, coloré, serein,
graphismes 2D tout plein de pixels et couleurs gentil. Les oiseaux picorent des graines. Le vent fait pencher les
joyeuses, des vaches, des lapins, des fleurs, des petits arbres. Mon chat se prélasse sur le porche de ma maisonnette.
villageois gentils, une musique de jeu Nintendo… En théorie, C’est gnangnan comme pas possible mais purée que ça détend.
je n’ai absolument rien à faire dans cet univers enfantin. Et
pourtant, j’en suis à plus de 20 heures de jeu et j’adore. Tenez, Tissu social rose bonbon. Jouer à Jojo-le-fermier n’est qu’une
là j’écris le test, mais une partie de mon cerveau continue de partie de Stardew Valley. Il y a des tas d’autres activités dès qu’on
se demander si je dois planter des tournesols à la prochaine sort de son lopin de terre. Dans le village d’à côté, une trentaine
saison, si j’ai bien arrosé mes tulipes et si la petite nana que de NPC vivent paisiblement. On les croise sur la place du village,
je drague dans le village voudra bien se marier avec moi. ils vous balancent quelques lignes de dialogues bien cul-cul du
genre « Il fait beau aujourd’hui » ou « J’ai pêché un gros poisson dans
Le charme de la province. Stardew Valley est un RPG à fin la rivière ». Personne ne vous parlera jamais de Donald Trump, des
ouverte pompant avec entrain le concept de Harvest Moon sur frondeurs de gauche ou de la crise des migrants. Quel bonheur.
Super Nintendo. Scénario : le héros vient d’hériter d’une ferme En interagissant avec ces NPC, en leur offrant des cadeaux pour
abandonnée à côté d’une petite bourgade peuplée d’une trentaine leur anniversaire ou en effectuant des quêtes basiques du genre
d’âmes. But du jeu : aucun. C’est à vous de vous faire votre propre « ramène-moi un radis pour que je fasse une soupe », on se lie d’amitié
histoire. L’activité la plus évidente, c’est bien sûr de développer la avec eux. Il y a des fêtes organisées dans le village (concours de
ferme. Armé de petits outils (bêche, faucille, hache, piolet), votre danse, chasse aux œufs de Pâques…) qui renforcent encore les
petit perso pixellisé retourne la terre, y plante des graines achetées liens avec cette petite communauté. Certains habitants sont
à l’épicerie du village et les arrose tous les matins. Vous les récoltez même des candidats au mariage : choyez-les et vous pourrez les
au bout de quelques jours et vous les revendez contre des pièces ramener à la ferme en tant que mari ou femme. Pas de Tinder,
d’or et achetez plus de graines pour une nouvelle récolte. C’est tout pas de « plan cul super chaud dans ta région », juste des relations
con mais c’est étrangement agréable. Au bout de quelques jours, on humaines qui dégueulent de bons sentiments et de gentils
peut commencer à fabriquer quelques objets pour se simplifier la clichés. Je ne comprends vraiment pas pourquoi j’aime ce jeu.

16 | Canard PC
,IRVIRPG paysan
cul-cul-la-praline
)³ZIPSTTIYV
ConcernedApe
(États-Unis)
“HMXIYVĘƚÏĩĬåĀŸĘ
5PEXIJSVQI
PC Windows
(SRǻK
VIGSQQERH³I
ƚĹƤŞåƋĜƋ{ÚåģŅƚåƚų
8³P³GLEVKIQIRXc
300 Mo
1ERKYIVO
uniquement
)72Steam

Aujourd’hui, j’installe un poulailler. Il y a plein


d’autres choses à faire dans Stardew Valley. Ce
sont des petits morceaux de jeu vidéo qui, pris La vallée de Stardew n’est pas gigantesque, mais
séparément, n’ont rien d’extraordinaire, mais qui elle regorge de détails et de zones annexes à
ensemble forment une ambiance, un rythme, une déverrouiller. C’est d’autant plus remarquable que
véritable petite vie rurale. Vous pouvez aller pêcher le jeu a été réalisé par un développeur solitaire.
du poisson sur la jetée et le vendre au magasin d’à
côté. Vous pouvez explorer les bois pour y récolter 3SXVI&ZMWc
des fleurs et légumes sauvages. Et il y a aussi la Stardew Valley est
mine, la zone de combat du jeu dans laquelle, armée incroyablement
d’une petite épée, il faut explorer des dizaines de pourrait être plus pratique, surtout lorsqu’il niais, bêbête, lent,
niveaux pour buter des petits monstres rigolos s’agit de jongler avec un inventaire de vingt items mignon, serein,
et ramasser du minerai. En fait, il y a toujours de qui ne sont pas tous accessibles par la barre de relaxant. C’est un
quoi s’occuper dans Stardew Valley : moissonner les raccourcis. Et les trajets, parfois, semblent un peu paisible simulateur
champs, récupérer les œufs de votre poulailler ou le longuets à cause d’un personnage qui n’avance pas de bonheur
miel de vos ruches, vendre une pierre précieuse au très vite, même en activant le « always running » rural, un petit
forgeron, ramasser des coraux et des coquillages sur dans les options (ce que vous ferez tout de suite). RPG dégoulinant
la plage, remettre en état la salle municipale, crafter Mais Stardew Valley a tellement de charme. Je de guimauve
de nouveaux meubles pour la maison, progresser sur n’ai pas d’enfant (Dieu m’en préserve), mais si qui comblera
un des nombreux petits arcs scénaristiques offerts j’avais un môme ou une gamine de 7-10 ans sur pleinement ceux
par les NPC… Le piège, c’est que les sauvegardes les bras, je sais que nous serions tous les deux qui voulaient un
se font uniquement le soir, lorsque le héros se met devant le PC. Mon bambin s’extasierait à chaque jeu à la Harvest
au lit. Alors au réveil on se dit toujours : « OK, écran et dirigerait le héros au clavier avec ses Moon sur PC.
aujourd’hui j’installe le poulailler, je coupe 150 rondins petits doigts maladroits. Moi, je lui traduirais
de bois pour me fabriquer des coffres et je file un hareng les dialogues (ils sont uniquement disponibles
à Sébastian, puis j’arrête. » Mais on n’arrête jamais. en anglais) tout en consultant la Wiki du jeu
afin d’optimiser mes rendements agricoles et Environ
Un vrai jeu de 7 à 77 ans. Il y a bien quelques
défauts dans cet univers si accueillant. L’interface
construire une ferme de millionnaire. Ce serait
une si belle scène de bonheur familial.
15 €
Canard PC | 17
TEST PC

par Maria Kalash

Shardlight ,IRVIc aventure


à l’ancienne
la peste aux étoiles )³ZIPSTTIYVc
³HMXIYVc
Chez vous je ne sais pas, mais ici c’est la saison des coups de vieux. Prenez Dave Gilbert Wadjet Eye
et sa micro-entreprise d’édition de jeux Adventure Game Studio. Mais si, tous les point Games (États-
cGPMGOªKVSWTM\IPWIXTIXMXWFVEWHIGIWHIVRM²VIWERR³IWPIWGemini Rue, les Blackwell, les Unis d’Amérique)
Primordia, les Resonanceƾ'SRªZSXVIEZMW±EJEMXGSQFMIRHIXIQTWUYƶMPIWXPª$)M\cERW 5PEXIJSVQIc
PC Windows
(SRǻK
recommandée :
un ordinateur
doté d’une souris
et d’un écran
8³P³GLEVKIQIRXc
500 Mo
1ERKYIc
VOST anglais
)72cSteam ou
aucun sur GoG
)72ccpc.cx/eRW

L
es shardlights, ce sont des
petits fragments de verre
dopés à l’uranium. Sous
la lumière des UV, ils rayonnent
d’une lueur verte, glauque. Dans
la grande ville ravagée par la
bombe une vingtaine d’années
auparavant, c’est devenu la
source de lumière pour les
humains qui tentent de survivre.
Dans le nouvel ordre qui s’est
institué, il y a les gagnants et les
perdants. Les aristocrates, qui Notre Avis :
ont accès à tout, et les autres. Amy appartient à la jeu, un tout petit nombre de puzzles vient renforcer Pour qui apprécie
seconde catégorie. Pour espérer survivre à la maladie l’épaisseur des mystères qu’Amy s’apprête à percer. les gros pixels des
qu’elle vient de contracter, elle accepte un contrat productions Wadjet
du gouvernement. En guise de salaire, elle obtiendra La lutte des crasses. Comme dans Resonance, Eye, il y a de quoi se
un ticket de loterie. Une tombola dont le gagnant Primordia ou Technobabylon, quelques-unes des régaler. Une histoire
remporte… une dose de vaccin. précédentes productions Wadjet Eye, la dystopie sert intéressante, des
de cadre à l’évolution d’un personnage. C’est du coup personnages forts
La mécanique du splendide. Dans ce monde hostile, un peu surprenant qu’Amy prenne des décisions sans et une ambiance
Amy tient le coup et vivote. La mécanicienne a des vous. Elle décide de s’allier aux uns ou de rejeter les ÚåĀĹÚƚĵŅĹÚå
amis, un appartement, des voisins. Vous leur parlez et autres, sans vous demander votre avis de joueur. Mais servent un propos
vous vous déplacez au clic gauche, le clic droit permet n’ayez crainte, c’est ensemble que vous déciderez du plutôt nuancé. Du
d’observer, et passer sa souris en haut de l’écran fait fin mot de l’histoire. Pour ceux qui regretteraient coup, on regrette
apparaître l’inventaire, sur fond vert shardlight. d’avoir déjà terminé ou qui souhaiteraient tâter du ŧƚåĬ±ĀĹØƚĹŞåƚ
Amy Cooper frappe par sa normalité. Dénuée de doigt l’univers peuvent jouer gratuitement à Rebirth précipitée, arrive
super pouvoirs ou de connexions, elle se débrouille et The Reaper, développés par Ben Chandler et si vite.
et elle prend quelques décisions dans un monde Francisco Gonzalez, les développeurs de Shardlight,
trop grand pour elle. Il s’agira de repérer des objets à l’occasion d’une jam (cpc.cx/eOy). Mais cela
dans les décombres, de les utiliser au bon moment, n’empêchera pas les charmantes aventures d’Amy
de parler aux bonnes personnes et de s’intéresser à Cooper de finir un peu trop vite, après à peine Environ
leur sort. En dehors de la combinaison d’objets assez
logique, parfois brutale, qui constitue l’essentiel du
plus de cinq riches heures de jeu, et de manière un
tantinet expéditive.
15 €
18 | Canard PC
Plants vs. Zombies : Garden Warfare 2 par Netsabes

Le pot de terre et le pot de fer 2 : la vengeance Genre : TPS multi


YVQSR³GVERYRIVSWIXMVIHIWFSYPIWHIJIYWYVYR^SQFMIREMR Développeur :
HERWYRQIGLEYRZMIMPPEVHFEPERGIYRHVSRITIVVSUYIXHERWPIW Popcap (Canada)
EMVWUYMWITVIRHHIWXMVWHI)(&TEVYR³TMHIQEºWƾ'SRGƶIWX Éditeur :
TEWIRGSVIEYNSYVHƶLYMUYƶSRZEQITVIRHVIEYW³VMIY\ªPEV³HEG *PIGXVSRMGc&VXW
Plateformes :
5(c;MRHS[W<FS\
4RI5PE]XEXMSR
(SRǻK
recommandée :
5(cHINSYIYV
8³P³GLEVKIQIRX
,S
1ERKYIVF
DRM : Origin

I
l y a deux ans, EA sortait Plants vs.
Zombies : Garden Warfare, un TPS
multi en 12v12 avec les personnages
de Plants vs. Zombies. Le premier Garden
Warfare, malgré son originalité et sa
bonne humeur, présentait deux défauts
majeurs : un système de progression qui
donnait l’impression que des micro-
transactions allaient être ajoutées (ce qui
fut le cas) et un déséquilibre permanent
entre les deux camps. Bien sûr, ce dernier était au Warfare 2 propose trois nouveaux personnages par
cœur même du gameplay asymétrique du jeu (les camp, dont deux qui, chez les plantes, massacrent tout Notre Avis :
plantes, faibles et rapides, étaient équipées d’armes sur leur passage. Résultat, lors de toutes mes parties en :±ųÚåĹœ±ųü±ųåƤƖ
automatiques, tandis que les zombies, costauds et ligne, j’ai assisté au même phénomène : on comptait est la copie
lents, avaient des armes à moins longue portée et à la déjà 12 joueurs côté plantes quand je les rejoignais, conforme du
vitesse de tir moindre, mais causant plus de dégâts), donc je débarquais chez les zombies, généralement premier épisode,
mais se voyait exacerbé par des cartes trop ouvertes, moins nombreux. Dès la fin des matchs, les deux présentant les
forcément au détriment des zombies. Je suis ravi de tiers des joueurs de mon camp abandonnaient, mêmes défauts,
vous annoncer que Popcap n’a pratiquement rien espérant réapparaître côté plantes dans une autre une poignée de
corrigé de tout cela. Le système de progression (à base partie, et ainsi de suite. Un patch rééquilibrant le nouveautés et
de paquets de cartes à collectionner) reste conçu pour jeu a été annoncé ; peut-être sera-t-il sorti quand un mode solo à
les micro-transactions… Et tiens donc, alors que j’écris vous aurez ce magazine entre les mains mais pour ŞåĜĹåŞĬƚŸæƋŅýæţ
ces lignes, le jeu est sorti depuis à peine 15 jours que les l’instant il a déjà une semaine de retard, et le seul Et pour ça, EA
voilà déjà arriver. Pour le premier épisode, EA avait au disponible est celui qui ajoute les micro-transactions. pense pouvoir en
moins fait mine de temporiser, attendant deux mois Le pire, c’est qu’à l’instar du premier épisode, Garden demander 30 euros
après la sortie avant de lâcher ses comptables dessus. Warfare 2 fonctionne par moments comme prévu : de plus que pour le
les affrontements y sont temporairement chaotiques ŞųæÏæÚåĹƋţ
La rose arrose. Concernant l’équilibre des parties, il et farfelus, les gadgets et pouvoirs secondaires des
reste catastrophique. Popcap a fourni un gros effort nouveaux personnages ajoutent une bonne dose de
sur les maps, qui offrent beaucoup moins de lignes de variété aux combats… bref, pendant un instant ou Environ

tir évidentes, mais à côté de cela, il s’est complètement deux, on s’amuse. Il ne manque pas forcément grand- 60 €
planté sur les nouvelles classes de personnage. En chose pour que Garden Warfare 2 passe du bon côté de sur PC,
70 € sur
plus de celles disponibles dans le premier épisode la barrière, mais l’obstination d’EA à ne rien changer à consoles
(on peut d’ailleurs importer sa progression), Garden sa formule n’améliore pas le jeu, bien au contraire. (pardon ?)

Canard PC | 19
TEST PC

Grim Dawn
Diablo laïc
Depuis quelques années, on peut lire partout que Grim DawnIWXncplus maturec~
que ses concurrents. S’agit-il d’un jeu qui vous susurre du Simone de Beauvoir
à l’oreille pendant que vous pataugez dans le sang frais ? Son scénario vous
pousse-t-il à vous interroger sur la morale, la justice et l’inégalité des richesses
au sein de notre société bourgeoise ? Pas vraiment. Apparemment, la maturité,
ce serait plutôt d’éviscérer des monstres mais avec une petite larme au coin de
l’œil, parce que quand même, c’est très triste ça, d’éviscérer des monstres.

par Izual

L
es récoltes pourrissent, les coupe-jarrets pullulent le long Les classes des titans. Et Grim Dawn peut avoir confiance
des routes, l’ambiance est au post-apocalyptique mâtiné de en lui : son système de progression, élément aussi vital pour
western… L’univers de Grim Dawn n’est pas jojo. Si vous un hack & slash qu’une balance truquée pour un maraîcher,
n’avez jamais osé terminer le bouquin de votre classe de a été entièrement repompé sur un autre titre, Titan Quest.
lecture en CE1 de peur que le chien meure à la fin, alors là oui, il Bon, le jeu avait été créé par la même équipe que Grim Dawn,
est même mature et terrifiant. Tandis que si vous êtes quelqu’un ce qui doit alléger pas mal la culpabilité des vilains plagieurs.
de normalement constitué, vous trouverez sans doute son univers Dès votre premier gain de niveau, vous choisissez donc votre
plutôt lambda. Trop lambda, même. Sans doute un peu idéaliste classe – sorcier pyromane, assassin aux lames agiles, etc. – mais
et fleur-bleu, je m’attendais à ce que ce Diablo post-apo’ me mette vous pouvez par la suite sélectionner une autre de ces classes
une tronçonneuse et un lance-flammes dans les mains avant de pour compléter la première, de façon à avoir deux arbres de
me demander de charcler du pillard dans une bagnole déglinguée. compétences où répartir vos points. Au final, le système assez
Au final, je me suis retrouvé avec la même hache à deux mains flexible permet des spécialisations poussées mais aussi une
que dans le premier hack & slash venu, à ferrailler contre les certaine polyvalence, notamment pour les joueurs qui adorent
mêmes monstres difformes et à évoluer dans des souterrains qui un versant de leur classe principale et qui vont chercher à le
auraient pu être creusés par des nains. Et si je place ce constat renforcer grâce à un bout de l’arbre d’une autre. Les joueurs en
brutal en tête de mon papier, ce n’est pas entièrement par cruauté. quête de nouveauté seront déçus de retrouver un système déjà
C’est pour qu’on soit bien conscient que, contre toute attente, éprouvé, mais on a aussi le droit de les traiter de rabat-joie et
Grim Dawn ne cherche pas à nous happer grâce à son univers. de les laisser dans leur coin vu l’efficacité de ce bi-classage.
Il revendique son classicisme d’entrée de jeu, tout de go, et il
vous balance des zombies à la figure alors qu’il sait très bien que Diablo grenadine. Grim Dawn apparaît donc d’abord comme
vous en avez déjà buté des millions dans Torchlight 2. Parce qu’il un hack & slash prometteur où, sans surprise, le héros doit
a confiance en ses capacités. Il est comme ça, Grim Dawn. éclater des grappes de monstres, ramasser les objets rares sur

20 | Canard PC
Genre :
hack & slash
)³ZIPSTTIYVc
éditeur :
Crate Entertainment
(États-Unis)
Plateforme :
PC Windows
(SRǻK
VIGSQQERH³Ic
PC de joueur
8³P³GLEVKIQIRXc
3,1 Go
1ERKYIVO
DRM :
Steam (mais les
dév’ ont promis
qu’ils seraient sur
GOG un jour)

leurs cadavres et passer aux groupes suivants puis au boss de Titan au mitard. Et puis, au bout de quelques heures de jeu,
la zone. Les mécaniques restent très classiques, leur exécution le plaisir de jouer les brutes se dissipe. Le déclic, de mon côté, a
généralement correcte – objets variés, contenu de haut niveau coïncidé avec le moment où j’ai perdu tout espoir de voir l’univers
à foison, mode hardcore où votre personnage n’a qu’une seule du jeu devenir vraiment post-apo’ au lieu de se contenter d’un
vie, et ainsi de suite. Après pas mal de combats, on remarque médiéval-fantastique parfumé à la poudre à canon. C’est là que le
aussi une petite prise de risque côté baston, où l’accent est plutôt manque d’inspiration de Grim Dawn m’a sauté aux yeux. Avec son
mis sur l’attirail du joueur au détriment de la complexité de ses bestiaire trop classique et ses niveaux stéréotypés du genre prison
tactiques – un parti pris qui déplaît au Sun Tzu qui sommeille ténébreuse et labo de savant fou, l’univers sans saveur du jeu le
en moi, mais qui reste défendable dans un jeu basé sur le loot. handicape plus qu’autre chose. Pire : les cartes sont fixes et non pas
On relève bien quelques défauts de conception, comme cette générées procéduralement, un vrai retour en arrière en termes de
absence totale de challenge jusqu’aux alentours du niveau 12 rejouabilité qui aurait soi-disant permis au studio de porter plus de
si vous ne jouez pas en mode difficile, mais dans l’ensemble, soin à la cohérence des zones, ce qui n’est pas flagrant. Les combats
Grim Dawn fonctionne. On se surprend à essayer nos nouvelles non plus ne sont pas exempts de défauts, certes mineurs, mais tout
aptitudes avec entrain, à défoncer des crânes dans l’allégresse et de même agaçants : la lisibilité est aux fraises, les massues à deux
à chercher des sessions multijoueurs pour parcourir le monde en mains décrites comme « très lentes » frappent aussi vite qu’un
bonne compagnie – surtout qu’après un long tunnel d’adversaires sabre « très rapide » de Diablo, les boss sont des sacs à PV ignobles
monstro-zombies, on se retrouve enfin à affronter des bandits et les monstres six fois plus nombreux que ce qu’on attend dans
humanoïdes, un changement de cadre assez bienvenu. un hack & slash, avec beaucoup de chair à canon. À côté de ça, il

Canard PC | 21
TEST PC GRIM DAWN

L’homme le plus « classes » du monde


Au niveau 2, votre personnage devra
choisir entre six classes qui détermineront
ses aptitudes, ses forces et ses faiblesses.
L’occultiste est un invocateur porté sur les
malédictions et le poison, le démolisseur
est un ingénieur-sorcier qu’il ne faut jamais as
laisser seul avec une boîte d’allumettes, s,
le shaman se concentre sur la tape à
deux mains tout en demandant de l’aide de
à la foudre, et ainsi de suite. Plus tard
dans l’aventure, le choix d’une deuxième me
classe permet au joueur d’acquérir dess
sorts dans une nouvelle branche ou de e
compléter sa spécialisation dans un type pe
d’attaques. En plus de ce bi-classage, la
répartition de quelques points dans des es
ÏŅĹŸƋåĬĬ±ƋĜŅĹŸ±ƚĀĬÚåĬ±ޱųƋĜåƴĜåĹÚų±
consolider un aspect du personnage sur
lequel vous voudriez mettre l’accent.

3SXVI&ZMWc
S’il avait au moins
assumé son côté
post-apo’, Grim
Dawn aurait pu être
un chouette hack &
slash d’ambiance.
Au lieu de ça, il
est condamné à
devenir du rab’
générique de
Path of Exile et
Diablo III, un titre
plutôt correct
mais vachement
classique, qui se
rate sur trop de
points pour devenir
incontournable.
Sur le papier, il a
bien suivi la recette
faut aussi reconnaître des qualités aux bastons, même fait mieux. Rassurez-vous, je ne m’apprête pas à du hack & slash.
avec des coups qui peuvent envoyer valdinguer déterrer la vieille momie Diablo II, laissons-la reposer Après y avoir joué,
les ennemis à quinze mètres, des animations de en paix. Mais impossible de jouer à Grim Dawn sans on constate que
mort rigolotes et des ennemis qui s’entre-tuent penser à un autre titre, plus récent, Path of Exile. Grim Crate Entertainment
parfois sans prévenir tellement ils ont la dalle. Dawn souffre beaucoup de la comparaison avec le jeu a quand même
de Grinding Gear Games, plus beau, plus profond et oublié quelques
Grim contre l’humanité. Alors voilà, Grim plus complexe. Surtout, Path of Exile a, lui, le bon goût ingrédients dans
Dawn n’innove pas des masses, fonce dans le du gratuit – ou le goût mi-figue mi-raisin du free-to- la marmite : le
classicisme la tête la première et en plus se permet play, si vous préférez. Toujours est-il que j’aurai du mal ŸŅƚÿååƋĬű±ƚÚ±Ïåţ
de rater certains trucs. Quelles conclusions en à recommander Grim Dawn alors qu’une alternative
tirer ? Que s’il s’agissait d’un précurseur du hack gratuite existe. Les fans du hack & slash et ceux qui ont
& slash et que la concurrence était inexistante, raclé tous les titres du genre peuvent sans problème
il pourrait prétendre aux plus sincères louanges. l’acheter, histoire de s’injecter une bonne dose de neuf Environ
Malheureusement, d’autres jeux ont déjà tenté de
remplir le même cahier des charges, et ont parfois
dans les veines. Aux joueurs moins fanatiques, on
conseillera plutôt ses concurrents plus aboutis.
25 €
22 | Canard PC
TEST PC

par Kahn Lusth

Devil Daggers Genre : Fast FPS


)³ZIPSTTIYVc
Les dagues aux doigts éditeur :
:SYWZSYWWSYZIRI^HIW+5UYMSRX³X³TVSHYMXWHERWPIWERR³IW$1ƶSFPMKEXMSRHIWXVEǺIV „Ņų±ƋĘƤŠeƚŸƋų±ĬĜåš
comme un dingue, de « bunny hopper » comme un dieu et de placer ses tirs à la perfection Plateforme :
TSYVWYVZMZVITPYWHIXVSMWQMRYXIWWYVXSYXPSVWUYƶSREZEMXPIQEPLIYVHIZSYPSMVNSYIVIRPMKRIc$ {ƤœĜĹÚŅƵŸ
Eh bien, Devil Daggers est une lettre d’amour au genre... écrite sur un timbre poste. (SRǻK
recommandée :
n’importe quel PC
8³P³GLEVKIQIRX
220 Moc
1ERKYIškƤŠ±ĹčĬ±ĜŸš
DRM : Steam

P
as de musique, ni de
décor. Je suis là, planté
devant une dague qui
flotte dans les airs, à peine
éclairée d’un halo lumineux.
Je m’approche et en prend
possession, ce qui me révèle
les alentours, résumés à une
petite plateforme ronde qui
flotte dans le vide et surtout, Notre Avis :
des ténèbres insondables. Devil Daggers est
Machinalement, j’effectue un un très bon FPS,
clic gauche pour comprendre que maintenir ce dernier peau. Je suis désormais classé aux alentours du numéro mais succinct au
me permet de mitrailler des dagues, tandis qu’une 25 000. « Bordel, c’est quand même pas un FPS à la con possible. Malgré
courte pression me permet de tirer en large cône, à la qui va m’apprendre la vie ! », me dis-je en vidant ma son prix cadeau, on
manière d’un fusil à pompe. Ah, trois pylônes viennent canette et en relançant une nouvelle partie. Cette fois, le recommandera
d’apparaître et ont lâché chacun une grosse nuée de je découvre qu’on peut faire une sorte de rocket jump, surtout aux
crânes qui OH PUTAIN DE MERDE ÇA VA TROP en se tirant un coup de fusil à pompe dans les pattes amateurs de
VITE ! Une simple touchette aura suffi à me tuer, et que les sauts en diagonale sont vachement utiles speedruns et autres
révélant ainsi l’écran de fin et son tableau des scores pour gagner en vitesse. Je tourne en rond, je tiens bien prouesses, qui
mondial. Je ne suis pas loin du numéro 30 000 et je plus longtemps et crève en touchant un pylône comme mouilleront leur
me sens un peu honteux, non pas à cause de mon score un con. Cette fois, c’en est trop. J’écrase la canette chemise en partant
pitoyable mais parce que, l’espace d’un instant, j’ai contre mon front et je lance le replay du numéro un, à la chasse au
détesté ce qui me rendait autrefois joyeux. Je suis en pour essayer de comprendre. Il vise impeccablement score. Les autres
train de vieillir. malgré l’absence de réticule, laisse les pylônes en vie n’y verront qu’un
pour augmenter son score grâce aux nuées de crânes jeu vide et répétitif,
Clique, meurs, recommence. D’un simple clic, qu’ils envoient. Il se balade. Pire encore, à force de ce qui me rend très
je relance la partie. Cette fois, je commence à tuer, son arme devient de plus en plus puissante et tire triste.
comprendre quelques petites subtilités, comme le désormais dans un son strident, proche de celui d’une
fait de tirer sur la gemme rouge qui orne les pylônes cocotte-minute. En réalité, il ne semblera souffrir que
pour les détruire instantanément. J’insiste, je cours dans la dernière minute, lorsque la plateforme sera
dans tous les sens en poussant des petits cris, jusqu’à saturée de monstres en tous genres. C’en est fini de lui, Environ
ce qu’un de ces foutus crânes cornus, moins nombreux
que les crânes normaux mais plus solides, me fasse la
tout comme des réflexes de ma jeunesse et pourtant,
j’ai toujours envie de jouer.
5€
24 | Canard PC
The Walking Dead :
T Life in Bunker
Michonne
M Abri raccourci
Episode 1 : In Too Deep
Je suis la Ténébreuse - la veuve - l’inconsolée Par Guy Moquette

Par Maria Kalash

I
l est fréquent qu’un jeu ne dévoile sa vacuité
Genre : point & click & QTE qu’une fois le didacticiel passé. Dans de rares
)³ZIPSTTIYV³HMXIYVc cas, il accomplit l’exploit de provoquer un
Telltale Games ennui confinant à la somnolence dès l’explication
(États-Unis de Californie) des principes de base. C’est comme ça : on n’a pas
Plateformes : encore achevé le tuto de Life in Bunker que l’on
PC Windows, Mac, comprend qu’il recycle les mécaniques reprises à
PS3, PS4, Xbox One et des dizaines, des centaines même, de jeux qui les
360, iOS, Android exploitaient mieux que lui, en ajoutant un petit
Langue : VOSTFR
côté Dungeon Keeper pour s’attirer la sympathie
DRM : Steam
ou la curiosité des badauds qui croisent son
Prix : 15 euros la saison
de 3 épisodes
chemin. À la surface de la planète, c’est la grande
saison des champignons (atomiques), on se
retrouve avec le destin de survivants bloqué à
l’intérieur d’un abri souterrain, et la charge de
le développer en attendant que ce petit monde
puisse sortir prendre l’air. On ne va pas faire
durer le suspense si vous voulez prendre soin
d’une petite colonie, on pourrait vous citer
des dizaines d’excellents jeux (à commencer
par Banished et Rimworld) qui font tout bien
mieux. Ce machin bricolé à la va-vite est allé
faire un tour dans les années 1990 pour en
ramener des modèles 3D offensants et une
interface qui laisse des traces (psychologiques,
mais également de souris dans le mur, pour être
précis). Life in Bunker est un sandwich au pain,
un plat de nouilles trop cuites sans beurre. Un
truc fadasse, qui ne fait même pas l’effort d’être
suffisamment raté pour provoquer des fous-
rires, et dont la seule gloire est d’être un poil
plus profond que Fallout
Rien
I /10
l paraît que c’est dans les vieux près. Telltale ne change absolument Shelter. Ouais, c’est moche.
pots que l’on fait les meilleures aucun des ingrédients de sa formule
soupes, et je suis bien d’accord, à gagnante depuis 2012 : vous allez
condition cependant que les oignons alterner les phases de QTE (où il
n’aient pas pourri et que les carottes vous faudra marteler les touches a et
ne soient pas blettes. Telltale remet e de votre clavier que vous aurez pris
donc le couvert avec son adaptation soin de passer en qwerty), quelques
des comics de Robert Kirkman, The maigres phases d’exploration et des
Walking Dead, et propose au joueur dialogues où vous devrez décider
pas encore écœuré par la recette des répliques de Michonne dans des
de se plonger dans les aventures moments de pression. Les acteurs
maritimes de Michonne, personnage sont impeccables, Telltale fait l’effort
au charisme magnétique. Taiseuse, de fournir des sous-titres français à Genre : anodin
dure-à-cuire, mais aussi pleine de côté de la plaque, mais on commence )³ZIPSTTIYV³HMXIYVcFlox Studios (quelque
fêlures, elle porte à elle toute seule le à éprouver un sentiment de lassitude part dans un ancien pays du Pacte de Varsovie)
premier épisode de cette mini-série, non négligeable. D’ailleurs, Telltale Plateformes : PC Windows, Mac
censée servir de trait d’union entre ne s’y trompe pas : l’épisode bat des Langue : VO
les saisons 2 et 3 du jeu. On y vit records d’expéditivité et (SRǻKVIGSQQERH³Iune bibliothèque
les aventures de l’avocate lorsqu’elle se boucle en à peine plus Steam de jeux tous terminés trois fois
quitte temporairement le groupe d’une heure. Dans l’absolu DRM : Steam ou aucun (Humble Store)
de Rick Grimes dans les comics, ce n’est pas mal, mais perso 8³P³GLEVKIQIRX130 Mo
pour ceux qui suivraient ça de je n’ai plus vraiment faim. Prix : 16 €

Canard PC | 25
TEST PC

par Pipomantis

The Deadly Tower of Monsters ,IRVIc nanar


)³ZIPSTTIYVc
My tailor is kitsch ACE Team (Chili)
Le savriez-vous ? Dans le commentaire audio du DVD d’Asterix & Obélix : Mission “HMXIYVcAtlus
Cléopâtre, Alain Chabat meuble les silences entre les anecdotes de tournage avec 5PEXIJSVQIWc
des lectures de recettes de cuisine. PC Windows, Mac
(SRǻK
recommandée :
PC de joueur
8³P³GLEVKIQIRXc
1 Go
1ERKYIc VOSTF
)72cSteam

T
he Deadly Tower of
Monsters est – comme
son nom ne l’indique Notre Avis :
pas vraiment – un hommage Terriblement
au cinéma de science-fiction charmant et
des années 1940-50, où des sympathique, The
spationautes en collants Deadly Tower of
avec un bocal autour de la Monsters n’est
tête croisaient des aliens pas un mauvais
au cerveau hypertrophié et bougre. Certes
des moustiques de dix-huit maladroit et pas
mètres au garrot. Dès ses toujours bien
premières secondes, le titre malin, notamment
d’ACE Team (Zeno Clash, lorsqu’il noie le
Rock of Ages) annonce la couleur et fait blablater le montre à la hauteur. Et c’est ici qu’ACE Team se prend joueur sous des
réalisateur du film dont vous êtes le héros, comme un peu les pieds dans le tapis. Il faut dont gravir cette combats répétitifs
un commentaire audio qui viendrait narrer vos fameuse « Tour Mortelle des Monstres » et génocider et machinaux, on
aventures. Une idée pas vraiment toute neuve qui la quasi-totalité des espèces aliens qui vous tomberont lui pardonnerait
tape un peu trop souvent à côté (Prince of Persia ou sur le râble. Malheureusement, les combats manquent presque ses
Bastion l’ont déjà exploitée, et avec plus de brio) mais cruellement d’énergie, à cause de leurs armes trop errements tant
qui, de temps à autre, arrive à arracher un sourire molles et leurs animations rigides. Pourtant, les il semble vouloir
au joueur. C’est ce genre de petits détails, aidés par développeurs se sont un peu creusés avec la possibilité bien faire. Une
une direction artistique aussi débile que géniale (les de tirer en contrebas sur des ennemis qui grimpent friandise douce-
« monstres » non-humanoïdes sont animés à 20 FPS également le long de la tour ou ces séquences en chute amère que vous
pour émuler la stop-motion de l’époque) qui donnent libre, plutôt grisantes et réussies. Certains combats de pourriez tout à
une personnalité forte à The Deadly Tower of Monsters. boss arrivent également à casser un peu la monotonie ü±ĜƋƴŅƚŸŅýųĜų
Singes géants, dinosaures, hommes-insectes et autres mais malheureusement, la répétitivité du gameplay et en dessous de
rats-cerveaux (si, si) s’ébrouent joyeusement dans son manque de dynamisme nous plongent un peu trop ŎLjƤåƚųŅŸţ
cette grande fresque kitsch qui porte fièrement son souvent dans l’ennui. On traverse de longs segments en
idiotie en étendard. pilote automatique, à taper comme un sourd sur des
ennemis en carton-pâte jusqu’à la prochaine séquence
La série B d’ACE en folie. C’est bien mignon de un peu rigolote. C’est un peu triste mais, dans ces Environ
plonger le joueur dans cette délicieuse parodie de
SF old school mais encore faut-il que le gameplay se
moments-là, j’ai un peu regretté qu’il n’y ait personne
pour me lire des recettes de cuisine.
15 €
26 | Canard PC
Deponia par Guy Moquette

Pour ne pas rester sur sa fin Genre : point & click


Développeur /
éditeur : Daedalic
« Attention, je suis, je suis... TOP ! Je suis une trilogie de jeux vidéo qui possède une galerie
Entertainment
de créatures oscillant entre le bizarroïde et le trognon. Les relations sentimentales de
(Allemagne)
mon protagoniste principal sont connues pour être compliquées. La conclusion du
Plateformes :
ƒŹŇĞžĞìķåƐæŤĞžŇÚåƐ±Ɛü±ĞƒƐĚƣŹĮåŹƐķåžƐü±ĻžØƐŭƣĞƐžåƐžŇĻƒƐžÏ±ŹĞĀæžƐåƒƐŇĻƒƐåĻƒ±ķæƐÚåžƐďŹìƽåžƐ
{ƤœĜĹÚŅƵŸØa±Ï
ÚåƭĮ±Ɛü±ĞķƐŤŇƣŹƐåĻƐÚåķ±ĻÚåŹƐƣĻåƐ±ƣƒŹåØƐĥåƐžƣĞžũũũƐůƐIåƐžƣĞžũũũƐů »
(SRǻK
recommandée :
n’importe quel PC
8³P³GLEVKIQIRX
3 Go
1ERKYIšk„‰8
DRM : „Ƌå±ĵ

M
« ass Effect ? Ah
là là là non, il
y avait un piège, il
s’agissait en fait de Deponia.
Heureusement, vous ne Notre Avis :
repartez pas les mains vides, Dans la droite
nous vous offrons l’encyclopédie lignée de ses
Larousse en 28 volumes des prédécesseurs
lieux communs dans les jeux Deponia : Doomsday
vidéo. » est un point & click
En 2013, Goodbye Deponia solide alternant
clôt la série de point & énigmes tordues
click développé par les Allemands de Daedalic. Au temps pour lui. À ce stade, vous aurez compris et humour plus ou
À l’époque, même Maria Kalash s’avouait déçue du que les paradoxes temporels et autres réalités ĵŅĜĹŸĀűƚÚţ„ŅĹ
sort (trop doux) réservé à son détestable anti-héros alternatives seront au programme. Pour le reste, plus grand exploit
Rufus. La plupart des autres joueurs conspuent, c’est du Deponia pur jus. Pur jus de chaussette, reste tout de même
pour d’autres raisons, une fin jugée bancale / même, si l’on se réfère à l’habituelle profusion de de se moquer
inadmissible / cruelle / « trop dég’ je vais retenir ma mini-jeux de qualité très inégale (heureusement autant de lui-même
respiration jusqu’à en avoir une autre ». Daedalic a tous escamotables) et à l’humour mi-pouet pouet, que des joueurs
vu l’opportunité de faire d’une pierre deux coups : mi-scato qui s’invite, une fois encore, à la fête. Dieu scandalisés par
sortir un nouvel épisode et répondre aux suppliques merci, il ne s’agit pas tout le temps de péter dans Ĭ±ĀĹÚåGoodbye
des joueurs traumatisés. Deponia : Doomsday une baignoire pour détendre l’atmosphère : comme Deponiaţ%åŞåƋĜƋåŸ
démarre sur un contrat très clair : vous êtes déçu car ses prédécesseurs, Doomsday est plutôt bien écrit, moqueries qui
vous attendiez une happy end ? Eh bien voilà, grâce arrache régulièrement quelques vrais sourires sincères frôlent même
aux voyages dans le temps, vous avez le pouvoir de devant ses situations grotesques (il m’est même arrivé parfois le doigt
modifier le cours des choses. Retour en arrière, bien de pouffer, je le confesse) et continue d’abreuver les d’honneur, mais
avant les événements des titres précédents, quand pervers masochistes du genre d’énigmes tordues et toujours avec le
Rufus projette de quitter sa planète dépotoir pour de combinaisons d’objets frôlant l’aliénation mentale. ŸŅƚųĜųåţ
atteindre la station spatiale paradisiaque d’Elysium. On est même enclin à lui pardonner ses errances sur
Ce même Rufus qui a, comme c’est pratique, des le simple souvenir de nos manipulations génétiques
visions de son futur. Et qui va mettre la main sur idiotes sur Elysium, de nos exploitations délirantes
une machine à remonter le temps, dont il va user et, des portails temporels dans le dernier quart du jeu Environ
forcément, abuser en bon être irresponsable, stupide
et égoïste qu’il est.
ou sa constante fascination obsessionnelle pour les
ornithorynques.
30 €
Canard PC | 27
TEST PC

par Maria Kalash

Heaven’s Hope Genre : EZIRXYVI


point & click
paradis vaut bien une messe Développeur :
1IH³ZIPSTTIQIRXHINIY\ZMH³SGƶIWXWSYZIRXYRIEǺEMVIHITEXMIRGIHeaven’s Hope, Mosaic Mask Studios
NIcPƶEZEMWZYªPE,EQIWGSQIR‡Pƶ³TSUYINƶEZEMWWSYVMTSPMQIRXHIZERXPƶI\TSW³UYI &PPIQEKRI
QƶIREZEMXJEMXYRQSRWMIYV.PJEYXHMVIUYƶMPTVIREMXPETIMRIHIQIWMKREPIVPIWQSQIRXWSÄMP Éditeur :
JEPPEMXVMKSPIVGIPEIÆX³X³KVSWWMIVHIQETEVXHIRITEWGSST³VIV *YVSZMHIS2IHMIR
Plateforme :
5(c;MRHS[W
(SRǻK
recommandée :
GEVXIKVETLMUYI
dédiée
8³P³GLEVKIQIRX
,S
DRM : Steam

T
alorel est un ange.
M’enfin un ange en
carton : d’abord il
est tombé du ciel, ensuite
il a cramé ses ailes et perdu
son auréole. À ce train-là,
autant dire tout de suite qu’on
n’est qu’un type normal et Notre Avis :
vaguement amnésique. Mais Heaven’s Hope
Talorel entend dans sa tête les occupera le fondu
voix de deux copains restés au d’aventure point &
Paradis, Azael et Salomé, du coup on s’éloigne un peu Mais désuet d’une autre époque que celle des décors. click une dizaine
du neurotypique. Échoué dans une verte campagne Le plus étonnant dans tout ça, c’est la façon dont le jeu d’heures, ce qui
européenne du milieu du XIXe siècle en proie au s’excuse parfois de ce qu’il vous fait faire. Comme ce est très honnête. Il
fondamentalisme catholique d’une dénommée moment où, dans un puzzle, Salomé intervient pour lui arrachera aussi
Greta, Talorel va faire de son mieux pour récupérer vous dire « nan mais en fait si ça t’embête on le résout quelques jurons
son auréole et de quoi regagner les Cieux, tout en pour toi hein ». Comme si les développeurs s’étaient d’agacement,
évitant les foudres de l’inquisitrice. Il lui faudra donc rendu compte au dernier moment de l’intérêt limité rapport à sa
tailler bavettes et hosties avec les habitants du coin, du passage, mais ne pouvaient pas l’enlever faute de lui jouabilité parfois
rendre des services en échange d’indulgences, et, avoir prévu un remplacement. aléatoire, et
occassionnellement, résoudre un puzzle. un nombre de
L’auréole, parce qu’il le vaut bien. Ce manque de rires et sourires
Talorel est hardi. Il s’agit d’un jeu d’aventure point cohérence se fait sentir tout au long de l’aventure et inversement
& click d’un confondant classicisme. L’inventaire en donne le sentiment qu’en fin de compte, personne proportionnel
bas de l’écran vous permet de stocker une collection chez Mosaic Mask (dont c’était le premier jeu) ne à sa sensibilité
d’objets hétéroclite, une carte autorise les voyages croyait vraiment à ce qu’il faisait. C’est dommage, aux questions
rapides et allège un peu le fardeau des milliasses certains personnages adorables sont sous-employés, d’inclusivité
d’allers-retours auxquels vous n’échapperez pas, et tandis que l’on n’échappe jamais aux caricatures culturelle.
un journal de quête dessiné, ainsi que les conseils lourdaudes (le marchand sorti des Mille et une nuits
de Salomé et Azael, vous évitent de vous sentir trop qui pleurniche sur le nombre d’enfants – en constante
con, surtout après une interruption un peu longue. augmentation – qu’il a à nourrir ou la vendeuse
Le tout a pour décor d’assez jolis, quoique vieillots, de soieries chinoises qui planque une opiumerie). Environ
environnements peints. Les personnages, eux aussi,
arborent un charme désuet dans leur conception.
L’ensemble parvient à rester à peu près agréable à
condition de fermer les yeux sur ses maladresses.
20 €
28 | Canard PC
TEST CONSOLE

Testé sur Wii U

Genre : combats de
coqs électriques
Développeur :
Pokkén Tournament
Bandai Namco
Entertainment
Tabassez-les touss !
(Japon) En Allemagne, Pokkén Tournament s’appelle tout ut simplement
Éditeur : The Poké thodiques et
Pokémon Tekken. J’ai d’abord pensé que, méthodiques
Pokémon Company ny carr
carrés, nos chers voisins mangeurs de Wurstst refusaient
Plateformes : toutes sortes de fantaisie et souhaitaient appeler
eler un chat un
arcade (Japon GLEX/ InZEVMSPI~IR
GLEX/ƶEMIRWYMXIETTVMWUYInTSGOIR~WMKRMǻInZEVMSPI~IR
uniquement), Wii U allema
allemand, ce qui devient tout de suite beaucoupup plus drôle.1
Langue : VOSTF

par Pipomantis

V
ariole T
Tournament,
t donc,
d estt le
l
dernier crossover signé Bandai
Namco, après Street Fighter X
Tekken (un jeu de combat idiot et
rigolo, malgré ce qu’en pensent les esprits
chagrins), et en attendant Tekken X Street
Fighter qui, pour le moment, n’a peut-être
pas dépassé le stade de « blague rigolote
sur un coin de nappe ». On y incarne
comme toujours un fringant dresseur
(ou une dresseuse) qui va embarquer
un animal sauvage et le forcer à se
battre contre d’autres animaux qui n’ont
sûrement rien demandé. Du ragondin
électrique au dragon orangé en passant
par le chandelier hanté (oui, bon), Pokkén
Tournament propose 16 bestioles jouables,
accompagnés de 15 couples de pokémon
dits de « soutien » que l’on pourra
invoquer pendant les échauffourées. Et
c’est à peu près tout pour ce qui est de la
série de Nintendo. Hormis la présence Fighter ou Mortal Kombat, hein. Pikachu de travailler des stratégies comme peut
des animaux et leurs attaques les plus Fighters, donc, scinde ses matchs en deux le demander un Street Fighter. Ici, peu
connues, on ne trouve presque rien dans parties distinctes. La première (dite importe l’adversaire que l’on a en face
le gameplay qui rappelle la série de RPG « phase de terrain ») se joue avec des de soi, on va réciter peu ou prou les
de Nintendo. Le problème, c’est qu’on déplacements libres en 3D, où les bestiaux mêmes combos, en changeant parfois
ne trouve pas grand-chose de Tekken antagonistes se tournent autour et de pokémon de soutien pour varier les
non plus. Oui, il y a quelques combos essaient de se toucher à distance. L’autre plaisirs.
simplistes à apprendre par cœur et on phase (« duel ») oppose les deux pokémon
peut faire rebondir ses adversaires contre sur un plan en 2D, comme dans un jeu de Du rififi chez Rafflesia. Dracaufeu
les murs qui délimitent l’arène, mais baston plus classique. Malheureusement, Tatapoum Baston souffre également
la comparaison avec les jeux de baston bien que certaines attaques diffèrent beaucoup de son héritage de jeu
de Namco s’arrête là. Ce qui n’est pas selon la phase de jeu et que l’on apprend d’arcade, qui vient étonnamment
forcément un défaut, notez, puisque ça vite quel coup permet de passer de l’une plomber le solo ET le multijoueur, de
donne à Pokkén Tournament l’occasion à l’autre, le système reste confus, peu deux manières différentes. Comme
de trouver son propre style et, pourquoi agréable et, surtout, un peu superficiel. dans de nombreuses adaptations de jeux
pas, de créer un nouveau genre de jeu de On sent que les designers ont voulu tenter d’arcade dans les années 1980-90, Pokkén
baston. la nouveauté, mais la mayonnaise ne Tournament souffre d’un contenu solo
prend pas vraiment. Il faut dire que le jeu particulièrement aride, où l’on enchaîne
C’est l’heure du du-du-du-du-du- n’est pas vraiment sauvé par son système des matchs comme autant de perles sur
duel (ah non, c’est pas ça). Bon, je ne de combat. Bien que chaque pokémon soit
voudrais pas vous décevoir ou gâcher une doté de nombreuses attaques originales 1. Il est d’ailleurs étonnant de voir qu’aux Pays-
quelconque surprise mais on va attendre et intéressantes, on n’a jamais vraiment Bas, où variole se dit littéralement « pokken », le
un peu avant d’annoncer la mort de Street l’impression de créer un plan de jeu ou titre du jeu est resté inchangé.

30 | Canard PC
un collier pour pouvoir,
pou de temps en mais le titre de Capcom est absolument phases et laa maniabilité, le jeu reste un
temps, regarder une cinématique sans inattaquable dans ses mécaniques de base poil trop technique pour qu’on puisse
énergie qui fait avancer un scénario alors que Namco Bandai accouche dans la le lancer en toute insouciance au cours
plan-plan. Vous pourrez aussi acheter des douleur d’un système un peu casse-gueule d’une soirée entre amis. Trop confus
coupes de cheveux et des fringues pour et confus. pour être pleinement accessible, trop
votre dresseur que vous ne verrez jamais superficiel pour être joué par les pros,
en 3D et… et c’est à peu près tout. Passons Bulbagarre, je te choisis ! C’est Pokkén Tournament ne sait pas vraiment
maintenant au mode versus. Les combats vraiment dommage, Monstres de Poche : où il habite. Tout ce que je sais, c’est
se déroulant en partie avec une caméra Crêpage de Chignon 2k16 aurait pu être qu’il n’habitera pas longtemps dans ma
derrière le joueur, chaque combattant un chouette jeu de baston. Les combats Wii U. 
doit avoir son propre écran pour suivre font parfois preuve d’un dynamisme
l’action pendant les phases de terrain. insoupçonné (la plupart des furies sont Notre Avis :
Ce qui ne pose aucun souci en arcade, très classe, par ailleurs), deux joueurs un
où chacun est posté devant sa borne, peu entraînés peuvent tout à fait échanger
Pokkén Tournament est un mystère. Le
devient beaucoup plus agaçant sur Wii U, de belles passes d’armes et le titre permet
cul entre environ 75 chaises, il se cherche
puisqu’un des joueurs se voit obligé de quand même de sélectionner un Pikachu
constamment entre sa nature de jeu
jouer sur l’écran de la mablette. Rien de luchador absolument adorable. Mais
d’arcade, ses velléités compétitives
scandaleux non plus, mais pour un jeu comparé à ces quelques qualités, tout le
et son univers sous-exploité. Sans
qui se veut compétitif (et qui sera présent reste de Pokkén Tournament est trop…
être honteux, il aura beaucoup de
au tournoi EVO cette année), c’est loin fadasse. On ne se prend jamais vraiment
mal à tenir qui que ce soit en haleine
d’être optimal, surtout quand les jeux de au jeu, le mode solo n’encourage pas du
pendant des dizaines d’heures.
baston Naruto gèrent ce point depuis des tout à jouer avec stratégie (l’intelligence
lustres sans souci. Et je sais bien que je artificielle se fait généralement rouler
suis le premier à excuser Street Fighter V dessus) et donne de mauvaises habitudes
pour son contenu solo famélique (tandis pour les parties en ligne et le versus local
qu’en plus, Pokkén Tournament propose
un mode défi le jour de sa sortie, lui)
se montre particulièrement inconfortable.
De plus, entre les changements de
Environ 60 €
Canard PC | 31
T AU DOIGT ET À L’ŒIL LES JEUX SUR TABLETTE ET SMARTPHONE
Test

bientôt si vous bientôt si vous


êtes sages n'êtes pas sages

Alike Studio, 260 Mo, 4 € Gram Games, 70 Mo, Blue Byte, 2,1 Go, 5 €
free-to-play (version (mais il y a aussi des micro-

Love you to bits WERWcTYFTSYVǘ XVERWEGXMSRWIRFSRYW

par NETSABES
Merged! Assassin’s
P as de bol : la copine robot de Kosmo a été éparpillée
à travers toute la galaxie par un trou noir. Le brave
par PIPOMANTIS
Creed :
astronaute que l'on incarne va donc parcourir l'univers
à la recherche des 25 morceaux, à travers autant de Q uand j’ai parlé à Netsabes
de mon envie de tester Identity
niveaux. Love you to bits est un petit point & click un peu Merged!, il m’a dit : « C’est un par NETSABES
trop classique se déroulant dans de petites zones bien jeu de réflexion sans réflexion nul
séparées. La plupart des puzzles sont évidents, la faute comme tu les aimes. » C’est qu’il
au faible nombre d’objets et d’interactions disponibles, est sévère, ce M. Sabes. Sauf qu’il
et le jeu se termine donc bien trop vite malgré est difficile de lui donner tort
d’interminables allers-retours. Pourquoi s’embêter à en sur ce coup-là. Merged! est un
parler, alors ? Parce que Love you to bits, développé par adorable match-3 qui consiste à
les créateurs de Tiny Thief, regorge d’inventivité, chaque poser des dominos sur un terrain
niveau proposant de nouvelles (et généralement bonnes) de jeu et faire coïncider au
idées et variations de la formule. Et pour couronner moins trois chiffres identiques
le tout, les visuels et animations du jeu sont pour qu’ils fusionnent en une
atrocement mignons. Certes, Love you to bits
reste court et basique, mais des point & click
aussi bien réalisés, j’en voudrais plus souvent.
seule case, frappée du chiffre
supérieur. En effet, on y trouve
finalement peu de stratégie et le
Q uelle mouche a bien pu
piquer les honorables
Teutons de Blue Byte pour qu’un
tout est assez répétitif mais nom beau jour, ils décident, au lieu
de nom, je me suis fait avoir de sortir un nouvel Anno, de
par l’enrobage délicieux du titre tenter de transformer Assassin’s
de Gram Games. Graphismes, Creed en « RPG » mobile ? Je
animations et bruitages en font mets des guillemets parce qu’eux
un titre tout à fait distrayant et moi n’avons pas la même
sur lequel je me vois bien passer définition de jeu de rôle : pour
quelques nuits, alors moi, on y joue un rôle dans un
qu’objectivement, il récit à choix ; pour eux, il y a de
n’en mérite pas tant. l’XP, des classes, un inventaire
et ça suffit comme ça, merci
bien. AC Identity est donc
une transposition maladroite,
malhabile, du gameplay classique
de la série sur écran tactile, avec
des missions très courtes dans
des zones pas gigantesques, où
de toute façon les contrôles
imprécis donnent envie de se
pendre. Seul petit plaisir :
y retrouver les villes
italiennes ensoleillées
d’Assassin’s Creed 2.

32 | Canard PC
3SSHPIGEOIXYHMSW2S Ryan McLeod, 40 Mo, free-to-play
JVIIXSTPE] ZIVWMSRWERWTYF
TSYVǘ
Blackbox : Think
Clocks
par PIPOMANTIS outside the box
par PIPOMANTIS

par NETSABES

P arce qu’il ne faudrait pas non


plus favoriser outre mesure les
jeux conceptuels ou les « RPG » tirés I l y a trois
mois, dans
de grosses licences Ubisoft, Clocks Canard PC
est un jeu à un seul bouton. Chaque n° 329, je vous
niveau contient un nombre donné parlais de
de petites horloges blanches qui Progress to 100,
tournent à toute vitesse et colorent un petit jeu
l’une d’entre elles. Celle précisément iOS original
qui, quand vous appuierez sur le mais court, qui
gros bouton « SHOOT » en bas de vous forçait
l’écran, tirera une balle depuis son à utiliser à peu près toutes les
aiguille, de préférence vers une de fonctions de votre machine
ses congénères. Le but est donc de portable siglée Apple. Blackbox
joue dans la même catégorie, 'YǺWXYHMS2SJVIIXSTPE] ZIVWMSRWERWTYFªTEVXMVHIǘ
détruire toutes les montres à l’écran,
sauf que lui ne vous explique
le moindre tir dans le vide étant
synonyme de game over. Alors oui,
ça reste assez éloigné de The Banner
jamais quoi faire : il se contente
de vous mettre devant une série
Timing Hero
par PIPOMANTIS
Saga ou Lara Croft Go mais que de casse-tête, à vous de trouver
la façon de les résoudre. Parfois
voulez-vous, parfois il suffit d’une
toute petite bonne idée
bien exécutée pour qu’on
il faudra changer la luminosité
ou le volume (je spoile un peu,
C ’est fou, à la base, Timing Hero était le jeu
parfait pour moi. Un gameplay simple (il suffit
d’attaquer ou d’esquiver dans la bonne direction au
se prenne au jeu. mais je vous rassure, ce ne sont bon moment), une réalisation rétro avec un chouette
que les plus évidents), tantôt pixel art monochrome et une bande-son tout aussi
il faudra lancer Blackbox à old-school, qui rappelle les sympathiques RPG que
des jours ou horaires précis… pouvait avoir le Game Boy en son temps. Et puis, pas
Seule règle : ne pas toucher de bol, j’ai lancé le jeu. Si le gameplay et la réalisation
l’écran. Le plus souvent, vous ne sont aussi réussis que prévu, la répétitivité des
trouverez la solution que par ennemis a été le premier d’une longue série de petits
pur hasard (c’est mon cas), ce qui cailloux dans ma chaussure. Sont ensuite arrivés un
peut rendre ce jeu un tantinet gros enrobage free-to-play (avec l’obligation d’acheter
frustrant. Intéressant, des « gemmes » pour enlever la pub), un univers vide
inédit, souvent bien et vain, une interface imbitable et, fin du fin,
trouvé, mais tout de une traduction française qui contient au bas
même pénible. mot 40 % de phrases en espagnol. Mes pompes
sont pleines de gravier maintenant, c’est malin.

Canard PC | 33
À PART ÇA

Ddossier

LOCOMALITO
UN AMI QUI VOUS
VEUT DU BIEN
par
Juan Antonio Becerra Vilchez. Vous ne connaissez Pipomantis
sûrement pas ce nom mais,lui,il vous aime déjà.
Depuis plus de dix ans,ce graphiste espagnol développe
dans son coin des jeux en pixel art qu’il distribue
gratuitement sous le nom Locomalito. Comme il était
temps de vous parler de ce bon samaritain évoqué ici
ou là dans nos pages au fil des années,on lui a posé
quelques questions pour mieux cerner le personnage.

T
« his is a free traditional game. » Ces six mots, que donc, dès que c’est possible, je rends un petit hommage à l’une d’entre
l’on retrouve au lancement de la majorité de ses elles dans un de mes jeux »). Et, ensuite et surtout, la gratuité
productions, pourraient suffire à définir l’inté- totale.
gralité du travail de Locomalito. Du fin fond de sa
« grotte dans le sud de l’Espagne », comme Le nerf de naguère. Car voilà, que vous vouliez
il le dit sur son compte Twitter, Vilchez mène tirer sur des monstres en fausse 3D dans 8-bit
tranquillement sa barque avec une philosophie Killer, sauver le royaume de Castille des forces
claire et saine qui tient en quelques points. démoniaques dans Maldita Castilla ou jouer
Des titres au gameplay simple, mais courts à un étonnant remake de Jet Set Willy
et difficiles pour coller à l’esprit des jeux au XIIIe siècle sur fond de massacre des
Cathares par l’église catholique dans le
sud de la France (L’Abbaye des Morts), ça
Choisir son ne vous coûtera pas un rond. Sans pour
autant faire montre d’un altruisme
prochain jeu aveugle (son site est quand même
ouvert aux donations), Juan Vilchez ne
à l’instinct et au conçoit pas ses jeux comme des pro-
duits. Il préfère dire qu’il partage avec
gré de ses humeurs. plaisir le fruit de son travail, « comme une
grand-mère partage avec ses petits-enfants
un gâteau sur lequel elle a travaillé ». Depuis
d’arcade d’antan, avec une difficulté unique le début des années 2000, il bosse en tant que
méticuleusement réglée, plein de secrets cachés un graphiste pour un petit studio monté avec des
peu partout, un score comptabilisé et des petits 8-bit Killer 2008 amis et œuvre sur ses propres jeux dans son coin,
bonus (flyers, bande originale) offerts avec chaque le soir et le week-end. Les donations des joueurs
jeu. Mais de tous les aspects de la philosophie Locomalito, les mettent un peu de beurre dans les épinards mais, de son propre
deux plus importants sont, d’abord, le nombre d’influences qui aveu, ne sont pas suffisantes pour en vivre : « Depuis le début
l’habitent (ce qu’il assume avec bonheur : « Je suis ravi d’avoir des du projet, je mets les donations dans une "boîte différente", unique-
milliers d’inspirations différentes – et tout le monde devrait l’être – ment liée aux projets de Locomalito. Garder mon ordinateur et mon

34 | Canard PC
Certains
jeux ont
carrément
eu droit
à de
véritables
éditions
physiques,
comme
cette borne
de Maldita
Castilla,
ou une
cassette
Spectrum
de L’Abbaye
Endless Forms Most Beautiful 2012 des Morts.

espace de travail à jour, faire tourner mon site, gérer les


copyrights, ce genre de petites choses. Oh, et évidemment
m’offrir quelques sorties avec ma femme, qui est sûrement
mon plus fervent supporter. »

Chili con carnet. À côté de son lit, Juan Vilchez


a posé un petit carnet dans lequel, chaque nuit ou
presque, il griffonne dessins et idées au hasard :
« Je prends rarement le temps de m’asseoir pour
réfléchir à de nouveaux projets vu que j’en ai déjà
plein mes carnets. Je dessine juste des trucs et, quand
j’ai beaucoup d’idées qui tournent autour du même
thème, j’imagine le jeu qui va autour. » Choisir son
prochain jeu à l’instinct et au gré de ses humeurs,
une méthode qui a permis à Locomalito de créer
des titres de genres très différents (shoot-them-up
horizontal ou vertical, jeux de plateforme, first per-
son shooter…), même s’il ne laisse pas tout au hasard Petit extrait
pour autant : « Quelques jours après avoir eu mon du carnet
idée, je dessine un faux screenshot censé dépeindre une magique
séquence de jeu. Quand le résultat me plaît, j’enchaîne de Vilchez,
avec quelques sprites, un décor basique et je me mets à ici pour The
coder. Si je trouve que le projet a toujours du potentiel, Curse of je décide de m’y mettre pour de bon. Je planifie environ 75 %
Issyos. de mon développement et laisse 25 % à l’improvisation, pour
pouvoir rajouter des idées sans trop changer la structure ou la
longueur du jeu. » Un développement entre organisation
et chaos, où tout avance à petits pas : un sprite ce jour-ci,
un bout de code ce jour-là… pas vraiment gênant quand
on ne s’impose pas de date de rendu : « C’est plus facile
de progresser si l’on ne pense pas constamment à la finalité,
lointaine, du projet. Je ne me presse jamais pour sortir un jeu.
Une grande partie de sa cohérence globale et de ses petits ré-
glages minutieux se font dans la dernière ligne droite, quand
le titre a l’air fini mais pourrait être encore meilleur avec un
peu plus d’amour. »

T’as le look, Loco. Ce n’est un secret pour personne :


de nombreux développeurs utilisent le pixel art comme
une béquille leur permettant de sortir des jeux plus vite
et à moindre coût. Vilchez, le graphiste professionnel
qui utilise Iconomaker (un éditeur d’icônes à 20 euros)
pour créer et animer tous ses sprites, a jeté son dévolu
sur les gros pixels pour d’autres raisons : « Je défends le
pixel art basse résolution en tant que style mais je n’y suis
Gaurodan 2013 pas enchaîné. J’imagine que, ne l’utilisant pas beaucoup dans

Canard PC | 35
À PART ÇA
D
dossier
LOCOMALITO

Hydorah 2010 Viriax 2011

L’Abbaye des Morts 2010

mon boulot de tous les jours, je le trouve « Ils partagent la plupart de leurs travaux
intéressant dans mes jeux. Et puis, quel que gratuitement et, même s’ils ont aussi des
soit le style graphique, pixel ou pas, j’aime jeux commerciaux, on remarque vite qu’ils
quand ça manque de détails. Ça aide le ne vont jamais se compromettre pour coller
joueur à imaginer ce qu’il veut, du visage au marché. » On en profite alors pour
d’un personnage à ce qui peut se cacher lui demander s’il n’a jamais, lui non plus,
derrière un décor noir. » Difficile aussi de voulu mettre un prix sur ses jeux : « J’y ai
parler de Locomalito sans évoquer ses pensé, bien sûr, mais vendre un jeu, c’est plus
deux partenaires. D’un côté on trouve son compliqué que juste coller une étiquette avec
ami proche Gryzor87, qui a composé les un prix dessus. La "bureaucrazy" nécessaire
musiques de quasiment chaque jeu, elles est un gigantesque obstacle que je cherche à
aussi disponibles gratuitement. « Il fait éviter, plus encore vu que je développe tout
toujours partie du développement, vu qu’on ça sur mon temps libre. Je n’écarte pas l’idée
se partage et commente tous nos projets. de bosser sur un projet commercial à l’avenir Maldita Castilla 2012
De plus, nous sommes tous deux très attachés mais vu ma situation actuelle, je préfère
à notre liberté et essayons de toujours avoir continuer à me concentrer sur mes idées de
un contrôle total sur nos œuvres. C’est jeux. » Après dix années à développer au-
aussi pour ça que nous les partageons toutes tant d’excellents titres gratuits et quelques
gratuitement. Quand tu n’as pas de date mois seulement après la sortie du dernier
butoir, pas de client, de financeur ou de (The Curse of Issyos, voir encadré page
patron, c’est plus facile de rester concentré ci-contre), quel regard porte Juan Vilchez
sur le travail. » De l’autre côté, un peu
plus au nord-est de l’Espagne, on trouve
Marek « Beedool » Barej, l’artiste polo-
nais qui s’occupe de dessiner les superbes « nous sommes très
jaquettes de chaque nouveau titre. Ce
dernier travaille d’ailleurs actuellement
sur son propre jeu. « Et cette fois, c’est
attachés à notre
moi qui l’aiderai pour le code », enchérit
Vilchez. Et d’ajouter : « Je travaille certes
liberté et essayons
tout seul la majeure partie du temps mais
sans leur aide, mes projets seraient moins
de toujours
bons ou, pire, n’existeraient même pas. »
contrôler nos
Gordon Freeware. Quand on lui
demande s’il connaît d’autres déve- œuvres. »
loppeurs qui partagent sa philosophie et
sa vision du jeu vidéo, Locomalito donne sur son parcours ? « Je ne regarde pas They Came from Verminest 2012
sans hésiter le nom de Daniel Remar. beaucoup en arrière mais quand je le fais, je
Ce développeur suédois embauché chez vois que j’ai accompli mon rêve de gosse au
Ludosity (Ittle Dew, Card City Nights) moins dix fois, sans compter la tonne de bons Sources supplémentaires :
prend lui aussi ses week-ends pour créer souvenirs et d’amitiés créés pendant ces an- Entretien : Locomalito - Pierre Gaultier cpc.cx/eR9
des petits jeux distribués gratuitement, nées. Je crois que je suis devenu une meilleure The Locomalito Interview - Konstantinos “Gnome”
dont le très célèbre Iji. Les noms d’Anna personne grâce à ça. Bon, je suis toujours loin Dinopoulos cpc.cx/eRa
Anthropy (Mighty Jill Off, Mind Fuck) de mon objectif de 9 999 jeux sortis, mais
et de Terry Cavanagh (VVVVVV, je fais de mon mieux ! », dit-il, alors qu’il a Merci à Locomalito pour s’être prêté au jeu de
Super Hexagon) sont également cités : déjà deux nouveaux projets sur le feu. l’interview malgré un emploi du temps chargé.

36 | Canard PC
MENU MAXI BEST-OF
On a beaucoup parlé du monsieur mais finalement peu de ses jeux. Voici
une petite sélection totalement subjective,piochée sur le site de Locomalito.

Maldita Castilla - 2012


On en parle beaucoup dans ce dossier
et pour cause : Maldita Castilla est
l’œuvre la plus connue de Locomalito.
Dans cet hommage appuyé à Ghosts’n
Goblins, on incarne Don Ramiro,
chargé de repousser les forces du
mal qui s’attaquent au Royaume de
Castille. Avec son ambiance sombre
mais cartoonesque, le titre jouit d’une
ambiance très particulière, mais c’est
surtout son gameplay réglé comme du
papier à musique qui le fera connaître,
jetant un joli coup de projecteur sur son
développeur.

The Curse of Issyos - 2015


Dernier projet en date pour Juan Vilchez, The Curse
Hydorah - 2010
of Issyos vous propose de revisiter la Grèce antique
Vous avez englouti un
de Jason et les Argonautes, avec ses squelettes
nombre indécent d’heures
épéistes et ses manticores fantasmagoriques.
(et de pièces de monnaie)
{±ŸĵŅĜĹŸÚĜþÏĜĬåŧƚåŸåŸÏŅĬĬìčƚåŸØĬåƋĜƋųåųåŸƋå
dans les bornes de Gradius
tout à fait abordable pour les joueurs patients et
ou R-Type quand vous étiez
méticuleux, qui y trouveront une vraie-fausse suite à
gamin ? Alors Hydorah
des jeux des années 1980 comme Rygar ou Rastan.
est sûrement fait pour
vous. Ce shoot horizontal
ÚĜþÏĜĬåĵ±ĜŸü±ĹƋ±ŸƋĜŧƚå
possède une grosse
quinzaine de niveaux à choisir de
manière non linéaire, généralement
ponctués par des combats de
boss bien ardus. Joli, maniable et
accompagné par une fantastique
BO de Gryzor87, Hydorah est une
petite perle.

8-bit Killer - 2008


Quatre années avant que
Vlambeer ne foute la honte à
tous les FPS de sa génération
avec Gun Godz, Locomalito
sortait 8-bit Killer. Dans
ce petit Doom-like sans L’Abbaye des Morts - 2010
prétention, Vilchez a tenté Développé en quelques nuits pendant des vacances
de transposer à la première dans le Languedoc (véridique), L’Abbaye des Morts
personne le rythme des retrace l’histoire tragique du massacre des Cathares
run and gun de l’époque par l’église catholique au XIIIe siècle et l’utilise
comme Contra ou Bionic comme cadre pour un titre à la Jet Set Willy. Des
Commando. Le résultat est graphismes qui sentent bon le ZX Spectrum, un
assez étonnant, avec des gameplay comme on n’en fait plus depuis vingt
déplacements rapides et des ans... L’Abbaye des Morts n’est peut-être pas le
combats assez lents. Une plus jouable du lot, mais sa personnalité en fait un
chouette curiosité. excellent représentant de l’esprit Locomalito.

Canard PC | 37
PLUME PUDDING AU COIN DU JEU

Au coin du jeu
Fleur, Antonin
et les jeux vidéo
Quels rapports entre Fleur Pellerin, ex-ministre
française de la Culture, et Antonin Scalia, juge de la
(SYVWYTV´QIHIW“XEXW9RMWV³GIQQIRXH³G³H³c$
Pas énormément à vrai dire, sinon que j’ai envie
HIQƶIRWIVZMVTSYVMPPYWXVIVPIWVETTSVXWHMǽGMPIW
et parfois paradoxaux que la société politique
entretient avec les objets culturels.

par Ivan Le Fou

C
’est un article du journal Le Parisien qui nous pas dire franchement réactionnaire lorsqu’il pre-
l’a appris après son éviction du ministère de nait position sur l’avortement, le port d’armes ou
la Culture : Fleur Pellerin était surnommée les droits des homosexuels. Mais contrairement
« ministre des jeux vidéo », péjorativement bien sûr. à ce qu’on pourrait penser, une telle personnali-
Fidèles à la traditionnelle philosophie des défen- té ne représenta pas l’allié espéré par les hommes
seurs d’une citadelle qu’ils imaginent perpétuel- politiques qui menèrent une guérilla morale et
lement assiégée, les acteurs du jeu vidéo s’en sont sanitaire contre les jeux vidéo dits « violents »
automatiquement émus. En première ligne, le très entre 2005 et 2010. L’ESA (Entertainment Soft-
éruptif patron de Focus Home Interactive, Cédric T ibl
Terrible ware Association, lobby américain du jeu vidéo)
Lagarrigue, y est allé d’un classe « bande de nazes ». position qui nous a rappelé que le juge Scalia fut au contraire
Les représentants des syndicats SNJV (développeurs un artisan déterminant dans le jugement de 2011
français) et SELL (éditeurs) ont déploré le « mépris consiste à qui accorda au jeu vidéo la protection du premier
de certains défenseurs de la Culture avec un grand répondre amendement de la Constitution concernant la li-
C » et appuyé leurs remerciements à l’ex-ministre berté d’expression.
(« #MerciFleur », vraiment ?). « Je crée des Était-il pour autant un amateur de jeu vidéo ?
Curieusement, alors que de toute évidence, emplois » Fichtre non. S’est-il préoccupé, sous prétexte de
« ministre des jeux vidéo » est l’expression claire d’un la matière qu’il examinait, de goût, de morale, ou
mépris intellectuel (teinté probablement – vu notre lorsqu’on des rapports entre l’Art et la Marchandise ? Point
classe politique – de mépris social et génération- du tout, seulement du droit et de la Constitution.
nel, mais cette pure hypothèse n’engage que moi),
vous taxe On pourrait souhaiter de la même manière que la
les arguments des défenseurs furent exclusivement indirectement priorité d’un(e) ministre concerne l’administration
économiques : « créateur d’emploi et de croissance », et la réglementation.
« aider cette industrie à rester compétitive », « plus
de médiocrité Pour autant, est-ce qu’une ministre qui se ridi-
rapide développement à l’international »… Terrible intellectuelle. culise à la télévision en démontrant qu’elle ne sait
position qui consiste à répondre « Je crée des em- se servir ni de son téléphone ni de sa télévision, est
plois » lorsqu’on vous taxe indirectement de médio-- une bonne ministre pour l’industrie culturelle  ?
crité intellectuelle. Défendre le jeu vidéo de cettee Probablement pas. Inversement exiger d’un(e)
façon revient à jouer une fois de plus le match trèss ministre qu’il ou elle – à force de fiches et d’assis-
français de l’industrie culturelle contre l’Art, commee tants – fasse semblant d’avoir lu tous les livres et vu
une caricature biaisée des débats aussi ancestraux x tous les spectacles, rend-il service aux majuscules
qu’absurdes qui hantent ce ministère : théâtre privéé de l’Art et de la Culture ? On peut en douter.
contre théâtre public, multiplexe contre cinéma-- « Lire Dante, a écrit Antonin Scalia, est sans
thèque, etc. aucun doute plus édifiant culturellement et intellec-
« Et Antonin Scalia dans tout ça ? », me demanderez-- tuellement que jouer à Mortal Kombat, mais ces dif-
vous. Ce juge, nommé il y a trente ans par Reagan ett fférences intellectuelles et culturelles n’ont pas valeur
champion depuis d’une interprétation très restric-- constitutionnelle. » Il est sans doute encore un peu
tive de la Constitution des États-Unis, était consi-- optimiste d’espérer qu’elles n’aient pas valeur minis-
déré comme extrêmement conservateur, pour nee térielle non plus.

38 | Canard PC
Pour 1 an d’abonnement à

; Des News
économisez jusqu’à 25 % ; Des Tests
; Des Previews
; Des Dossiers

ABONNEZ-VOUS en ligne sur notre site CANARDPC.COM


 
BULLETIN D’ABONNEMENT (France métropolitaine)
À retourner dans une enveloppe affranchie, accompagné d’un chèque libellé en euros à l’ordre de Presse Non-Stop, à l’adresse suivante :
PRESSE NON-STOP, ABONNEMENTS, BAL 62, 14 RUE SOLEILLET, 75020 PARIS

OUI je m’abonne pour 6 mois, Nom et Prénom ou Raison Sociale


au tarif deȏȴȍȉǘ
Pseudo (obligatoire)
OUI je m’abonne pour 1 an,
au tarif de Ȯȁǘ N° d’appartement ou de boîte aux lettres - Étage - Couloir - Escalier - Service
OUI je m’abonne pour 2 ans,
au tarif de Ȧȏȟǘ Entrée - Tour - Immeuble - Bâtiment - Résidence - Zone industrielle

Je joins mon règlement par chèque N° Type et nom de voie (ex. : avenue des fleurs)
en euros à l’ordre de Presse Non-Stop.
Mentions spéciales de distribution et n° (BP, TSA, …) ou Lieu-dit
Pour tout paiement par carte bancaire, ou pour
l’étranger, merci de passer par notre site :
boutique.pressenonstop.com/abonnements Code Postal Localité de destination ou Bureau distributeur cedex ou Cedex

Date et signature obligatoires : Téléphone

@
E-mail (obligatoire pour les relances abonnement)

:IYMPPI^GSQTXIVYRQMRMQYQHIWIQEMRIWEZERXPEV³GITXMSRHYTVIQMIVRYQ³VS4ǺVIWZEPEFPIWNYWUYƶEYQEVW
(SRJSVQ³QIRXªPEPSM.RJSVQEXMUYIIX1MFIVX³WHYNERZMIVZSYWHMWTSWI^HƶYRHVSMXHƶEGG²WIXHIVIGXMǻGEXMSRHIWHSRR³IWZSYWGSRGIVRERXIR³GVMZERXªRSXVIWM²KIWSGMEP
5SYVXSYXVIRWIMKRIQIRXSYTVSFP²QIFSYXMUYI%TVIWWIRSRWXSTJV
PLUME PUDDING CABINET DE CURIOSITÉS

Cabinet de
curiosités
Les vies dansent
PA R M A R I A K A L A S H

Dans le grand exercice de défrichage qui m’occupe ici chaque


quinzaine, les moments de vaches maigres alternent avec les
périodes de vache grasse. Parfois je joue à deux cents jeux et mes
yeux saignent, parfois j’ai des listes d’attente et je ne parviens pas
à choisir. Et parfois ils surgissent. Je ne peux alors rien faire.

 Olav & the lute


Le luth final

A Normal Genre : Je suis à peu près certaine

Lost Phone
aventure de n’avoir jamais parlé de
)³ZIPSTTIYVc
Shelly Alon Olav & the lute (si c’est le
Allô, maman, bobo (Allemagne) cas, merci de contacter
Site web : un neuropsychiatre et de
Genre : Her Story téléphonique cpc.cx/eQL
faire évaluer l’état de ma
)³ZIPSTTIYVWcElizabeth Maler, Rafael
Martinez-Jausoro, Estellation, Dimitri
mémoire). Alors que je
Landais (France) suis certaine d’y avoir joué, au moins
Site web : cpc.cx/eQK deux fois maintenant, et d’avoir chaque
fois passé un bon moment en compagnie
de ce petit bonhomme qui se promène
Il y a des gens qui ont tout à l’envers (je ne suis pas certaine que ce
compris. Une idée simple, efficace, ne soit pas un bug). Olav tombe dans
clairement énoncée, c’est déjà la une grotte étrange, il y trouve un luth et
moitié du travail de fait. « Vous une sorte de métier à tisser gigantesque.
venez de trouver un téléphone. Il se met alors en tête de remettre ce
Découvrez la vérité. » Pour peu dernier en état de fonctionnement, des
que la réalisation soit à la hauteur fois que ça lui permette de dé-tomber
de ces prémisses, on est bon… dérouler le fil de l’histoire de de la grotte. Le voilà donc parti le petit
et divulgachâge : c’est le cas. Sam, à la recherche d’indices, Olav, à l’aide de votre souris, le luth à la
Vous venez donc de découvrir le dispersés dans les messages, les main, à travers la caverne. Le luth vous
téléphone de Sam. Vous faites ce dossiers et les applications. Alors permet de composer de petites mélodies.
que n’importe qui ferait dans la si on veut chercher la petite bête, Et certaines mélodies, oh surprise,
même situation : vous regardez non, les énigmes ne sont pas bien ont un effet. Et jouées à l’envers, elles
les derniers messages, histoire de compliquées, l’histoire un peu produisent l’effet inverse. Un peu comme
savoir qui appeler pour signaler téléphonée, les SMS un peu trop si un enregistrement de Un-Break My
votre rencontre avec l’objet (en proprets pour des textos d’ados. Heart de Tony Braxton passé à l’envers
tout cas c’est comme ça que je l’ai Mais malgré les contraintes et en soirée avait le pouvoir de doper les
roleplayé). Mais là, les SMS vous le temps limité dans lequel il a ventes de mouchoirs en papier. Bref,
apprennent un truc : le propriétaire été conçu, A Normal Lost Phone c’est très mignon, ça prend 20 minutes
de l’ordiphone a disparu depuis parvient à se montrer captivant, à tout casser, ça stimule les envies de
quelques heures. En pleine fête extrêmement touchant par beauté et d’harmonie totale, il n’y a
d’anniversaire. Vous allez donc moments et cohérent. donc pas de raison de s’en priver.

40 | Canard PC
QUE SONT-ILS PAS DEVENUS ? PLUME PUDDING
Dans « Que sont-ils pas devenus ? », Canard PC prend le pouls
des jeux en cours de développement et leur met des petits
coups de bâton dans les côtes pour voir s’ils bougent encore.

QUE SONT-ILS
PAS DEVENUS ?
par ackboo et Guy Moquette

Do Starve
Don’t
Together
Tog
Développeur :
Déve
Klei Entertainment
E (Canada)
Statut
Statu : ±EZEQIVGMIXZSYWc$
Aper pour la dernière fois :
Aperçu
Cana PC no 309
Canard

Il n’y a plus de jeunesse, ma bonne DST a connu pas mal d’améliorations


dame. Regardez le jeune Don’t Starve : (de l’équilibrage pour s’adapter aux HEARTS OF IRON IV
à peine quatre ans et déjà papa de contraintes multijoueurs pour l’es-
deux rejetons. Shipwrecked, le petit sentiel, la personnalisation des per- )³ZIPSTTIYVc Tout le monde parle beaucoup de
dernier, a fait l’objet d’un article dans sonnages…) et de l’ajout de contenu, Paradox (Suède) Stellaris, le 4X spatial que Paradox
le numéro 330 alors on l’oublie pour le en partie héritée du DLC du jeu de Statut : Interactive est en train de bâtir
moment pour mieux s’intéresser à son base Reign of Giants  : les quatre sai- en bêta privée sur les fondations de l’excellent
aîné, Together. Plus d’un an s’est écou- sons – qui apportent une vraie varié- Aperçu pour Crusader Kings 2. À tel point qu’on
lé depuis que Maria Kalash a évoqué té dans les manières de mourir dans la dernière fois :en finirait par oublier que le studio
cette excroissance multijoueur du d’atroces souffrances –, les zones sou- Canard PC no 313 suédois bosse aussi sur un autre
titre de Klei, vendu en stand-alone terraines ou la possibilité de dompter titre majeur, Hearts of Iron IV. Et
(offert aux joueurs qui avaient acheté et monter des beefalos. que ce wargame 1939-45 planétaire devrait sortir
le jeu original auparavant, il faut tout Don’t Starve Together est en tout cas en 2016, contrairement au très lointain Stellaris…
de même le noter) et en accès antici- aujourd’hui dans un état qui mérite- La dernière fois que nous avons tripoté Hearts of
pé sur Steam. On ne peut pas dire que rait un «  Sans Danger, foncez, c’est Iron IV, c’était début 2015 à l’occasion d’une visite
le projet a été nourri aux hormones trop de la balle » dans la rubrique « En dans les studios. Depuis, les nouvelles se font rares.
de taureau transgénique depuis tout Chantier » et il n’y aurait rien à redire Johan Andersson, le grand manitou du game de-
ce temps, mais il avance. « Doucement si le studio décrétait demain qu’il est sign chez Paradox, continue de poster sur Internet
mais sûrement ! », comme disait tout le terminé. Fait rare : on n’est finalement ses carnets de développement, abordant des sujets
temps ma mamie, dont je n’ai jamais pas si pressé de le voir quitter la sec- tels que la gestion des plans de bataille (ils seront
vraiment su si elle parlait de la cuis- tion accès anticipé de Steam des fois beaucoup, beaucoup mieux faits que dans Hearts
son au four du poulet dominical ou que ses développeurs se piquent d’en of Iron III) ou encore l’industrie, qui a d’ailleurs été
de son trajet vers le caveau familial. étoffer encore le contenu. entièrement repensée début 2016 pour des raisons
d’équilibrage.
Car le jeu, malgré une sortie prévue à l’origine pour
la fin 2015, est toujours en phase de cuisson à feu
vif. Une bêta fermée a démarré en février et devrait
durer plusieurs mois. La presse n’y a pas accès, ce
qui me donne envie de rouler sur la Suède avec trois
divisions de Panzer. Et l’éditeur n’annonce toujours
pas de sortie officielle (il se contente d’un « courant
2016 »). Ce n’est pas forcément une mauvaise nou-
velle. D’une part, les intoxiqués des jeux Paradox ont
encore de quoi s’occuper avec Crusader Kings 2 et
Europa Universalis 4 – les derniers gros DLC pour
ces jeux datent d’il y a seulement quelques semaines.
D’autre part, le précédent Hearts of Iron était sorti
dans un état déplorable, alors on ne va pas reprocher
à Paradox de bien prendre son temps pour nous dé-
buguer correctement ce nouvel épisode.

Canard PC | 41
PLUME PUDDING AUTOPSIE

Autopsie Dans Autopsie, Canard PCųåƴĜåĹƋŸƚųĬŲĘĜŸƋŅĜųåŠĜĹšÏŅĹĹƚåÚŲƚĹƤģåƚÏæĬìÆųåţ

&YNSYVHƶLYM:EPZIF³R³ǻGMIHIWSTMRMSRWJEZSVEFPIW

Half-Life 2 HƶYRIFSRRITEVXMIHIWNSYIYVW5(6YIPUYIWNIY\
GYPXIYRIFSYXMUYIFMIRJSYVRMIVIQTPMIHITIXMXW
TVM\YRISYHIY\P³KIRHIWJE±SRnGLI^:EPZIMPcRƶ]cE
MENSONGES ET PIPEAUTAGES TEWHIQEREKIV~IXZSMPªYRIFSRRIV³TYXEXMSR
HIJEMXI2EMWMPRƶIRETEWXSYNSYVW³X³EMRWM
CHEZ VALVE SOFTWARE par Netsabes

N
ous sommes au printemps 2003. Valve Software, une petite
boîte de Seattle fondée par des anciens de Microsoft, n’a rien
sorti depuis Half-Life, en 1998. Les deux extensions, Opposing
Force et Blue Shift, ont été développées par le tout jeune studio texan
Gearbox Software (fondé par des anciens de 3D Realms), et sur ce
que la jeune génération appelle « les forums web » – certains osent
dire qu’elles étaient meilleures que l’original. Au fil des ans, Valve n’a
fait que récupérer des équipes de mods célèbres : le Team Fortress de
Quake, devenu Team Fortress Classic une fois repackagé dans le moteur
de Half-Life (lui-même dérivé de celui de Quake), puis les créateurs
de l’ultra-populaire Counter-Strike, ceux de Day of Defeat… Valve les
republie, les améliore, les booste, mais ne semble plus rien produire
d’original. À l’époque, le studio est surtout connu pour les déboires de
ses deux projets suivants, Team Fortress 2 et Counter-Strike : Condition
Zero, une nouvelle version du mod multi, avec cette fois du solo en
plus. Les deux ont à ce moment des allures de vaporware : TF2 a
été aperçu pour la dernière fois en 1999, tandis que CSCZ a chan-
gé maintes fois de développeur. Débuté chez Rogue Entertainment
en 2000, il est ensuite brièvement passé par Valve, puis par Gear-
box, avant d’atterrir enfin chez Ritual Entertainment et Turtle Rock
Studios, vous parlez d’un bazar. Bref, Valve n’a pas la cote.

Pied de nez ou pied de biche ? Et pourtant, quand, en avril 2003,


les premières rumeurs de Half-Life 2 commencent à pointer le bout
de leur nez, immédiatement les esprits s’échauffent. Tout d’un coup,
tout le monde attend HL2 et rappelle que, du temps de Half-Life, les
FPS c’était quand même autre chose, en répétant en boucle les mêmes
anecdotes sur l’IA des soldats et en occultant évidemment la dernière
partie du jeu, sur Xen. Maîtrisant parfaitement sa communication,
Valve dévoile fin avril le retour de Gordon Freeman et annonce
même une date : le 30 septembre 2003, même pas six mois plus tard !
En mai, on a droit aux premières vidéos, très brèves, et en juillet, le

42 | Canard PC
Comme toutes les images de ces pages, ce screenshot
åŸƋĬűƚĹÚåŸŞųåĵĜåųŸÚĜŸƋųĜÆƚæŸޱųš±ĬƴåţŅĹØĜĬ
manquait peut-être une ou deux textures sur les murs
åƋŅĹæƋ±ĜƋ±ĬŅųŸºŧƚ±ƋųåĵŅĜŸÚåĬ±ŸŅųƋĜå±ĹĹŅĹÏæåţţţ

public peut découvrir ce qu’a vu la presse à Durant les semaines suivantes, a alors lieu Retour à la normale. Bien sûr, ça n’a
l’E3. Cette longue vidéo était notable pour un ballet assez absurde entre les services pas duré. Half-Life 2 a fini par sortir, plus
deux raisons. La première, c’est qu’elle était de communication de Vivendi Universal d’un an plus tard, en novembre 2004 (un
initialement distribuée uniquement sur Games (« mais si c’est repoussé ») et ceux de jeu bien plus classique que ce qu’annon-
Steam, qui vivait alors ses premiers jours, Valve (« mais non »). Par exemple, le 8 août, çaient les vidéos de 2003), de même que
et qu’elle permettait donc à Valve de tester l’éditeur annonce une sortie pour le 13 no- Counter-Strike : Condition Zero (en mars
son système de distribution de contenu (pas vembre 2003, tandis que le 27 août, Valve 2004). Vivendi Universal Games et Valve
fou, Valve avait tout de même coupé la vi- (qui, forcément, paraît de moins en cré- ont violemment rompu peu après, le FBI a
déo en quatre fichiers répartis sur plusieurs dible) maintient une sortie pour le 30 sep- réussi à arrêter le hacker de Gabe Newell
jours, pour être sûr que le système tienne la tembre. (un Allemand de 19 ans qui, au tribunal, n’a
charge). La seconde, c’est qu’elle était inté- écopé que d’une tape sur les doigts), Steam
gralement pipeautée. Le grand vol du code source. Le 20 sep- est sorti et petit à petit, l’entreprise de Gabe
tembre, soit dix jours avant la sortie, Valve Newell a refait sa réputation et surtout
Les promesses de Source. Alors oui, les confirme une nouvelle fois son intention de sa fortune. Ils ont même fini par mettre
éditeurs qui font n’importe quoi avec leurs tenir cette date et donne même des détails en ligne Team Fortress 2, en même temps
démos E3, ce n’est pas très original ; après sur le téléchargement via Steam. De son que Half-Life 2 : Episode Two, la dernière
tout c’est du marketing, tous les coups ou côté, Vivendi Universal Games évoque un
presque sont permis. N’empêche, Valve vague « début 2004 »… Et puis paf, trois
avait poussé très loin le bouchon, montrant jours plus tard, Valve se rend : Half-Life 2
des séquences entières « jouées » durant est bel et bien repoussé, mais promis, il
plusieurs minutes. Aucune n’avait au final sortira pour Noël, quoi qu’en dise leur
été intégrée et la plupart présentaient des éditeur ! Sauf que l’affaire est un peu plus
choses impossibles à réaliser dans le jeu. compliquée : une semaine plus tard, Gabe
Comme l’IA des soldats avait l’air maligne Newell annonce que son Outlook a été pi-
dans la démo ! Et le moteur physique qui raté début septembre et on découvre vite
permettait de bloquer une porte avec des que c’est tout le réseau de Valve qui a été
objets (porte que les IA explosaient en- infecté. La preuve : un hacker balance sur le
suite), ça ouvrait tant de possibilités  ! Net le code-source de Half-Life 2… qui per-
Encore aujourd’hui, la vidéo vaut le coup met aux plus téméraires de constater que
d’œil tant elle pue le foutage de gueule, for- le jeu est bien loin d’être terminé. Qu’im-
cément volontaire puisque à l’époque, Valve porte : désormais, dans la communication
affirmait à qui voulait l’entendre que Half- de Valve, le retard de Half-Life 2 est imputé
Life 2, c’était pour dans deux mois. Et pour- au piratage, et qu’importe s’il n’avait pas
tant, fin juillet, comme une fleur, Vivendi la moindre chance de sortir en 2003. En
Universal Games1, l’éditeur de Valve, an- réalité, en interne, Newell savait dès juillet,
nonce que Half-Life 2 ne sortira pas à la avant même la publication des vidéos du aventure de Gordon Freeman, fin 2007.
date du 30 septembre initialement prévue. jeu, qu’il ne pourrait pas tenir ses engage- Leur dernier jeu solo, Portal 2, remonte à
« First time I’ve heard about it », me dit Gabe ments. Ça ne l’a pas empêché de mentir par cinq ans, et Valve, désormais, préfère les
Newell (du temps où il répondait encore la suite, jusqu’à enfin trouver une excuse très rentables « services en ligne » (Dota 2,
à mes e-mails), qui nie donc tout retard. passable, bien que complètement hors- Counter-Strike, Team Fortress 2) aux jeux
sujet. Ajoutez à cela les retards perpétuels vidéo solo à la durée de vie limitée. Quant à
de Counter-Strike : Condition Zero et de Half-Life 3, il reste (et risque de rester) aux
1. Vivendi Universal Games, qui englobait Sierra Team Fortress 2, et Valve, après avoir fait abonnés absents : maintenant que Valve a
et Blizzard, a plus tard été englouti par Activision, rêver quelques mois les joueurs, passe de trouvé la façon de toujours satisfaire ses
et n’a donc aucun rapport avec le Vivendi qui nouveau pour une bande de bras cassés qui clients, il ne peut plus prendre le risque de
tente aujourd’hui de boulotter Ubisoft. a eu de la chance et qui sait recruter. les décevoir.

Canard PC | 43
PAR KAHN LUSTH
PLUME
PLUM
PLUME
E PUDDING
PUDD
PUDDIN
ING

NEWS
ONLINE
La leçon
du jour
Potins de Chambre

James Harding est un ancien joueur pro qui a profité de l’explosion du sur Reddit par Gabe Newell, expliquant que « James est un âne » avec
streaming (un mort et huit blessés, tout de même) pour se reconvertir en qui Valve ne souhaitait plus travailler et que son retour s’expliquait par
commentateur officiel de Dota 2. Connu pour son côté pince-sans-rire le fait que certains employés avaient lourdement milité en sa faveur.
so british, Harding a cessé de travailler pour Valve en 2015, avant de faire Puis Gabe a précisé que 2GD (la boîte de production de Harding) était
son grand retour à l’occasion d’un tournoi de Dota 2, appelé Shanghai également renvoyée du Shanghai Major, probablement pour l’incompé-
Major. Plutôt rapide, le retour s’est terminé après une journée et demie tence dont ils ont fait preuve. De son côté, Harding s’est bien entendu
de boulot, puisque le commentateur s’est fait virer avec pertes et fracas. défendu des accusations en expliquant que son licenciement découlait
Du côté des spectateurs, on aura surtout noté une production bancale à d’une absence d’atomes crochus avec l’employé de Valve qui encadrait
base de caméras laissées à l’abandon et de plantages de flux, pendant ce tournoi. Il semblerait donc que la firme de Bellevue souhaite donner
que Harding s’évertuait à blaguer sur le fait qu’il ne sait « désormais plus une certaine « respectabilité » à ses shows e-sport, à tel point que les
rien au sujet de Dota 2 ». Finalement, des explications ont été apportées sales gosses n’y auraient désormais plus leur place.

En vrac
Robe Grise / Grise Robe

Exclusif, moins 10 % sur le trop cher Colin Johanson vient de


quitter ArenaNet. Pour ceux
qui ne le connaissent pas, cet
homme officiait en tant que
I l y a peu, les joueurs de Black Desert étaient devenus fous furieux. La raison ?
« Les salopards de Daum ont osé ajouter un cash shop sur leur jeu et tant pis si
bien d’autres l’ont fait avant, ce sont eux qu’on va pendre sur la place publique. » D’un autre côté,
réalisateur de Guild Wars 2
et désormais, son poste sera
beaucoup se sont notamment plaint – à juste titre – des prix pratiqués, puisqu’il est possible repris par Mike O’Brien, le
d’obtenir un costume et une skin d’arme pour la modique somme de 32 dollars. Non, je n’ai pas patron du studio.
oublié la moindre virgule dans ce prix. Toujours est-il que Daum, qui se disait « être à l’écoute »
des retours, vient de passer à l’action en baissant le prix des fameux ensembles à… 29 dollars. Après 14 ans de bons et
C’est tout fier que le studio annonce ainsi une baisse générale de 10 % sur les cosmétiques en loyaux services, le pan
vente dans sa boutique. À titre purement personnel, je prédis donc que la colère des joueurs sera console de Final Fantasy XI
diminuée d’environ 10 %. sera mis à mort le 31 mars.
Selon les dernières volontés
du condamné, une cérémonie
sera tenue en son honneur,
The Elder Scrolls Online présidée par des soubrettes
équipées d’épées géantes.
Phase une : le déni
Parce que le Temple du
P arfois, il suffit d’un simple article pour qu’un petit bonhomme vienne danser
dans votre tête en criant « J’avais raison ! J’avais raison ! ». Aujourd’hui, ce qui
rend ce petit bonhomme si heureux est une longue interview de Matt Firor par le
Mal Élémentaire ne
permet pas d’ancrer
site Metro.co.uk. Enfin, l’échange aura surtout été long pour le réalisateur de The Elder Scrolls Online, qui suffisamment
dit sans pouffer que le succès du jeu « est un peu passé sous les radars ». Puis, toujours sans éclater de rire, Neverwinter dans le
Matt la Déconne affirme que son titre n’est pas un MMO en livrant de véritables contre-sens comme : fan service, Cryptic vient
« ESO n’est pas vraiment un MMO traditionnel et nous n’utilisons pas vraiment ce terme au bureau. C’est d’annoncer qu’Icewind Dale
d’ailleurs ce qui le distingue des autres jeux. Si vous voulez jouer en solo, comme vous l’avez fait avec les autres y fera son apparition vers
jeux Elder Scrolls, vous pouvez le faire. Si vous voulez jouer d’une manière super grindesque avec des donjons et l’automne prochain. D’après
des boss à tuer en groupe, vous pouvez vous réunir avec d’autres joueurs et le faire aussi. » Surtout, que personne mes calculs, ça nous laisse
ne lui parle de Guild Wars 2 ou Star Wars : The Old Republic. Ça pourrait lui faire un choc. Baldur’s Gate pour l’été
2017.

44 | Canard PC
Chez pépé
En vrac
Toi, tu vas avoir des problèmes Chose promise,
chose due, Camelot
Unchained vient
d’embaucher
A ussi surprenant que cela puisse paraître, Ultima
Online continue d’exister, à tel point que ses
développeurs viennent d’annoncer un événement
93 vers le début de l’été avec plein de contenu, pour
que vos aventures en Britannia restent intéressantes,
ainsi que quelques modifications de confort que
de nouveaux
développeurs, après
qui prendra la forme d’une invasion de Myrmidex. nous n’avons pas pu inclure dans la mise à jour 92 et avoir passé son stretch
Un nom bien étrange qui cache des bêtes à l’aspect surtout, une boutique très attendue qui permettra de goal « Envoyez plus de
d’insectes, avec d’énormes mandibules qui… ouais, rendre l’acquisition de vos objets favoris plus facile développeurs ! ». La
bon, tout le monde s’en fout. Le plus surprenant que jamais ! » Ah, je crois que les joueurs de Black prochaine étape, située
reste sans doute le discours qui accompagne la Desert viennent de tous tourner la tête en direction 125 000 dollars plus loin,
nouvelle et dessine la prochaine mise à jour du d’Ultima Online. Ben là mon gars, il est trop tard permettra l’ajout de
jeu : « Notre objectif est de publier la mise à jour pour demander pardon. nouvelles animations.

Chez les cols blancs


Coup de
dur chez
Soupirer n’est pas jouer
les mous

L a gamification est un terme qui est presque entré


dans le langage courant, tant tout le monde voit
cette pratique comme l’outil qui devrait bientôt
supplanter les cartes de fidélité toutes pourries.
Conan PC Et non, je ne dis pas ça parce que j’en ai marre de
voir la caissière insister à chacun de mes passages,

D écidément, utiliser la
licence Conan semble
être une piste parfaite
lorsque je lui explique avec des mots gentils que
je ne veux pas de sa merdouille en plastique, juste
bonne à pister mes achats. Quoi qu’il en soit, Arc
pour se remplir les poches (le Steam de Perfect World) vient de découvrir
à bon compte. Après un à son tour les bienfaits de la gamification en
jeu de société produit par incorporant un système de quêtes journalières,
Monolith qui a empoché associé à des récompenses. Concrètement, le
plus de trois millions, c’est logiciel vous propose des trucs comme « jouer
au tour de Modiphius de à Royal Quest » ou « se connecter à Arc pendant
proposer un jeu de rôle huit jours consécutifs » afin d’obtenir des points
papier, issu du même d’expérience. Puis, lorsque votre attitude servile
univers. Et si je vous parle vous permet de passer un niveau, le jeu logiciel
de tout ça, c’est parce que vous récompense avec 500 points Arc qui
ses créateurs semblent pourront être échangés contre les monnaies
prêts à bouffer à tous les de singe de n’importe quel autre logiciel jeu de
râteliers, au point d’être l’éditeur. Bordel, je m’amuse tellement que je
entrés en partenariat avec n’arrive même plus à discerner le jeu du logiciel.
Funcom. L’intérêt ? Créer Bravo messieurs-dames, il ne manque plus que des
un guide supplémentaire prix calés sous les seuils psychologiques pour que
qui sera entièrement dédié je vous fasse don de mes organes.
au MMORPG, permettant
aux amateurs de D20
de retrouver des lieux En vrac
emblématiques d’Age of Suite au rachat de Darkfall par Big Comme quoi, regarder les publicités
Conan comme Tortage, Picture Games, le jeu sera rebooté et peut avoir du bon, puisque les lecteurs
mais aussi des PNJ et bien verra la mention « Rise of Agon » s’accoler d’IGN ont vu passer un bandeau expliquant
sûr, l’équipement que l’on à son nom. Pour le moment, nul ne sait si qu’Overwatch agrandit les pénis et sortira
chasse dans le tréfonds cela affectera la version actuelle du jeu ou le 24 mai prochain. Oh et, bien entendu, tous
de ses donjons. Toutefois, si un nouveau titre existera à ses côtés. les médecins le détestent.
rien ne dit qu’à l’image du
jeu vidéo, le jeu de rôle
Une manifestation de Paladins en colère, une assemblée générale de copropriétaires
permettra de faire enfler
le tour de poitrine de nos inquiets au sujet du housing ou une fête qui tourne mal sur votre MMORPG ? Envoyez
personnages en payant un vos screenshots et explications à clicclac @ canardpc.com et gagnez la possibilité
peu plus. d’avoir la chance d’être choisi pour possiblement apparaître dans les News Online.

Canard PC | 45
A A venir

Kingdom Come :
Deliverance
Un jour, mon royaume viendra
Par Kahn Lusth

46 | Canard PC
À VENIR PC

En anglais, « kingdom come » est et son framerate est des plus instable, mais
une expression qui désigne l'arrivée il est impossible de nier que Warhorse
du règne ou encore l'heure de gloire. réalise un travail d’orfèvre en modélisant
En bref, un moment où l'on peut se tout le territoire à la main. Oui, même les
la péter à 300 km/h sous prétexte arbres ont été posés avec amour par des
d'avoir réussi un truc important. Et ce développeurs qui doivent certainement
titre est loin d'être choisi au hasard, lutter chaque jour contre la dépression.
puisque le jeu raconte l'histoire d'un Et le résultat est là, puisque du plus
ǻPWHIJSVKIVSRUYMEXSYXTIVHYHERW petit des chemins à la plus vaste des
une guerre, en plus d'être développé forêts, Deliverance respire déjà la vie et
par des gens qui ont déjà levé près l'envie de courir tout nu dans les prés.
de trois millions de dollars, grâce à la Genre : RPG Dans de telles conditions, on comprend
QEKMIHYǻRERGIQIRXTEVXMGMTEXMJ )³ZIPSTTIYV³HMXIYVc mieux pourquoi le jeu s'étoffera au fil
Warhorse Studios des épisodes et démarrera sur un terrain
(République tchèque) d'une quinzaine de kilomètres carrés.

C
Plateformes : S'agit-il du bon pari ? Seul le test pourra
'est à l'occasion d'une bêta qui {ƤœĜĹÚŅƵŸåƋXĜĹƚƻØ nous le confirmer mais, en attendant,
doit être entre les mains des £ÆŅƻkĹåØ{„ĉ je ne compte plus les « Ooooooh ! »
généreux « donateurs » à l'heure Sortie prévue : 2016 et les « Aaaaaaah ! » que la rédac a
où vous lisez ce magazine, que
Warhorse a souhaité nous rencontrer. Plus
précisément, ce serrage de pognes était
surtout un prétexte pour faire le point
sur les avancées du titre, avant de nous
filer un accès anticipé à la fameuse bêta
pour que l'on puisse y jouer chez nous,
comme des princes et des dandys. Pour
faire simple, Kingdom Come : Deliverance
sera le premier épisode d'une série de jeux
de rôle en monde ouvert qui relatera une
seule et même histoire, depuis le pétage
de plombs d'un souverain jusqu'à notre
hypothétique vengeance, en guise de
bouquet final. Ici, c'est donc en bouseux
que le joueur commence cette bêta, à la
recherche de bandits qui ont mis un village
voisin à sac comme de gros bâtards.

Warhorse réalise un
travail d’orfèvre en
modélisant tout le
territoire à la main.
1UOIQUOIDANSLESŽEFSMais avant
même de chercher ne serait-ce qu'une
pointe d'indice, il faudra tout d'abord
raccrocher sa mâchoire. Vous vous
souvenez du « Woooooow… » que vous
avez poussé, la première fois que vous êtes
sorti à l'air libre dans Oblivion ? Eh bien, ‰ųìŸÏŅĵŞĬåƋØĬŲĜĹƴåĹƋ±ĜųåÚƚ
Kingdom Come pourrait bien vous faire le ŞåųŸŅĹűčåŅýųåŎĉåĵŞĬ±ÏåĵåĹƋŸŞŅƚų
même effet, lorsque vous commencerez ĬŲæŧƚĜŞåĵåĹƋŧƚĜŸåčìųåޱųĵŅųÏå±ƚƻØ
à arpenter ses vallées. Pourtant, le soft ĵ±ĜŸæč±ĬåĵåĹƋޱųÏŅƚÏĘåŸţ
souffre encore pas mal de bugs d'affichage

Canard PC | 47
À VENIR PC DELIVERANCE

XåŸ{cI±ƚųŅĹƋĬåƚųŸ
ŞųŅŞųåŸųŅƚƋĜĹåŸţFÏĜØ
ĵ±Ú±ĵåƴ±ŞƚĜŸåų
ÚåĬŲå±ƚţ ƤĵŅĜĹŸ
ŧƚŲåĬĬåĹåŸŅĜƋ
ޱųƋĜåŞŅƚųƴĜÚåųĬå
ϱϱÚåŸŅĹčųŅŸ
ÚæčƚåƚĬ±ŸŸåÚåĵ±ųĜţ

Et manant dans ta gueule ?


Face à un PNJ récalcitrant,
le jeu peut nous proposer
entre une à quatre
méthodes de persuasion.
La première consiste à
convaincre le personnage
par les mots, en se
contentant d'un simple jet
de Discours. Plus directe,
l'Intimidation suit le même poussés, après s'être agglutinée derrière des bandits dont il semble faire partie.
principe en utilisant une mon écran pendant quelques minutes Pour cela, plusieurs méthodes possibles ;
éventuelle mauvaise et pendant que le jeu nous sortait une la plus évidente reste d'interroger les
réputation comme bonus, petite musique qui n'aurait pas dépareillé villageois pour comprendre ses habitudes
IRTPYWH ´XVIMRǼYIRG³ITEV dans les films de Conan le Barbare. et retrouver sa planque. Souvent généreux
notre équipement. Car c'est et entièrement doublés, les dialogues sont
bien connu : on négocie #ESTOUśROUCESTNONEt si se promener déjà bien agréables, tant pour le petit
toujours mieux avec une pourrait représenter une activité à part côté « potins locaux » qui s'en dégage
grosse épée dans les mains. entière, il ne faudrait pas oublier qu'on parfois que pour les indices qu'ils peuvent
‡cP MRZIVWI.QTVIWWMSRRIV est là pour « gifler du Suzerain », comme contenir. Résultat, il n'est pas rare de
se réserve aux gentils, on dit dans les banlieues chics à chaque passer cinq à dix minutes à discuter avec le
puisque la méthode – quasi- fois qu'un vent de révolte souffle à Les mendigot du coin qui finit par se rappeler
identique à la précédente – Républicains. Sans surprise, il faut suivre que Reeky a souvent de la sciure sur ses
utilise une bonne réputation une quête principale qui nous demande bottes et qu'il aime claquer le fessier de la
IRKYMWIHIFSRYW*RǻR ici de retrouver un certain Reeky pour lui malpropre du village. Vous savez, la fille
Soudoyer permet comme défoncer les genoux l'interroger au sujet que personne n'aime, sauf quand il faut
son nom l'indique de coucher avec elle. Or, contrairement à bien
délier les langues grâce des RPG qui pointent le moindre élément
au pouvoir de l'or. Mieux important de leur gros doigt dégueulasse,
encore, le choix d'une Kingdom Come fait dans la finesse,
bonne ou mauvaise réponse grâce à des « marqueurs intelligents »
peut apporter un bonus ou qui se contentent souvent d'indiquer
malus, indépendamment grossièrement une zone et nous laissent
de la méthode utilisée. nous débrouiller seuls, une fois sur place.
Un exemple ? Une sœur C'est agréable, bien plus immersif que la
cherche à cacher son moyenne et pourtant, toujours nécessaire
frère, ce qui nous permet puisque certains morceaux de quête
de comprendre que pourront apparaître ou disparaître, en
nc.RXMQMHIVc~EZIGYRI fonction de nos choix. À en croire les
menace de mort sera très développeurs, Reeky peut se faire trucider
probablement inutile, tandis par des bandits de passage avant qu'on
que « Impressionner » en ne le retrouve et autant vous dire que la
parlant de sa protection sera simple hypothèse d'un monde qui tourne
plus avantageux. sans nous me donne déjà la fièvre.

48 | Canard PC
ŽĹåÏĘŅŸå
åŸƋŸƞųåØĹŅƚŸ
ĹŲ±ƚųŅĹŸޱŸ
ÆåŸŅĜĹÚŲƚĹ
mod pour
ųåĹÚųåĬåŸĹƚĜƋŸ
ŞĬƚŸĹŅĜųåŸţ

Estrille, es-tu là ? Et quand vient le armure puisque les dégâts sont localisés. Et l'absence de classes et les compétences
moment de distribuer les claques, parce c'est compter sans le principe voulant qu'un qui progressent au fil de leur utilisation
que Reeky vous énerve ou qu'un malandrin coup se pare plus facilement si notre arme devraient autoriser toutes sortes de
traite votre maman de gourgandine, est déjà bien placée… à condition que notre fantaisies, du bon gros barbare au voleur
Kingdom Come se pose entre la simplicité endurance le permette encore, puisque qui se fait passer pour un noble chevalier.
d'un Elder Scrolls et le réalisme d'un Mount cette dernière s'épuise au fil des beignes Loin de réinventer la roue, ce concept
& Blade. Au corps à corps, le joueur doit et ne remonte que dans la limite fixée par s'inscrit pourtant dans une volonté
viser un ennemi que son personnage suit les points de vie restants. Sur le papier, le de créer un jeu de rôle aussi ouvert et
automatiquement du regard, puis choisir combat promet donc d'être bien pensé, organique que possible, où l'immersion
l'orientation de sa garde avec la souris. mais j'avoue nourrir encore de nombreux passe avant tout le reste. Cela explique
doutes sur son efficacité, notamment à sans doute la présence des jauges de faim
cause d'une rigidité de mouvements dont et de sommeil, contraignant à se reposer
Créer un jeu de on se passerait bien. Dommage, car même
si Warhorse affirme haut et fort que la
et se nourrir de temps à autre, sous peine
de voir nos petits nœils se fermer tout
rôle aussi ouvert baston n'est qu'un élément de gameplay
parmi tant d'autres, elle n'en reste pas
seuls. Oui, les développeurs donnent un
peu l'impression d'avoir pensé à tout et
et organique que moins importante, comme le prouve la surtout, de prendre à contre-pied tous
possible. bataille finale de cette bêta qui fout déjà la
honte aux petites escarmouches de Skyrim.
ces jeux de rôle qui gardent toujours le
petit confort du joueur en ligne de mire.
Ici, attendre quelques heures prendra du
Pour y voir plus clair, une sorte d'étoile à #HAUDLESMARAUDSEnfin, à force temps, réveiller un PNJ sans raison valable
cinq branches apparaît alors par-dessus le d'abattre sa masse sur la couenne des pourrait faire baisser notre réputation et
viseur et indique si notre arme est en haut, manants et de taquiner la gueuse (ou le se balader en pleine nuit sans une torche
à gauche, à droite ou encore plus bas sur gueux, vous faites ce que vous voulez), est pratiquement inenvisageable… un peu
les côtés. L'intérêt d'un tel système consiste le personnage finira inévitablement par comme le fait de ne pas s'impatienter, face
bien sûr à nous faire chercher la faille prendre du niveau. Ici, le système se à ce qui pourrait être une œuvre majeure
dans la garde adverse, mais aussi dans son veut aussi ouvert que possible, puisque du jeu de rôle en monde ouvert.

Canard PC | 49
À VENIR PC

TrackMania Turbo
Party pour un tour
Par ackboo

Le saviez-vous ? Les élèves qui sont en 6e Genre : qui flottent un peu partout… Il y a nettement plus
au collège aujourd’hui n’étaient pas nés cours’eud’bagnole de choses à voir en bord de piste. C’est toujours
quand le premier TrackMania est sorti. Développeur : très mignon et ça tourne à 60 FPS, du moins sur
C’était en 2003, à l’époque Pompidou était c±ÚåŅƤŠ8ų±ĹÏåš la version PlayStation 4 que nous avons essayée.
président et la télévision couleur n’existait Éditeur : Ubisoft Les deux autres environnements, Valley et Lagoon,
pas. Que de chemin parcouru depuis ! Plateformes : sont eux inédits. Valley est assez proche de Canyon,
{ƤœĜĹÚŅƵŸØ£ÆŅƻ aussi bien au niveau de l’ambiance que du pilotage,
kĹåØ{Ĭ±ƼŸƋ±ƋĜŅĹĉ là aussi très orienté drift. Lagoon est un décor de
Sortie prévue : jungle tropicale, avec une végétation luxuriante,

B
on, TrackMania, tout le monde connaît. ĀĹĵ±ųŸƖLjŎƅ des paysages de baies thaïlandaises, des porte-
Des circuits façon Hot Wheels avec containers échoués… C’est splendide et ça implique
des tracés pas possibles, dess bagnoles un pi
pilotage très spécial : la voiture est survireuse,
pression de
qui foncent à 300 km/h, une impression pas évidente
é à prendre en main quand on vient de
ues et un
vitesse folle, des sauts gigantesques jouer deux heures d’affilée sur Stadium ou Canyon.
dédain total pour les concepts de « freinage » Elle ttourne comme une dingue, avec un petit
ou de « réalisme »… La formule a fait ses rayon de braquage, et j’ai mis pas mal de temps
preuves puisque le studio françaiss Nadeo avant de commencer à maîtriser ce nouvel engin.
ues années)
(racheté par Ubisoft il y a quelques
Turbo ne
continue d’en vivre. Cet épisode Turbo Trac
Track and Field, Tony Hawk,
va rien bouleverser, il se contentee de broder Micr
MicroMachines...
sur le même thème en rajoutant une tonne Com
Comme dans n’importe quel TrackMania,
de contenu. Lisons tout de suite lee menu. l’activ
l’activité solo principale va consister à débloquer
les 20
200 nouveaux circuits du jeu en réalisant des
Deux nouveaux, deux anciens. ns. Quatre chron
chronos pour débloquer des médailles. On retrouve
environnements (et donc quatre bagnoles offrant le même
mê classement de difficulté par couleur (comme
des styles de conduite différents) sont livrés pour les pistes de skis). Vous commencerez donc sur
avec le jeu, dont deux que nous connaissons des parcours blancs qui se bouclent en 15 secondes
déjà : Stadium et Canyon. Là, aucune surprise. et donnent l’impression d’être un dieu du pilotage.
Stadium se joue dans un… stade, oui, bravo, avec Puis vous finirez dépressif et alcoolique au bout de
la classique Formule 1 survitaminée qui vire bien votre 892e tentative infructueuse pour débloquer
à plat. Canyon se pratique lui dans des… canyons, une pauvre médaille de bronze sur les éprouvants
merci, avec une bagnole qui part facilement en circuits rouges et noirs. Le multijoueur sera du
dérapage. La direction artistique a été musclée même acabit, on pourra comme d’habitude se
sur ces environnements, qui proposent des décors connecter à un serveur et tourner avec d’autres potes
plus détaillés, des tas de panneaux publicitaires avant de défoncer le clavier parce que Toto_du_78
dans toutes les langues, des ballons de baudruche vous a grillé de 0,004 seconde sur la ligne d’arrivée.

50 | Canard PC
)ĹʱƚƋºÚųŅĜƋåØƴŅƚŸƴŅƼåDŽĬåŸģ±ƚčåŸÚű域åĹÏåÚƚĵŅÚåBŅƋ„å±ƋØŧƚĜŞåųĵåƋºĘƚĜƋ
ģŅƚåƚųŸÚåƋŅƚųĹåųĬåŸƚĹŸ±ŞųìŸĬ埱ƚƋų域ƚųĬ±ĵéĵåĵ±ÏĘĜĹåŞŅƚų±ĵæĬĜŅųåųĬåƚųƋåĵŞŸţ Parce que le jeu n’était
sûrement pas assez
délirant, certains
départs de circuits se
font désormais depuis
Entre deux sessions sérieuses où les trajectoires • Un mode « à la Micro Machines » se joue à un câble d’hélicoptère.
seront optimisées au nanomètre, TrackMania quatre sur le même écran, le but étant de ne
Turbo offre aussi un tas d’autres nouveaux pas se faire distancer en sortant du champ
modes multijoueurs que les jeunes d’aujourd’hui de la caméra (vous perdez alors une vie
qualifieraient de « rigolol ». Ils constituent la sur cinq). C’est très original et il est même
vraie nouveauté de cet épisode. Le plus simple possible de jouer avec des collisions pour un
reste de vous en dresser une petite liste : résultat encore plus bordélique. J’ai trouvé ça
super difficile et je n’arrêtais pas de perdre.
• Smash est un mode « à la Track and Field »
(je cite ici les mots du lead game designer) dans • Un mode Split Screen permet à quatre
lequel l’accélération se fait en écrabouillant joueurs de jouer chacun sur un quart de
le bouton le plus rapidement possible. l’écran, sans aucune perte de fluidité.
C’est marrant mais ça nique les doigts.
• Dans le mode Hot Seat, huit joueurs peuvent
• Bonus rajoute du Super Mario Kart dans votre passer l’un après l’autre pour tenter d’améliorer
TrackMania. En passant les checkpoints, on le meilleur temps de la session tout en gérant
récupère des items qui réduisent la gravité, une jauge d’essence. C’est parfait pour du
augmentent ou diminuent la taille de la multijoueur en local, vous pouvez faire
voiture, permettent de tirer des projectiles tourner huit joueurs avec une seule manette.
C’est moi
vers l’avant ou l’arrière… Sympa, même si ça qui l’ai fait
ne vaut pas un vrai Super Mario Kart. • Dans le mode Double Driver, bien con, deux ŅĵĵåÚűʱÆĜƋƚÚåØ
joueurs pilotent la même bagnole, chacun ce TrackMania
• Stunt, un mode « à la Tony Hawk », permet de influant sur 50 % de l’amplitude des contrôles. åŸƋĬĜƴųæ±ƴåÏƚĹ
réaliser des rotations durant les sauts pour faire C’est mon favori, celui sur lequel nous avons le ü±ĹƋ±ŸƋĜŧƚåæÚĜƋåƚų
grimper une jauge de turbo. C’est très technique plus rigolé. Il faut se synchroniser avec l’autre ÚåÏĜųÏƚĜƋØÚĜŸŞŅĹĜÆĬå
parce que les rotations ne sont pas évidentes à doser. pilote et, bien évidemment, rejeter la faute åĹĵŅÚåŸĜĵŞĬåŅƚ
sur lui lorsque la bagnole se crashe dans le ±ƴ±ĹÏæØƋųìŸÆĜåĹ
décor. Ça va être formidable à jouer bourré. ĀÏĘƚſĵéĵåƚĹ
ĹŅƴĜÏåŸåų±ϱޱÆĬå
Le Trackmania de l’apéro. TrackMania ÚåŸŅųƋĜųƚĹޱųÏŅƚųŸ
Turbo sortira fin mars, avant qu’il ne soit testé ų±ĜŸŅĹűÆĬåĵåĹƋ
dans le prochain Canard PC. Je vais donc me ĜĹƋæų域±ĹƋåĹĵŅĜĹŸ
permettre de vous donner un début d’opinion : ÚåŎLjĵĜĹƚƋåŸţ
les contrôles sont parfaits, les circuits excellents, XűæÚĜƋåƚųŞåƚƋ
la réalisation impeccable, mais le vétéran de ±ƚŸŸĜčæĹæųåųƚĹ
la série n’y trouvera rien de révolutionnaire ޱųÏŅƚųŸ±ƚŞĜüåĹ
s’il se contente de jouer en solo. Ce nouvel ŧƚåĬŧƚ域åÏŅĹÚåŸØ
épisode se révélera surtout intéressant pour ޱųü±ĜƋŞŅƚųĵåƋƋųå
ces gens bizarres (et souvent névrosés) qui ƋŅƚƋĬåĵŅĹÚåŸƚų
aiment la convivialité ou le partage. C’est avec ƚĹŞĜåÚÚűæč±ĬĜƋæ
trois ou quatre potes autour de la console ŞåĹÚ±ĹƋĬåŸޱųƋĜåŸ
pour jouer en Hot Seat ou en Split Screen que ĵƚĬƋĜģŅƚåƚųŸţ
TrackMania Turbo devrait justifier son prix
quand même assez élevé de 36 euros.

Canard PC | 51
À VENIR PC

Space Hulk : Deathwing


Le FPS à l’alien fraîche
Kahn Lusth

En matière de level design,


Deathwing devrait alterner
de grandes pièces ouvertes
et des couloirs plus étriqués
que le... nan, laissez tomber,
c’est trop vulgaire.

Le « What’s Next ? » de Focus, ou le lambada pour nous attirer et autres fourberies sont
n6YSMcIWXETV²W$~HERWYRIXVEHYGXMSR ,IRVIc ainsi au programme, accompagnées d’une montée en
PEQIRXEFPIIWXYR³Z³RIQIRXSVKERMW³ FPS tactique XP qui permettra de débloquer de nouvelles armes
TEVPƶ³HMXIYVTSYVJEMVIPITSMRXWYVWSR (et un peu RPG) pour notre équipe ou encore, de nouveaux pouvoirs
GEXEPSKYIHINIY\IRH³ZIPSTTIQIRX‡GIXXI )³ZIPSTTIYVc pour notre psyker, comme une chaîne d’éclairs sur
SGGEWMSRRSYWEZSRWHSRGTYFPSUYIVPIW Streum On Studio fond de Jean-Michel Jarre. Autant vous dire que,
GV³EXIYVWHIDeathwingHERWPIGSMRHƶYRI (France) sur le papier, ce titre me fait bouillir le sang.
TM²GITSYVIRWEZSMVYRTIYTPYWETV²W “HMXIYVc
YRIERR³IHIFSYPSXWSYWRSWVEHEVW Focus Home Repent, motherfucker ! Mais dans les faits, les choses
Interactive sont hélas un poil moins prometteuses, même si cette
5PEXIJSVQIWc présentation m’a permis de constater certaines avancées.

L
a promesse de Streum On est plutôt simple Windows PC, Pour commencer, c’est l’interface qui semble s’être payé
à décrire. Dans les ténèbres d’un futur Xbox One, PS4 un bon lifting et fait désormais plus futuriste que le jeu
lointain où il n’y a que la guerre et Games SVXMITV³ZYIc vidéo des années 1990. De petites fenêtres flottantes
Workshop qui brade ses licences, Deathwing « Bientôt » apparaissent sous nos yeux, l’arme est accompagnée
place le joueur dans la grosse armure d’un psyker d’un compteur de munitions holographique et tout
Space Marine. Cet espèce de magicien du futur est fait pour qu’on se sente comme un Ironman dans
appartient au chapitre des Dark Angels et plus l’espa En revanche, si le punch des combats semblait
l’espace.
précisément à sa première compagnie qui donne amél
amélioré, j’avoue avoir encore de gros doutes sur son
son nom au jeu. Pour faire simple, vous œuvrez effica
efficacité. Certes, les armes claquent plus fort et les
dans l’ombre pour protéger un lourd secret, effet qui accompagnent le moindre coup de feu sont
effets
à base de : « Non, aucun Dark Angel n’a jamais peau
peaufinés. Toutefois, le résultat pourrait manquer
rejoint le Chaos mais si on en trouve un, on va le cruel
cruellement de ragdoll débridé, de sang qui repeint les
faire se repentir à coups de masse énergétique dans murs et toutes ces finesses qui font le charme bucolique
les dents. » Or, comme les scénaristes pensent d’un Warhammer 40k. Et puisque nous parlons des
toujours à tout, il se trouve qu’un Space Hulk Term
Terminators, sachez que ceux qui vous accompagnent
(un agglomérat d’épaves de vaisseaux) contient so plus que deux, afin être moins bordéliques à
ne sont
de précieuses informations sur le sujet, en gérer dans un jeu qui se veut plus orienté sur l’action
plus de méchants aliens qui ont boulotté nos s la tactique. Un point compréhensible, mais
que sur
prédécesseurs. Dans les faits, Deathwing est donc n
qui n’empêche pas Streum On d’affirmer que le mode
attendu comme un FPS où l’on dirige ses équipiers coop sera probablement jouable à cinq. C’est bien,
coop’
à la manière d’un Brothers in Arms allégé, tout en mais rien de tout ça ne nous explique pourquoi le
faisant face à des aliens dont l’IA pourrait nous traile de Deathwing débute sur un rap, avant de se
trailer
jouer des tours. Contournements, fuite, petite term
terminer sur des trompettes de mariachis…

52 | Canard PC
The Technomancer Seasons After Fall
Mars à l’ombre Renard en retard
Par Izual Par Netsabes

Z
acharie est un type malin : il a vite compris
que ses parents étaient bourrés au moment de
lui trouver un prénom et que pour survivre
dans les colonies humaines miséreuses de Mars, il
faudrait autre chose qu’un nom de caniche. Alors
Zacharie se fait appeler le Technomanceur et il
parcourt toute la planète à l’ambiance post-apo’
pour rosser les malpolis qui osent se moquer de son
prénom. Il faut dire qu’il a quelques facilités : non
seulement sa faction de départ est une dictature
militaire qui rappelle les heures glorieuses de
l’URSS, mais il est aussi membre d’un ordre de
chevaliers-magiciens qui utilise l’électricité pour
pimenter les soirées, un peu comme Claude François. ,IRVIc
Les mésaventures de Zacharie l’amèneront dans balade en forêt
)³ZIPSTTIYVc
quelques grandes zones (pas de monde ouvert) où il
Swing Swing
devra traiter avec plusieurs groupes, et il pourra se
Submarine
spécialiser dans plusieurs styles de combat comme
ŠºƤaŅĹƋŞåĬĬĜåųØ
le bâton électrique, la dague électrique ou encore
en Suède)
la massue électrique. Mais tout ne sera pas réglé
“HMXIYVc
par les bzzzt et les zzzapp : The Technomancer est
Focus Home
un jeu de rôle, et vous aurez donc tout un panel
Interactive
d’attributs, de dialogues à choix multiples, de
5PEXIJSVQIWc
compétences de crochetage et de charisme à votre
{œĜĹÚŅƵŸØ
disposition pour venir à bout du scénario, qui
a±ÏØXĜĹƚƻ
détaillera votre quête pour restaurer le contact
ŠåƋƤŞĬƚŸƋ±ųÚ
avec la Terre – en espérant qu’ils ne soient déjà
sur consoles)
pas tous desséchés sur la planète bleue.
SVXMITV³ZYIc
2016

M
ais est-ce qu’il va finir par sa voie dans une forêt touffue, où
sortir, ce jeu ? D’abord il rencontrera les esprits locaux
présenté en 2010 puis et gagnera le droit de changer de
mis en pause et enfin repris après saison à loisir. Ces pouvoirs, en
la sortie de l’excellent Tetrobot and retour, lui permettront de revisiter
Co. il y a deux ans, Seasons After Fall la forêt pour atteindre des zones
se fait attendre. Cette fois, c’est sûr, jusqu’alors bloquées, par exemple
ce sera pour la fin du printemps. en faisant tomber de la neige pour
Ou la fin de l’été. Enfin, cette année créer de quoi grimper plus haut,
en tout cas. Le jeu de renard finaud en faisant pousser à l’automne des
des Montpelliérains de Swing champignons magiques qui peuvent
Swing Submarine a un souci : sa servir de plateforme ou d’ascenseur,
(magnifique) direction artistique ou encore en utilisant la chaleur
décidée très tôt, qui donne du coup de l’été pour faire fondre les glaces
,IRVIc{:ĵ±ĜŸƚĹŞåƚ l’impression que le jeu n’avance de l’hiver. Seasons After Fall se veut
Æå±ƋěƋĘåĵě±ĬĬŧƚ±ĹÚĵéĵåƤ pas d’une présentation à l’autre. Et bien moins difficile et cérébral que
XåģåƚæƋ±ĜƋĬŅĜĹ
)³ZIPSTTIYVc „ŞĜÚåųŸŠ8ų±ĹÏåšƤ d’être aussi pourtant, il progresse : à chaque Tetrobot and Co., l’idée étant cette fois
“HMXIYVcFocus Home beau quand on fois, les effets sont plus raffinés, les de créer un jeu narratif avec quelques
FĹƋåų±ÏƋĜƴåƤ l’a vu tourner animations plus nombreuses et plus casse-têtes et un peu de plateforme
5PEXIJSVQIWc{œĜĹÚŅƵŸØ ÏĘåDŽ8ŅÏƚŸØÏå réussies… Mais reprenons. Dans (qui, là encore, ne devrait pas
£ÆŅƻkĹåØ{„ĉƤ qui montre que Seasons After Fall, vous contrôlez (en poser trop de difficultés). Résultat
SVXMIcTV³ZYIc2016 ŞĘŅƋŅŸĘŅŞŞåƚųåŸƋ 2D vue de côté) un renard cherchant dans quelques mois, enfin.
ƚĹĵæƋĜåųÚű±ƴåĹĜųţ
Canard PC | 53
À VENIR PC

Call of Cthulhu
Bouffé par le Mythe
Par Guy Moquette

Depuis très longtemps, et comme en Entre eux deux, la folie. Parmi tous les détails
témoigne le numéro de Noël 2012 dédié Genre : RPG intéressants glanés lors de cette rencontre, il
au Mythe1, la rédaction de Canard PC d’investigation y a la présence à l’écriture de Mark Morrison,
est remplie de névrosés de Lovecraft. Développeur : auteur à qui l’on doit plusieurs scénarios et
La récente arrivée de Miss Katonic, la Cyanide (France) campagnes du jeu de rôle papier, à commencer
maquettiste du bout du monde, n’a fait Éditeur : Focus par l’extraordinaire Terreur sur l’Orient-Express.
qu’empirer la situation et il y a aujourd’hui Home Interactive Il y a également ce premier trailer du jeu,
dans les locaux plus de tentacules qui Plateformes : évoquant immédiatement Amnesia (référence
traînent que dans les plus hardcore des PC Windows, PS4, pleinement assumée par le studio) avec sa vue
hentais. Alors quand un studio se met en Xbox One à la première personne, sa lampe à pétrole à la
tête de développer un RPG s’inspirant autant Sortie prévue : flamme vacillante, et une perception de la réalité
de l’œuvre de Hectolitre Politburo Lovecraft 2017 à géométrie variable. « L’œuvre de Lovecraft, ce
que de l’excellent jeu de rôles papier L’Appel n’est pas seulement de l’horreur et des tentacules,
de Cthulhu, on se tait, on tend l’oreille et on explique le game designer Jean-Marc Gueney,
frétille un peu du pseudopode. comme pour mieux flinguer mon introduction.
C’est avant tout une confrontation à une terrifiante
réalité par un homme du commun. Et la manière dont
il sombre dans la folie à mesure qu’il s’approche de la

D
epuis que les écrits de ce bon vieux vérité. » Selon l’état de sa jauge de santé mentale,
H.P. L. sont passés dans le domaine public, le joueur n’aura donc pas la même perception de
il faut bien reconnaître que l’on trouve tout son environnement. De l’aveu des développeurs,
et n’importe quoi en matière d’adaptation. Avec le but est de « lui faire douter de la réalité de ce
un goût très prononcé pour le n’importe quoi, on qu’il verra et entendra ». Quant à la vue FPS, qui
ne va pas se raconter de salades. Ce qui devrait pourrait laisser suggérer la présence d’armes
normalement inciter à la plus extrême prudence. à feu… « Oh oui, il y en aura une. Mais elle ne
Dans le cas de Call of Cthulhu, on a tout de même permettra que de gagner un répit dans certaines
envie de mettre le scepticisme de côté. Pas tant situations et, l’essentiel du temps, de faire prendre
parce que l’on parle du studio français Cyanide, conscience au joueur de sa vulnérabilité… » Sous-
pas réputé pour sa constance à enchaîner les entendu : ceux qui ne savent pas encore que vider
chefs-d’œuvre – ni les bouses, notez, c’est déjà un chargeur sur une créature du Mythe n’est pas
pas mal – que parce que ses deux représentants franchement utile vont rapidement le découvrir.
ce jour-là, Jean-Marc Gueney et Maximilien
Lutz, ont eu la bonne idée de dire exactement ce
qu’un intégriste du Mythe comme votre serviteur 1. Il est encore disponible en vente par
a envie d’entendre en pareille circonstance. correspondance, c’est fou ça ! cpc.cx/eLl

54 | Canard PC
persuasion : « Elle comprend à la fois le charisme et l’intimidation.
Le joueur pourra parfois tenter de convaincre une personne de parler,
parfois lui forcer la main. » Et ces différents PNJ, dont on nous dit
qu’ils auront chacun une personnalité précise, un background
et des motivations qui leur seront propres, ne réagiront
pas tous de la même manière. Et souvent, ce choix aura des
répercussions à long terme : « Il sera ainsi parfois possible d’avoir
recours avec succès à une intimidation. De précieuses informations
seront récoltées tout de suite, mais le PNJ aura pu se braquer et être
moins collaboratif, voire hostile, lors d’une rencontre ultérieure. »
Tandis qu’une méthode douce possiblement moins productive
à court terme en raison de la méfiance de l’interlocuteur
Pieds et poings R’Lyeh. Même le protagoniste de Call of pourrait, à l’inverse, porter ses fruits et rendre ce même PNJ
Cthulhu ressemble à l’un de ces personnages pré-tirés du jeu de mieux disposé à faire confiance à Pierce un peu plus tard.
rôle : Edward Pierce, vétéran de la Première Guerre mondiale
est devenu détective privé dans le Boston de 1924. Engagé … envoie FHTAGN au 81‫ݴ‬1ࢺ Quelques dizaines de secondes
par un homme qui a perdu sa fille et son petit-fils dans un de bande-annonce et une trentaine de minutes à papoter
incendie et qui estime que l’enquête criminelle a été bâclée, ses avec les deux représentants du studio sont évidemment
recherches l’amènent sur l’île de Dark Water, un lieu où, comme loin d’être suffisantes pour préjuger de la qualité d’un titre
on dit dans ces cas-là, « on n’aime pas trop les étrangers ». prévu pour l’année prochaine. Mais il y a au moins un truc
Un petit coup d’œil à la fiche de personnage d’Edward permet à peu près certain : on trouve dans l’équipe de Cyanide
de distinguer, outre sa vilaine balafre ramenée d’Europe, de vrais passionnés au goût sûr2, qui ne se contentent pas
ses différentes caractéristiques : investigation, persuasion, de voir dans l’univers lovecraftien une licence porteuse
infiltration, criminologie, traumatologie. Oui, si Cyanide a qui a le bon goût d’être libre de droits. Des gens qui,
l’intention de respecter l’esprit du jeu de rôles, il n’en garde pas quand ils parlent des futurs compagnons (Pierce pourra
son système de règles, pas franchement adapté à un jeu solo et en compter trois sur un total provisoire de six différents)
globalement linéaire. Aïe, le mot qui fâche… Si Cyanide admet à envoyer en mission pour ramener des renseignements
effectivement que Call of Cthulhu se présentera comme une ou récupérer des objets, évoquent les différentes phobies
succession de situations – comme un enchaînement de petits que le détective pourra contracter en fonction du type de
scénarios composant une campagne, avec récupération de santé situation qu’il vit, ou abordent la modélisation, forcément
mentale entre chaque –, le studio insiste sur le vaste choix délicate et nécessairement subtile, de la folie dans leur
mis à disposition du joueur dans les différentes approches et jeu, laissent penser qu’ils ont au moins pris le projet par
sur l’importance accordée à l’exploration et aux dialogues. le bon bout. Le pseudopode n’a pas fini de frétiller.

Pour rencontrer des abominations près de chez toi... 2. Ils ont cité L’Antre de la Folie de John Carpenter comme meilleure œuvre
Sur ce dernier point, ils prennent en exemple la capacité de cinématographique inspirée par Lovecraft ; moi, il ne m’en faut pas plus.

Canard PC | 55
À VENIR PC

Styx : Shards of Darkness


Dans l’ombre d’un doute
Par Kahn Lusth

Il est petit, tout vert et ne sent pas très sous leur nez ou ne s’inquiètent pas bien longtemps de
bon. C’est ? C’est... Non, il ne s’agit pas de ,IRVIcĜĹĀĬƋų±ƋĜŅĹ découvrir Dédé, leur ami de toujours, égorgé dans un
Bloublou, le poisson rouge oublié depuis )³ZIPSTTIYV coin. Dommage car sans ces erreurs grosses comme
six mois dans l’aquarium de votre voisine Ƽ±ĹĜÚå„ƋƚÚĜŅ un nez de gobelin, Styx serait un excellent titre.
partie en « vacances » au Cap d’Agde mais Š8ų±ĹÏåš
de Styx, le gobelin tellement méchant “HMXIYVc Et Styx, et Styx, et colégram. Aujourd’hui, les
UYƶSRǻRMXTEVPƶEMQIVGSQQIYRKIRXMP 8ŅÏƚŸBŅĵå développeurs entendent donc remettre le couvert avec
FĹƋåų±ÏƋĜƴå un nouvel opus qui, promis juré craché, corrigera les
5PEXIJSVQIWc bêtises de son prédécesseur en améliorant sa recette.
{Ø£ÆŅƻkĹåØ{„ĉ Si les corrections attendront un test pour que l’on en

P
our rappel, le premier Styx était un jeu SVXMITV³ZYIc dresse la liste, sachez toutefois que Styx n’est plus un
d’infiltration bovais. Non, aujourd’hui 2016 gros manchot de l’escalade. C’est du moins ce que j’ai cru
encore, je ne sais toujours pas s’il faut le comprendre, en le voyant suspendu à un balcon et passer
ranger dans la catégorie « bon » ou « mauvais ». un angle droit sans devoir remonter. Ce point mis à part,
D’un côté, le fait de mettre le joueur aux les véritables nouveautés reposeront sur un contenu
commandes d’un gobelin pour justifier tifier un jeu plus riche et varié. Maintenant, notre gob’ aura affaire
ée. Le héros est
d’infiltration est une excellente idée. aux nains, à des insectes géants et peut-être d’autres
une petite ordure, ce qui change agréablement, surprises, en plus des traditionnels humains. L’intérêt ?
et son faible gabarit nous permet d’appréhender Pousser le joueur à changer sa façon de jouer, lorsqu’il
u’il est possible
différemment l’infiltration, puisqu’il se retrouve face à un nain qui peut le repérer à l’odeur
habituels,
de se cacher dans des endroits inhabituels, ou un cafard aveugle mais qui entend le moindre de ses
par exemple sous une table. Et pour ur finir, Styx mouvements. Et, comme on peut l’imaginer, ces ennemis
peut utiliser quelques pouvoirs en n puisant nous emmèneront dans des lieux qui modifieront aussi
dans une jauge d’ambre, ce qui lui permet notre approche, tel un village sous le soleil ou des grottes
entre autres de faire apparaître un n clone tortueuses. L’ultime nouveauté sera le craft qui permettra
teindre des
dont on prend le contrôle pour atteindre de débloquer de nouvelles recettes au fil des niveaux,
endroits autrement inaccessibles ou distraire afin de fabriquer des potions aux effets particuliers ou
les gardes. Soit un bon petit jeu, mais qu’une encore une arbalète de poing que l’on imagine utile pour
réalisation moyenne condamna aux ux limbes du faire des trucs et des machins. Au final, on peut croire
jeu vidéo. En cause, des fautes de game design dans le potentiel de cette suite, mais il faudra tout de
impardonnables, comme des gardes es qui ne même voir si ses créateurs peuvent mener leur projet à
réagissent pas quand des torches s’éteignent terme sans s’emmêler les pinceaux une fois de plus.

56 | Canard PC
Space Run Galaxy
EEuropa
Eur
uroopa
ur p Truck Simulator
pa
Par Louis-Ferdinand Sébum

Pour connaître les idéaux d’une civilisation,


GƶIWXWMQTPIcMPWYǽXHƶ³XYHMIVGIUYƶIPPIGVSMX
voir dans le ciel. Les Grecs imaginaient un
monde supralunaire incorruptible et invariant,
les chrétiens y cherchaient le royaume de Dieu,
les années 1960 rêvaient d’une utopie post- Han Solo et en multi. Le gameplay de Galaxy
raciale pleine de Sulu et d’Uhura. Depuis Reagan reste peu ou prou le même lors des missions,
IX8LEXGLIVGƶIWXHMǺ³VIRX1ƶIWTEGIIWXEZERX Genre : même si l’on trouve un plus grand nombre de
tout un endroit où faire du blé. Autant vous tower defense synergies entre modules et de nouveaux ennemis
HMVIUYƶIRFSRIRJERXHIWeighties, né deux ans Développeur : moins crétins. La grande nouveauté de cet épisode
avant Elite et Vive la criseUYERHNIVIKEVHIPI Passtech Games reste toutefois l’ajout d’un vaste méta-jeu. Fini
GMIP³XSMP³NIGSQTXIPIW³XSMPIWIROMPSIYVSW (France) les missions linéaires et scriptées du premier
Éditeur : Space Run, on a désormais droit à des missions
Focus Home procédurales dans une galaxie ouverte, persistante
Interactive et, surtout, multijoueur. Les modules et le vaisseau

C
ela explique sans doute pourquoi j’attends Plateforme : sont conservés d’une mission à l’autre et il est
Space Run Galaxy avec impatience. Certes, PC Windows possible d’acheter équipement, hexagones et
ce n’est pas la seule raison. Le premier Space Sortie prévue : même vaisseaux « clés en main » dans les systèmes
Run, sorti en 2014, fait partie de ces rares jeux printemps 2016 stellaires visités lors des livraisons. Certaines
indés qui non seulement reposent sur un concept planètes étant spécialisées dans certains types
original mais savent en tirer tout le potentiel. d’équipement (attaque, défense, soutien…), le
Pour ceux qui l’auraient raté à l’époque, il s’agissait joueur a une raison supplémentaire d’explorer
d’une sorte de tower defense mobile. Chargé de l’univers. Encore mieux, le joueur qui se voit
transporter des marchandises d’un point à l’autre confier une livraison qui ne l’arrange pas, parce
de la galaxie pour faire des thunes, le joueur devait qu’elle l’envoie dans des coins où il n’a rien à
installer différents modules hexagonaux sur son faire, peut créer sa propre mission et confier son
vaisseau (sorte de plateforme autopropulsée) cargo à d’autres joueurs. Libre à lui, s’il le désire,
pour se défendre face aux astéroïdes, pirates d’offrir une rémunération pour attirer des livreurs
et autres saloperies croisés en route. Si les potentiels. Salaire ou pas, exécuter des missions
premières missions étaient simples, elles viraient pour d’autres humains rapporte des matériaux
rapidement au casse-tête : trouver le bon équilibre de crafting uniques qui permettent de fabriquer
entre réacteurs (nécessaires pour livrer les des modules non accessibles autrement. Un
marchandises dans le meilleur délai possible), bon moyen d’encourager les joueurs à coopérer
boucliers, canons divers et autres modules n’était – l’autre étant la possibilité de voir, à tout
pas une partie de plaisir. Il fallait en permanence moment, quelles sont les missions qu’effectuent
démonter des modules pour en installer d’autres nos amis Steam, et de leur proposer un coup de
et, rapidement, faire des compromis pour espérer main si nécessaire. Tout cela a l’air aussi original
livrer au moins une partie du cargo à bon port. que bien parti. Coup de bol, ça sort avant l’été.

Canard PC | 57
À VENIR PC

The Surge
Vert solitaire Par Izual

D’après le lead game designer de The Surge,


PIL³VSWHYNIYIWXncun employé chargé de
résoudre des problèmes écologiquesc~/IJEMW
semblant de noter cet élément de l’intrigue sur
mon carnet avant de regarder à nouveau l’écran
de présentation, où un zombie en exosquelette
WIJEMXH³GETMXIVEYQS]IRHƶYRIXVSR±SRRIYWI
9RIGLSWIIWXWÆVIPƶ³GSPSKMI±EEGLERK³ Genre :
Dark Souls
dans le futur
)³ZIPSTTIYVc Lee courant alternatif. Puisque tronçonneuse et

A
fin de comprendre pourquoi Nicolas Hulot Deck13 Interactive ifi
pacifisme vont rarement bi bl parlons
bien ensemble, l
s’est soudain mis à décapsuler du mort- (Allemagne) des combats. Ils promettent d’être nombreux, mais
vivant, il faut revenir quelques minutes “HMXIYVc aussi techniques et plutôt gratifiants. Tout sera basé
en arrière, au début de la présentation. C’est là Focus Home sur l’endurance, cette jauge magique qui empêchera
qu’on m’a mis au jus : le jeu commence lors de votre Interactive votre personnage de trop enchaîner les roulades ou
premier jour de taff et que, pour manutentionner Plateformes : de lancer des assauts sans interruption. De toute
correctement dans l’usine titanesque où vous êtes PC Windows, façon, vous aurez intérêt à vous arrêter de taper
affecté, vous avez dû subir une greffe d’exosquelette. Xbox One, PS4 deux minutes pour réfléchir : l’atout principal de
Sauf que l’IA qui gère l’usine pète un câble, qu’elle Sortie prévue : 2017 The Surge, ce sera la possibilité de démembrer les
verrouille tout, qu’elle rend mabouls les ouvriers ennemis. Et justement, une partie de leur corps
transformés en zomblards et que vous vous retrouvez sera leur point faible – pour les ouvriers zombies
coincé dans un environnement des plus hostiles. en exosquelettes dont je parlais plus haut, ce sera
Un premier jour de boulot plutôt chouette, en les jambes, tandis qu’un boss en forme de robot-
somme – à mon arrivée à Canard PC, j’avais dû araignée géant devra se faire trancher les pattes une
écrire un guide sur Hearthstone, de quoi relativiser à une pour être vaincu. Si au début vous n’aurez
la malchance de notre Eva Joly masculin. Quoique. pour tout arsenal que vos outils de soudure ou votre
Deck13 Interactive est le studio co-responsable scie à moteur, quelques améliorations ramassées
de Lord of the Fallen, un ersatz de Dark Souls pur sur les cadavres ennemis vous permettront d’aller
jus, et The Surge semble bien parti pour reprendre porter votre projet écologique jusque dans les zones
la même recette dans un univers futuriste un peu les plus dangereuses. Il faut aussi rajouter à tout
glauque. Jean-Vincent Placé devrait donc affronter cela une idée assez chouette, celle d’acheter des
une cohorte d’ennemis dont même les plus faibles implants crâniens pour modifier votre interface :
pourraient le descendre s’il ne fait pas assez gaffe, l’un vous permettra de voir la santé des ennemis,
le tout au cours d’un grand voyage à la Dark Souls un autre focalisera sur leur point faible, et ainsi
avec son lot de zones secrètes, d’embranchements de suite. Entre ces quelques innovations plutôt
à explorer et de pseudo-discrétion pour éviter prometteuses et sa direction artistique soignée, The
d’attirer l’attention d’un cyborg en patrouille. Surge a le potentiel pour devenir un excellent jeu.

58 | Canard PC
Remnants of Naezith
on lui a mis le grappin dessus
Par Pipomantis

On se rappelle toujours de ce qu’on était peu l’adage (big up à Philippe Pollet-Villard, ma


en train de faire autour de 18 ans. Les ,IRVIc référence pour les citations surannées) mais le
fêtes dantesques avec les potes, les Super Vite Boy moindre bout de level design est une excuse pour
révisions studieuses pour le baccalauréat, )³ZIPSTTIYVc virevolter entre des scies, frôler des lasers du bout
l’insouciance et la fougue de l’âge auquel on Tolga Ay (Turquie) des fesses et se régaler. La physique du grappin est
tient encore l’alcool… Et puis il y a Tolga Ay. 5PEXIJSVQIc excellente et propose ENFIN de se balancer ou de
PC Windows se faire tracter en fonction de la situation. Ça a l’air
SVXMITV³ZYIc tout bête mais c’est ce choix, ce refus flamboyant

T
olga Ay est un jeune homme qui, à l’âge 2016 du compromis dégueulasse imposé depuis des
de 18 ans, a décidé de bosser sur son années par l’infâme industrie du AAA1, qui rendent
jeu pour apprendre le C++ et affiner ses le titre si agréable. De fait, le grappin sert plusieurs
compétences en programmation. Sauf que là où fonctions et devient un petit couteau suisse
les post-ados de son âge s’entraînent généralement qui, à l’aide des nombreux mouvements donnés
à faire un clone de Super Mario ou un casse- au joueur (double saut, dash, walljump), offre
briques simpliste, Ay a préféré voir grand et une liberté d’action et de mouvement rarement
régler son pas sur ceux de Super Meat Boy et vue dans ce genre de « petites » productions.
Dustforce. Oui oui, ce jeune homme de 18 balais Cerise sur le gâteau, la maniabilité est un vrai
veut, dans le calme le plus complet, programmer bonheur et, après un léger temps d’adaptation,
un platformer ultra hardcore. Avec un grappin, on contrôle notre héros avec un plaisir et une
tant qu’à faire, histoire que ça soit bien compliqué aisance impressionnants. Un ressenti mis en valeur
à développer et que la hype entraîne une par la fluidité des animations et un level-design
gigantesque déception lors de la sortie du jeu. qui cache déjà de beaux moments de génie ici
Sauf qu’en fait, Tolga Ay est un développeur ou là. Et si vous avez peur que le développeur
extrêmement talentueux et que, malgré de petits ne suive pas et sorte son jeu avec vingt missions
hoquets ici et là, Remnants of Naezith est bien un peu bateau, le titre possède déjà un éditeur
parti pour être un jeu de plateforme hardcore, de niveaux. Encore vilain comme tout mais déjà
exigeant mais surtout sacrément jouissif. très simple à utiliser, nul doute qu’il permettra
aux plus déviants de créer de vrais monuments
Sonic Commando. Remnants of Naezith, c’est de sadisme. En espérant que la version finale soit
avant tout un but simple et sobre : arriver à la fin aussi réussie que cette alpha est encourageante.
de chaque niveau en un seul morceau. Mais vous
savez ce qu’on dit : « Dans un voyage ce n’est pas
la destination qui compte mais toujours le chemin 1. Oui, je suis toujours aussi énervé par ces filins qui
parcouru, surtout s’il l’est à coups de grappins, de tractent comme des cons et qu’on veut nous faire
boosts et de doubles sauts. » Bon, je transforme un passer pour des grappins mignons et gentils.

Canard PC | 59
E
Tous les quinze jours dans En chantier, vos rédacteurs se penchent sur des jeux
vendus en cours de développement : accès anticipés, alphas ou bêtas payantes.

en chantier

Ge
Genre : Minecraft
automatisé
aut
Développeur /

éditeur : Wube
éd
So
Software LTD
(Ré
(République tchèque)
Pla
Plateformes : PC
Wi
Windows, Mac, Linux
(S
(SRǻK
VIG
VIGSQQERH³Ic
car
carte graphique

dédiée
8³P
8³P³GLEVKIQIRX
Ça c’est un type sur Internet qui prouve qu’il 250 Mo
åŸƋŞŅŸŸĜÆĬåÚåƶƋĜųÚåĵ±čĹĜĀŧƚåŸÏʱğĹåŸ
1E
1ERKYIVF
ÚåĵŅĹƋ±čåƋŅƚƋåĹŞųæŸåųƴ±ĹƋĬ±āŅųåĬŅϱĬåţ
Pri
Prix actuel :
IRZ
IRZMVSRccIYVSW
Ça c’est un étranger Sit
Site : démo disponible

Factorio sur Internet qui a cpc


cpc.cx/eRJ
bâti une station So
Sortie prévue : ǻR
de lancement de DR
DRM : Steam ou aucun
Chaîne de vie par Maria Kalash satellites. sur Factorio.com

Certains jeux n’existent que plus de trois ans de développement et du fer. Il peut alors se fabriquer une petite
pour permettre au joueur de les 100 000 joueurs séduits sans l’aide du pioche, pour miner plus vite, et un petit
maîtriser. Pour ce sentiment de tentaculaire Steam, uniquement à la four en pierre, pour fondre ses minerais
totale domination qui rappelle force du gameplay, l’arrivée de Factorio en en plaques de métal. C’est à peu près à ce
l’époque où l’on faisait un mètre dix accès anticipé sur la plateforme de Valve moment-là, après 3 minutes de jeu donc,
mais où notre puissance face à une ne ressemble pas à celle de la plupart de que Factorio s’éloigne de Minecraft (cité
armée de bonshommes en pâte à ses petits copains, les jeux de survie en par Michal Kovařík comme sa source
modeler était sans limites. Et puis monde ouvert. C’est qu’il est déjà touffu, d’inspiration) pour devenir Factorio.
à l’inverse, il y a des jeux créés complexe, encore en développement certes, Contrairement à son prédécesseur, vous
TSYVRSYWVETTIPIVRSXVIMRǻRMI mais déjà assez mûr pour justifier qu’on n’allez pas passer votre vie de joueur à
TIXMXIWWIRSXVIMRWMKRMǻERGIRSXVI y consacre des centaines d’heures. Après fabriquer des trucs à la main comme un
statut de petit caca riquiqui qui de longs moments de souffrance, j’ai fini vulgaire péon. Dans Factorio, le maître-mot
jamais ne parviendra à quoi que ce par comprendre comment aborder ce c’est l’AUTOMATISATION.
soit dans la vie. monument tout en conservant un semblant
de santé mentale : comme un oignon.
Une quantité
L
La tournée du factorio. Avant de
de choses à gérer
es quelques jours que j’ai passés
sur Factorio pour les besoins de lancer une partie libre, il faut s’attaquer à
ce papier (la grippe a fait des la première couche de l’oignon et jouer à et à digérer.
ravages à la rédaction, au départ on la campagne, qui fait office de didacticiel.
avait programmé un journaliste doté de Si vous faites cela, vous aurez pendant
capacités intellectuelles et de troubles quelques minutes l’impression d’être Analyse d’usine. Et voilà comment vous
obsessionnels adaptés au jeu) marqueront en présence d’une sorte de très vilain allez devenir ingénieur-logisticien-supply
mon existence du sceau de l’inanité. J’ai Minecraft en 2D vu du dessus. Votre chain manager-grand ordinateur. Vous ne
en effet très vite pris conscience que le personnage se déplace avec les touches zqsd minerez pas à la force du clic droit, mais
temps que j’y passerai ne pouvait être (ou celles que vous voulez, les contrôles installerez dès que possible une petite
qu’insuffisant. Que c’est à peine si j’aurai sont entièrement personnalisables) sur mine thermique. Le charbon extrait, vous
le loisir d’effleurer du bout du doigt une planète inconnue. Il doit ramasser des n’allez pas le transporter à dos d’homme
la machine superbement huilée qui se ressources, vous l’aiderez en cliquant à la jusqu’à la fonderie, mais sur un tapis
dressait devant moi. Mon insignifiance souris sur ce qui se trouve à proximité : du roulant. Ces tapis roulants, au début vous
n’a eu d’égale que ma frustration. Après bois, de la pierre, du charbon, du cuivre et les fabriquerez un par un dans votre petit

60 | Canard PC
Ça c’est moi, peu
de temps avant
de fondre en
larmes.

Ça c’est moi,
posant à côté
de mon premier
radar.

Factorio. Vous vous mettez à utiliser les


deux bords des tapis roulants de manière
intelligente, vous passez des heures à
Ça c’est moi à côté étudier les designs mis en place par des
d’une centrale gens beaucoup plus malins que vous sur
solaire. Ce n’est Internet. Vous vous lancez dans de longs
pas moi qui l’ai
calculs avec des étrangers sur Reddit à
construite.
propos du débit des tuyaux qui apportent
l’eau à vos centrales. À ce stade, les aliens
qui attaquent votre base parce que vous
saccagez leur planète comme un humain
pollue la terre ne servent plus qu’à justifier
vos super tourelles laser et vous envisagez
sérieusement de poser des congés sans
soldes afin de recommencer une partie de
zéro avec les mods qui rendent les trains
inventaire, qui vous montre ce qu’il vous d’abord rechercher la logistique. Pour intéressants parce que les trains c’est
est possible de crafter. Et puis comme il bâtir des tourelles défensives, l’armement. cool. À ce moment enfin, dans une petite
vous en faudra des kilomètres, vous allez Viendra alors le moment de prendre centaine d’heures, Factorio vous procurera
automatiser leur fabrication aussi. Les conscience des manœuvres alambiquées ce sentiment de totale domination, de
premières heures, vous découvrirez toutes dans lesquelles il vous faudra vous plonger maîtrise. Votre vie aura un sens.
ces machines, vous laisserez submerger pour automatiser la fabrication des petites
par la quantité de choses à gérer et à fioles colorées destinées à la science. Eh
digérer. Vous allez vous retrouver avec non, on ne peut pas directement se lancer
des tapis roulants qui ne roulent plus, des à corps perdu dans la construction de la
bras articulés montés dans le mauvais base de ses rêves. C’est la deuxième couche En l’état :
sens, des fours sans charbon, trop d’écrous de l’oignon. J’hésite un peu à mettre « sans
et pas assez de plaques de métal, des danger » car Factorio me paraît
coupures d’électricité incompréhensibles… Échecs et automates. Dans la excessivement dangereux. Perso,
Il m’est arrivé de recommencer quatre troisième, vous allez remettre en question j’ai pris pleinement conscience que
fois le même morceau de campagne toute votre existence, toutes vos capacités j’étais nulle et qu’à moins de la subite
didacticielle pour arriver à un résultat intellectuelles. Rire de votre vous d’il y a émergence de centaines d’heures
plus simple, plus élégant, à mesure que je trois heures, celui qui était tellement fier de liberté dans mon emploi du
commençais à entrevoir comment tout d’être parvenu à organiser une chaîne de temps, je le resterai.
cela fonctionnait. Comme tout se fabrique production de circuits imprimés. Vous C’est bien triste car
à partir d’ingrédients simples et qu’avec n’éprouvez plus que du mépris pour ce chaque progrès
un peu de persévérance, on finit par tout sous-humain que vous étiez alors, qui dans la maîtrise
maîtriser, les développeurs ont ajouté un n’avait pas la moindre idée de comment de Factorio
autre facteur de complexité : la recherche optimiser un tant soit peu sa logistique. est une source
technologique. Pour pouvoir fabriquer Vous prenez peu à peu conscience du colossale de
une petite usine d’assemblage, il faudra degré de subtilité des mécaniques de satisfaction. Sans danger
Canard PC | 61
EN CHANTIER

Master of Orion
Le (bon ?) goût d’autrefois par Guy Moquette

,IRVIc Ce week-end, j’ai joué à Master of Orion. autres clones, hommages, spin-off engendrés depuis.
4X spatial Coucher cette phrase sur le papier, c’est Alors quand débarque ce Master of Orion, sorte
de réinterprétation HD des célèbres et fondateurs
)³ZIPSTTIYVc facile. Mais croyez-moi : la prononcer à
jeux de Microprose sortis en 1993 et 19961, avec ses
NGD Studios haute voix, c’est s’exposer au risque de se
mécaniques archiclassiques à peine dépoussiérées,
(Argentine) prendre un violent coup de pied au train ses quelques concessions faites à la modernité et ses
“HMXIYVc qui propulse plus de vingt ans en arrière, deux ou trois castrations notables (ils sont passés où,
WG Labs dans la peau de cet être plus jeune, maigre, les héros et la capture des vaisseaux ?), on ne peut pas
(Biélorussie) idéaliste (et, espérons, un peu plus con aussi) dire que la jauge d’extase monte dans le rouge.
5PEXIJSVQIc qu’aujourd’hui qui rentre de l’école avec sa
PC Windows pile de disquettes échangée contre un devoir World of Stars. Le retour de Wargaming.net dans
(SRǻK de maths, insérant chacune d’entre elles le petit monde du jeu traditionnel – en opposition
VIGSQQERH³Ic dans un lecteur capricieux, le geste rendu aux free-to-play qui ont fait autant sa renommée
PC de joueur fébrile par l’enivrante promesse de passer un que son replet compte en banque – se fait donc
8³P³GLEVKIQIRXc week-end entier à conquérir l’univers. via sa nouvelle filiale, WG Labs, dont le slogan
2 Go « Innovations in gameplay » sonne bizarrement vu
1ERKYIcVO (la VF à quel point son premier poulain, Master of Orion,

C
sera présente dans e week-end, donc, j’ai joué à Master of Orion. a les pieds enfoncés dans le ciment de la tradition.
Ĭ±ƴåųŸĜŅĹĀűĬåš Plus de vingt ans après, il y a moins de Ah, la tradition… C’est vrai que ça sonne bien,
5VM\c environ 46 € disquettes, moins de fébrilité (seulement trois comme mot, ça fait noble et respectueux. Mais à y
)72cSteam minutes à regarder le plafond le temps de télécharger réfléchir un instant, le terme désigne aussi bien les
les 2 Go d’installation avec la fibre optique) et aussi, pratiques éprouvées, la transmission de valeurs, les
il faut le reconnaître, un poil moins d’ivresse. C’est baguettes qui se la pètent, l’authenticité ou l’excision,
qu’entre-temps, le jeune couillon qui voyait le genre ce qui nous fait une belle jambe. Alors pour le dire
du 4X arriver à maturité sous ses yeux a grandi, vieilli
et surtout joué à cinq générations de Civilization, à 1. Notez que, par charité chrétienne,
Imperium Galactica, à Galactic Civilizations et tous les on n’évoquera pas Master of Orion 3.

62 | Canard PC
autrement, Master of Orion est un 4X qui
aurait fait un bond dans le temps, depuis
les années 1990 jusqu’à aujourd’hui.
Extérieurement, il est toujours jeune et
fringant : graphismes mignons, doublages
réussis, interface soignée… C’est de l’accès
anticipé très propre, comme on aimerait
en voir plus souvent. En revanche, à
l’intérieur, c’est un petit vieux un peu
largué.

Planètes pas sans bavures.


Attention, ne me faites pas dire ce que
je n’ai pas dit : dans sa version actuelle,
Master of Orion n’est pas un mauvais
jeu. Parfaitement incomplet, certes (des
conditions de victoires manquent, seules
six races sur dix sont présentes, les races nourriture et production, dont le brouillage de capacités ennemies et de
personnalisables et des pans entiers du rendement va decrescendo, ou encore la systèmes de défense antimissiles et aux
jeu, comme l’espionnage, n’arriveront gestion de la pollution. baies permettant de lancer des vagues de
que plus tard…). Bancal par bien des chasseurs et bombardiers. Il y a de quoi
aspects, au premier rang desquels l’IA Space opera-bouffe. Oui, tout cela s’y perdre, c’est prometteur et excitant…
complètement amorphe qui se montre promet de plutôt bien fonctionner une Jusqu’à ce que la prise en main de ces
capable de nous regarder bombarder fois le développement achevé. Mais, à vaisseaux personnalisés intervienne sur la
sa planète-mère avec ses yeux de bovin moins d’une grosse surprise, un lapin carte tactique des combats.
sans faire intervenir sa grosse flotte sorti du chapeau à la dernière minute Ce n’est pas tant que le passage de
capable de nous péter la gueule, mais par WG Labs, ce classicisme confinant l’historique système de tour par tour au
qui sera l’objet, nous promet-on, d’un à la copie-carbone d’un bon vieux Civ’ profit du temps réel (pausable) me hérisse
gros travail d’ici la sortie. Mais, au-delà manque du petit truc qui permettra à particulièrement, loin de là. Mais à l’heure
de ces défauts imputables à son statut l’amoureux de 4X qui s’est déjà goinfré, actuelle, les cartes étriquées et le faible
d’accès anticipé, on retrouve tous les excusez du peu, de GalCiv’, de Endless panel d’ordres à donner à sa flotte donnent
fondamentaux du 4X. L’exploration, Space et de Distant World au cours de ces l’impression de ne pas exploiter le dixième
la diplomatie, les choix de recherches dernières années, de s’y investir. Pourtant, des subtilités tactiques suggérées plus
– pas aussi radicaux que dans les titres on sent l’envie de bien faire. Tenez, haut. Là encore, le studio annonce avoir
originaux, mais certaines technologies prenez la personnalisation des vaisseaux. encore du travail sur cet aspect du jeu,
amènent à décider de leur application, Une fonctionnalité assez classique, mais alors on se gardera de tout jugement
par exemple entre un nouveau moteur qui, contrairement à la gestion assez hâtif. Et vous, de tout achat hâtif, ce serait
et une nouvelle arme pour les vaisseaux sommaire de l’économie et des planètes, mieux.
– ou l’inévitable course à la colonisation semble particulièrement profonde dans
de planètes plus ou moins accueillantes Master of Orion. Sur un châssis, le joueur
ou riches en minerai qui constitue tout peut disposer d’un capital de « place »
le sel du premier tiers d’une partie qui se pour intégrer un tas d’armes différentes, En l’état :
respecte. Avec quelques particularités, des missiles aux lasers, en décidant Attendez, attendez, attendez.
tout de même, telle la répartition de leurs arcs de tir et de leurs options Attendez que toutes les
de la population sur les différents de bonus, les moteurs, les boucliers, fonctionnalités manquantes à
emplacements générateurs de recherche, les blindages, jusqu’aux dispositifs de Master of Orion soient intégrées,
parce que ça ne sert à rien de
lancer une partie bancale, même
pour voir. Attendez que l’IA puisse
faire autre chose que regarder
TEWWIVPIWXVEMRW&XXIRHI^IRǻR
de déterminer votre propre attente
vis-à-vis d’un 4X spatial car il est
à peu près certain que pour le
vétéran du genre,
il risque de ne
pas rendre
l’attente de
)ĻÚĮåžžƐ„Ť±ÏåƭƞƐ
ou Stellaris
moins longue.
Attendez, quoi. Attendez
Canard PC | 63
EN CHANTIER

Genre :
FPS du Colonel
Moutarde
The Ship : Remasted
)³ZIPSTTIYVcc
³HMXIYVc
Un jeu tellement coule par Kahn Lusth

Ĭ±DŽĜĹč:ųĜþĹ
J’ai beaucoup aimé The Ship, pour la livres sterling ne l’ait rendu invisible en dehors de
(Royaume-Uni)
simple raison que ce jeu était un véritable la Grande-Bretagne. Les cons. Les joueurs n’en ont
Plateforme : eu, bien évidemment, rien à foutre et le studio s’est
PC Windows générateur d’anecdotes. Ah, les potes
retrouvé coincé avec un premier titre dont les termes
(SRǻK explosés à coups de rames sur les
du contrat lui interdisent toute modification et une
VIGSQQERH³Ic chiottes, abattus à la machette dans leur suite impossible à produire. Dans ce cas, plus qu’une
PC de joueur sommeil ou simplement enfermés dans le seule solution : recréer The Ship et agiter l’énorme
8³P³GLEVKIQIRX sauna, j’en rêve encore. Mais aujourd’hui, drapeau de la nostalgie en criant « Youhou ! Vous vous
1,2 Go le jeu revient avec une perruque et tente souvenez comme c’était bien ? ».
1ERKYI de se faire passer pour son cousin. Allez,
VO ((anglais) rentre chez toi, The Ship. Tu es saoul. « Multi » joueur(s). Au programme, une croisière
Prix actuel : où les passagers sont les victimes du jeu pervers d’un
environ
envir 20 € homme masqué qui les oblige à identifier et tuer leur

C
Sortie prévue
p : ’est en novembre 2011 que Blazing Griffin cible, tout en se débarrassant de leur chasseur. Dès
mai 2016
m rachète les droits de The Ship, auprès l’écran d’accueil, The Ship : Remasted suit l’exemple
DRM : d’Outerlight qui n’en avait certainement de son aîné, reprend sa musique et ses sons, mais
Steam
plus grand-chose à foutre, après le bide de Bloody nous laisse galérer pour trouver d’autres joueurs
Good Time. Suite à cela, les nouveaux propriétaires sur l’Internet omniscient. En réalité, le titre est loin
de la licence ont donc lancé vers la fin 2012 un d’être prêt pour le multijoueur en ligne, puisqu’une
financement participatif pour développer une suite bidouille lui fait croire que les serveurs distants sont
steam punk du titre, baptisée The Ship 2 : Full Steam présents dans le réseau local. En conséquence, la
Ahead. Hélas, la campagne s’est méchamment plantée limite maximale de 16 joueurs s’effondre à 4, pour
en ne récoltant que 18 000 livres de promesses peu que l’on ait le malheur de jouer sur le Net. Mais
de dons, pour un minimum fixé à 128 000 livres. pour en arriver là, il faudra trouver des gens moins
Avant de sortir des radars, les développeurs ont dupes que le soft, car en plein samedi après-midi,
tout de même tenté un ultime coup de poker sur Remasted ne comptabilise que trois joueurs qui
Steam Greenlight, craignant qu’un Kickstarter en auraient joué dans l’heure précédant mon arrivée,

64 | Canard PC
contre 55 chez son prédécesseur. Si avec
ça, les développeurs ne glissent pas des
antidépresseurs dans leur machine à
café…

Ça ne me bot pas des masses. C’est


donc face à des bots que l’on fait ses
premières armes dans l’espoir qu’un jour,
les clients soient un peu plus nombreux.
Pour l’instant, le jeu nous permet
d’arpenter quatre cartes dans trois modes
différents. Dans le premier (et l’unique,
diront les puristes), la Chasse, chaque
joueur se voit désigner une cible à abattre
au début de chaque round. Il suffit alors
de fouiller le navire pour y trouver une
arme, puis d’exploser sa proie aussi
discrètement que possible, puisque celle-
ci peut aussi nous tuer sans recevoir le fendre la gueule, le classement final ne sons qui manquent, corriger la physique
moindre malus. Ainsi, on marche l’air de se fait pas en fonction des morts mais et rendre les coups de latte un peu plus
rien pour s’approcher, puis on comprend grâce aux gains générés par « l’originalité viscéraux. Sans parler des bugs plus ou
que sans joueurs pour nous accompagner, » des armes utilisées. Par exemple, plus moins amusants qui hantent actuellement
le titre perd toute sa dimension les joueurs se servent d’un pistolet et le soft, par exemple des personnages qui
psychologique. Et ce ne sont pas les bots plus sa récompense devient ridicule, sortent leurs couverts de table pour aller
qui pètent régulièrement les plombs en tandis que les équipements délaissés vont aux toilettes, un inventaire qui devient
courant avec une arme à la main qui me voir leur cote grimper en flèche. Bien parfois inutilisable et le framerate qui
feront dire le contraire. entendu, rien ne vous empêche d’ignorer peut s’effondrer à 2 FPS, sur un simple
l’excellent mode Chasse pour jouer en changement de niveau. Eh oui, The Ship a
Dormir ou mourir, il faut choisir. élimination, où chaque assassinat vous toujours été un excellent jeu incompris et
Pourtant, les occasions de meurtres ne assure une nouvelle cible, jusqu’à ce que quelque chose me dit que ça n’est pas près
manquent pas, chacun devant composer tout le monde soit mort, ou encore en de changer.
avec une jauge de faim, de soif, de deathmatch, sans intérêt. Après tout,
sommeil, de distractions et de sociabilité, qui suis-je pour vous juger ? Une figure
imposant de dormir, manger, discuter patriarcale imaginaire et digne de
avec les PNJ, prendre sa douche et faire confiance ? Allons.
régulièrement son popo. Facile ? Pas En l’état :
vraiment, étant donné que brandir une Un homme à l’amer. Ceux qui ont Faut-il attendre un jeu qui se
arme sous le nez d’un vigile nous envoie déjà joué à The Ship doivent déjà s’en contente d’ajouter une poignée de
illico en prison et ce, pendant plusieurs douter : Remasted ne sera donc qu’une polygones et des textures HD à la
dizaines de secondes. Et afin d’éviter version HD. Quoique, en parlant de VIGIXXISVMKMREPIc$5VSFEFPIQIRX
que tout le monde ne se contente de « haute définition », il faut avouer que pas, surtout si vous avez déjà essoré
décrocher les haches de pompier pour se le titre ne brille pas pour sa plastique, le premier The Ship5SYVPIWEYXVIW
avec ses polygones qui manquent à l’appel Remasted pourrait être l’occasion
et ses éclairages souvent simplistes. En de découvrir un excellent titre, à
fait, seules les textures nous rappellent condition que les
encore que sa date de sortie est située aux développeurs
alentours de mai prochain. Oui, Blazing parviennent
Griffin devrait distribuer sérieusement à terminer le
les coups de fouet pour sortir son boulot dans le
titre dans un délai aussi court, avec ses tout petit délai
onze cartes, la possibilité de nager, des qui leur est
ascenseurs enfin fonctionnels, rajouter les imparti. Attendez
Canard PC | 65
EN CHANTIER

Ge
Genre :
RP / Rogue-like
RPG

)³ZIPSTTIYVc
éd
éditeur : Pera
Ga
Games (Turquie)
Pla
Plateformes :
PC Windows, Mac
(S
(SRǻK
VIG
VIGSQQERH³Ic
n’im
n’importe quel PC

8³P³GLEVKIQIRX
570 Mo
1E
1ERKYI
VO
VOST anglaise

Overfall Pri
Prix actuel :
en
environ 10 euros
Jeu, tue, îles... par Guy Moquette DR
DRM : Steam

La requête a beau ne pas déborder de carte du monde enclenche une petite (pas trop lourdingues, fait rare !) à la
HƶSVMKMREPMX³HMǽGMPIHIVIJYWIVHI saynète qui amènera tantôt un gain de pop-culture et ses situations absurdes
WEYZIVPIQSRHIYVXSYXUYERHGƶIWX ressource, tantôt une situation qui pourra se aux contre-pieds parfois délicieusement
HIQERH³KIRXMQIRX*XIRGSVITPYW régler diplomatiquement ou à grand renfort idiots font passer la pilule. Preuve que le
UYERHSRIWXWSMQ´QIHMVIGXIQIRX de baffes… et parfois un peu tout cela à la studio mise énormément là-dessus, il met
VIWTSRWEFPIHYQIVHMIVIRETTVSGLI fois. Arrosez l’ensemble de l’opportunité en avant le « parrain » Chris Avellone
d’agrandir l’équipe (jusqu’à quatre héros), et son guide d’écriture fourni avec le
d’un système de réputation – il faut jeu, visant à conseiller et encourager la

O
h, c’est une longue histoire. Mais s’acoquiner avec plusieurs factions pour communauté à enrichir Overfall de quêtes
en gros, votre duo de héros revient pouvoir l’emporter – et une progression et mini-scénarios concoctés par les joueurs
de mission sur un autre monde, dynamique des envahisseurs vorns, qui vont eux-mêmes. À défaut de le rendre profond,
quelque 300 ans se sont écoulés et c’est un progressivement mettre à sac toutes les îles juste et véritablement tactique, cela fait au
merdier indescriptible. Toutes les factions de la carte, et vous savez tout. moins d’Overfall un jeu sympathique.
sont en guerre les unes contre les autres
et une horde d’envahisseurs brutaux se Archipel à tartes. Enfin, presque tout.
déverse par le portail qui vous a servi Il y a des affrontements dans le jeu de Pera
à rentrer. Pour couronner le tout, une Games. Beaucoup. Un peu brouillon et En l’état :
prophétie vous désigne arbitrairement pas très profonds, les combats au tour par On aurait presque pu mettre
comme le seul espoir. Alors vous vous y tour d’Overfall se trouvent précisément ncWERWHERKIV~XERXOverfall est
collez. Et vous mourrez lamentablement. entre « boarf » et « mouais » sur l’échelle propre, dénué de bugs majeurs,
Et vous recommencez. Car oui, Overfall de la boffitude. Pour ne rien arranger, le jouable en l’état si l’on n’attend
est entièrement basé là-dessus : une côté aléatoire des rencontres peut amener TEWHIPYMTPYWUYIGIUYƶYRNIYª
mort permanente suivie d’une nouvelle à un combat quasi perdu d’avance… sans cIYVSWX]TMUYIQIRXEHETXEFPI
tentative. Mais entre-temps, vous aurez jamais offrir la moindre possibilité de WYVXEFPIXXIIWXªQ´QIHIJSYVRMV
– peut-être, car c’est un peu longuet dans fuite et donc à même d’interrompre Mais on a envie
la version actuelle – débloqué de nouvelles brutalement un run qui se déroulait de pinailler un
classes de personnages, de nouveaux jusque-là à merveille. Heureusement, un peu, alors on va
équipements et compétences susceptibles crochet du droit dans le pif ou un doigt attendre un peu
de rendre le nouvel essai différent, dans l’œil passent toujours mieux avec d’équilibrage
possiblement plus facile. une petite vanne. De ce côté, l’univers HERWPEHMǽGYPX³
Par bien des aspects, Overfall rappelle foutraque d’Overfall, ses humains teigneux, et la vitesse de
FTL. Chaque île de l’archipel qui fait office ses elfes hippies, ses multiples clins d’œil progression. Attendez
66 | Canard PC
En kiosque
Canard PC Hardware n°2 7
5,90 €

NOUVELLLEE
FORMU
T
ORDINATEUR
TECHNO

Et Pi y’a l’Odroid aussi


L'ACTUALITÉ DE CE QU'IL Y A SOUS LE CAPOT

NEWS

ous êtes encore tout tremblotant suite à l’an-


PAR FISHBONE AUDIO

Jack a
disparaît ?

V nonce du Raspberry 3, parce que vous êtes


comme ça, un grand émotif devant l’Éternel.
D’ailleurs, ce n’est pas pour rien que vous avez pleuré à
GPU
la fin de La Soupe aux choux. Bref, vous n’avez pas fini de
sangloter dans le mouchoir en tissu avec vos initiales bro- Intel fait
dées par Tata Roberte pour vos 30 ans, car dans la foule
des micro-ordinateurs à tout faire, existe également
son marché
l’Odroid-C2 du fabricant HardKernel, la boîte qui a le Le dernier rapport de Jon Peddie
Kernel tout dur en toute circonstance. Pour 40 dollars, Research sur les puces graphiques
cinq de plus que le Raspberry Pi 3, vous disposez cette confirme la baisse générale du
fois d’un quad-core 64 bits ARM Cortex-A53 cadencé à marché en 2015 (–14 %), un
2 GHz, d’un GPU Mali-450, de 2 Go de RAM, de quatre fléchissement qui, logiquement,
ports USB 2.0, un port USB 2.0 OTG (échange direct de suit celle du marché PC (–8 à Depuis quelques semaines, le
données entre deux périphériques), d’un port Ethernet –10 % selon les instituts). Quoiqu’il Web est émoustillé par la rumeur
Gigabit, d’un port HDMI 2.0 (4K/60 Hz, H.265/H.264), en soit Intel engouffre 71,6 % du d’abandon du bon vieux port au-
d’un connecteur GPIO 40 broches et 7 broches 12S. Reste marché graphique (+ 0,1 %), Nvidia dio jack 3,5 mm par les prochains
que cette machine, plus fermée que les Raspberry Pi, ne 16,6 % (+ 1,6 %) et AMD 11,8 % iPhone. Il est vrai que si Apple
dispose pas du même support développeur/communauté (- 1,9 %). Les ventes de cartes décide de franchir le pas, il y a
que ces derniers, ce qui restreint d’autant son public. graphiques haut de gamme, avec de fortes chances que le reste des
Également, elle ne propose ni le Wi-Fi, ni le Bluetooth, 5,9 millions d’unités, ont doublé. fabricants suive le mouvement
qu’on se le dise. En résumé, pour faire votre choix, c’est Sur ce créneau, Nvidia domine à plus ou moins brève échéance.
soit la biscotte beurrée sans confiture, soit la biscotte avec 78,8 % des cartes livrées au Un changement de paradigme, du
avec confiture mais sans beurre. dernier trimestre. niveau de l’abandon de la cassette
magnétique, dont d’ailleurs je
STOCKAGE ne me suis toujours pas remis.
16 To RÉALITÉ VIRTUELLE Cette éviction aurait pour but
de gagner en finesse de châssis
au garot
Samsung a présenté
Le prix de l’immersion (pliable), avec le remplacement du
port analogique par le connecteur
le PM1633a, un SSD C’est au tour du casque de réalité virtuelle de Valve/HTC, le Vive, d’être vendu en propriétaire de l’iPhone pour
SAS 12 Go/s destiné précommande. Pour la modique somme de 900 euros environ – plus des frais de connecter un casque idoine, ou
aux entreprises d’une port improbables de 73,20 euros car livré avec un poney mort –, vous disposerez par le Bluetooth pour une diffu-
capacité de 16 To. OK, du casque accompagné de deux manettes sans fil, de deux stations de base pour sion sans fil. Autre conséquence
OK, on exagère un peu, le suivi des mouvements à 360° e t des applications Tilt Brush (peinture virtuelle), logique de ce choix, le smart-
en fait, c’est 15,36 To. Fantastic Contraption (construction de bidules) et Job Simulator (simulation débile phone ne serait définitivement
Les débits en lecture et de travail où vous mangez des donuts et balancez des objets. Et pas plus, je sais à plus en charge de la conversion nu-
écriture séquentielles quoi vous pensez bande de coquins). Pour rappel, la résolution du casque est de mérique-analogique, puisque cette
montent à 1 200 Mb/s 2160 x 1200 à 90 Hz, avec 110° de champ visuel. Le fait que le Vive soit vendu dernière reviendrait au dispositif
- contre 500 Mb/s 200 euros de plus que l’Oculus Rift n’a pas empêché 15 000 exemplaires d’être d’écoute. Quoi qu’il en soit, l’idée
en moyenne pour les précommandés durant les dix premières minutes de vente. De son côté, de la suppression du mini-jack
SSD grand public -, HP a dégainé le sticker « certifié pour la réalité virtuelle » sur ne plaît pas à tout le monde,
aidés par une mémoire ses machines de jeu puisqu’une pétition a recueilli
cache de 16 Go. Enfin, « Envy Phoenix » 300 000 signatures pour s’y op-
le disque revendique (AMD Radeon R9 poser. C’est que l’humanité sait se
200 000 IOPS en 390X 0G min), fruit mobiliser pour les grandes causes,
lecture et 32 000 en d’une collaboration avec vous admettrez. Par ailleurs, je
écriture. Le prix n’est pas HTC, 1 300 dollars dis ça, je dis rien, un brevet d’un
communiqué mais au minimum. Dans ce casque EarPod hybride bluetooth
fond de vous, quelque contexte, la VR, c’est un et connexion magnétique à un
chose vous dit que vous budget minimum de jack, déposé en 2011, vient juste-
ne voulez pas savoir. 2 200 euros. ment d’être accordé à Apple.

68 | Canard PC
SÉCURITÉ

Paye ta biométrie
La biométrie au service par Google, nous dit Goo-
des paiements a le vent gle. En France, la Banque
en poupe, car au-delà de la Postale va lancer un nou-
sécurité qu’elle est censée veau service au nom bien
apporter, moins le consom- franchouillard de « Talk to
mateur doit faire d’efforts Pay  », avalisé par la CNIL,
pour acheter, mieux c’est afin de valider un paiement
pour les affaires. Afin d’ac- en ligne par la voix. L’utilisa-
compagner le développe- teur recevra un appel télé-
ment de son portefeuille phonique, prononcera une
électronique « Google An- phrase d’authentification, et VOITURE AUTONOME
droid Pay » – officiellement recevra en retour un cryp-
1,5 million de nouveaux
utilisateurs chaque mois
togramme (CVV) à usage
unique.
Et là, c’est le crash
et accepté par 2 millions l fallait bien que ça ar- sur la voie centrale pour continuer son
de commerces aux États-
Unis  –, la firme teste ac-
tuellement à San Francisco
I rive, après six ans d’essais
concluants et 2,3 millions de
kilomètres parcourus sans accrocs  :
bonhomme de chemin autonome, les
algorithmes estimant que le bus qui
arrivait à faible allure sur cette même
« Hand Free », une solution une Google Car autonome a été re- voie allait s’arrêter. Sauf que non, il ne
Android/iOS où l’utilisateur connue « en partie responsable » d’un s’est pas arrêté, le bus. C’est que Bill,
donne ses initiales pour ef- accrochage avec un bus, en février der- le conducteur, il n’est pas du genre à
fectuer le paiement (!). La nier près du siège social de Google à se dégonfler devant une Google Car,
reconnaissance faciale est Mountain View. Pas de victimes ni de c’est un vétéran, il a fait Disneyland.
également étudiée, avec blessés, pas même un écureuil, juste Résultat, un flanc à repeindre et une
la présence d’une caméra de la tôle froissée. Pour ce qui est des campagne de communication pour
sur la caisse qui compare circonstances – et là, j’ai l’impression Google  : «  Si notre voiture n’avait pas
la photo prise avec celle de remplir un constat à l’amiable –, la bougé, il n’y aurait pas eu d’accident »,
présente dans Hand Free. Google Car était sur la voie de droite, à a-t-il admis. L’« IA » va être patchée
Les informations sont ef- l’arrêt car bloquée par des sacs de sable pour lui faire comprendre qu’un bus ou
facées après le paiement non autonomes. La courageuse Google un camion, dans le doute, on ne fait pas
et ne sont pas collectées Car prend alors l’initiative de passer sa fière et laisse passer.

SÉCURITÉ CONSOLE
DRONES

Drones SlySoft a craqué Coleco-


Margoulinerie ?
de courses lySoft, l’éditeur du logiciel fondement pendant cette déclara-
Dubaï a toutes les
chances de devenir S AnyDVD, pourfendeur de
la protection AACS des
tion totalement naturelle. Comparé
à l’AACS, l’AACS 2.0 dispose en plus
la capitale des Blu-ray afin de réaliser pépère des d’un mode amélioré qui nécessitera
courses de drones, copies privées de ses galettes dû- une connexion internet pour récupé-
avec l’organisation ment achetées, a officiellement fermé rer la clé de chiffrement. Le choix du
la semaine passée ses portes (parce qu’officieusement, mode de protection utilisé par l’AACS
de la première c’est une autre histoire, cherchez 2.0, basique ou amélioré, sera laissé au
édition du « World « RedFox »). Il faut croire que la pres- producteur du contenu.
Drone Prix ». sion exercée par les ayants droit La suspicion est de mise
Donc voilà, il s’agit –  qu’on imagine sévère, idéale concernant la Coleco-Chameleon,
d’une course de pour ouvrir un pressing indus- une console dédiée au rétrogaming
drones dotée d’un triel – a fini par payer. Du côté (Atari 2600, SNES, Intellivision)
million de dollars de Fengtao, l’éditeur du pro- dont nous avions parlé dans le
de prix, dont gramme DVDFab qui remplit dernier numéro. La campagne
250 000 dollars la même fonction qu’AnyDVD, de financement Kickstater n’a
pour le vainqueur ce dernier continue son activité pas démarré comme prévu le
qui, avec tout cet mais a cependant déclaré qu’il 26 février dernier, car des doutes
argent, pourra ne s’aventurera pas à contour- planent sur la réalité du projet. De
éventuellement ner la nouvelle protection son côté, le fabricant RetroVGS
s’acheter une vie. AACS 2.0 des prochains Blu- indique que la campagne a été
Je m’abstiendrai ray UHD 4K, ce en accord avec reportée pour « rendre la console
de tout autre les studios de cinéma, l’AACS- encore meilleure », tout en postant
commentaire LA, la Blu-ray Disc Association de nouvelles photos du prototype.
désobligeant. et le couteau qui lui piquait le Mouais…

Canard PC | 69
TECHNO L'ACTUALITÉ DE CE QU'IL Y A SOUS LE CAPOT

NEWS PAR FISHBONE

GPU
ORDINATEUR

Et Pi trois encore !? Computation


’aventure continue pour le Raspberry Pi, dont les graphique externalisée
L ventes mondiales dépassent aujourd’hui huit millions
d’exemplaires depuis sa sortie (6 millions de Rasp-
berry 1, 3 millions de Raspberry 2). Ainsi, le micro-ordinateur
nous revient dans une troisième mouture, la bien-nommée
Raspberry Pi 3. Le bambin conserve le prix de 35 dollars du Pi 2,
tandis que le matériel évolue avec un SoC 64 bits quad-core
Broadcom BCM2837 ARM Cortex A53 à 1,2 GHz (SoC quad- GPU
core Cortex-A7 à 900 MHz pour le Pi 2, ARM 11 à 700 MHz
pour le Pi). Le fabricant annonce une amélioration des perfor-
Furieusement
mances de 50 à 60 % en 32 bits, toujours comparé au Pi 2. Je attendu
vous fais grâce de la comparaison avec le Pi 1, par respect pour Un mot rapide sur la fameuse
ses proches (OK, OK… mais restez discret : 2,5 fois à 20 fois Radeon Fury X2 d’AMD à base de
selon le contexte d’utilisation). Autres douceurs, l’intégration du puce Fiji. AMD a confirmé qu’elle
Wi-Fi 802.11n et du Bluetooth 4.1 (classic, LE). Pour le reste, il est serait bien disponible à compter du
question d’1 Go de mémoire LPDDR2, d’un GPU VideoCore IV second semestre 2016. Quant aux
(la partie graphique n’évolue pas), d’un port Ethernet 100 Mb/s GPU Polaris, dont les performances
(dommage pour le Gigabit), d’une sortie HDMI, de quatre ports énergétiques devraient être le Vous savez ce que c’est : on achète
USB 2.0, d’un connecteur microSD, d’un connecteur GPIO principal atout, ils sont annoncés un ordinateur portable, voire
40 broches et d’une alimentation de 2,5 ampères (vive l’alimen- pour mi–2016. Il est également ultraportable, parce que c’est bien
tation d’un périphérique USB). Esthétiquement, rien ne bouge question du retour de puces AMD pratique pour travailler peinard
(85 x 56 x 17 mm), si ce n’est la position des LED pour faire de la dans les ordinateurs portables sur le parking de la station-
place à l’antenne de 3,47 mètres de hauteur. Pas de panique, on pour joueurs, toujours grâce à essence. Mais notre âme de joueur,
s’y habitue vite. l’architecture Polaris de veau. elle, pleure du sang dès qu’elle
songe à tous ces magnifiques
ludiciels qui resteront hors de
portée de l’asthmatique solution
INTERNET AFFICHAGE graphique intégrée au bousin.
Alors oui, les portables pour
Vers le FTTH Display Port 1.4 : « OK, Play Port 1.4 » joueurs existent, mais soyons réa-
et au-delà listes, ils ne sont pas plus adaptés
L’Arcep nous ’est sur ce titre d’un ce faire, point d’augmentation au nomadisme professionnel que
informe que le
nombre d’abonnés
C puissant humour que
nous allons parler du
de bande passante par rapport
au DisplayPort 1.3, mais unique-
vos chaussons-lapin aux réunions
du conseil d’administration du
Internet en fibre nouveau standard Display Port ment l’intégration du Display groupe LVMH. La solution réside
optique (FTTH) a 1.4, récemment officialisé par Stream Compression en version alors dans une carte graphique
atteint, fin décembre la Video Electronics Standards 1.2. Le contenu est ainsi com- externe, et diverses solutions
2015, le nombre de Association pour faire bonne pressé avec un ratio de 3:1, sans propriétaires existent déjà en ce
1,425 million sur figure face à la démocratisa- pertes visuelles, nous dit-on. sens (Alienware, MSI). C’est ici
les 5,6 millions de tion du HDMI 2.0. Comme Le VESA évoque également la qu’AMD met les pieds dans le
lignes éligibles au vous allez le lire d’ici quelques Forward Error Correction pour, plat avec la volonté d’instituer un
très haut débit (THD) secondes, il s’agit là d’une évo- devinez quoi, la correction des standard pour les GPU externes,
en FTTH (pour un lution majeure, pour ne pas dire erreurs. En ce qui concerne l’au- que cela concerne « la connec-
total de 14,5 millions totale, voire époustoutiflante, dio, ça cause 32 canaux à une tique, les pilotes, les câbles, le plug
de lignes éligibles du DisplayPort 1.3. Je sais, j’en fréquence d’échantillonnage and play, le support par le système
au THD). Un million fais des tartines alors même de 1 536 KHz. Rendez-vous  au d’exploitation, etc. ». Il est vrai
de ces abonnés qu’on attend encore le matos en mariage de votre fille qui a qu’une norme adoptée par tous
se trouvent chez 1.3… Mais ne gâchons pas la fête aujourd’hui deux ans pour les les fabricants serait une vraie
Orange, qui domine des technico-commerciaux car premiers périphériques compa- avancée pour les utilisateurs de
sans surprise ce 0.1 de différence, rien que ça, tibles. portables biclassés VRP-joueurs.
marché. Par ailleurs, ça fait baisser les yeux des plus Outre l’aspect pratique, devant
1,2 million de lignes méchants des badass. Bon OK, le nombre d’acheteurs potentiels,
THD carburent en fait le DisplayPort 1.4 signe nous pourrions assister à une aug-
à 100 Mb/s ou surtout l’affichage de conte- mentation de l’offre logiquement
plus et 1,6 million nus 8K à 60 Hz et 4K à 120 Hz accompagnée d’une guerre des
entre 30 Mb/s et en HDR «  Deep Color  »  ; prix. Nous attendons maintenant
100 Mb/s, dis-je comprendre : des couleurs pro- l’annonce officielle d’AMD, ainsi
en pleurant sur ma fondes obtenues grâce à l’esso- qu’une pizza napolitaine comman-
connexion 3G. rage de Johnny d’élevage. Pour dée il y a plus de 37 minutes et
51 secondes.
70 | Canard PC
VR

Restons réalistes
Aussi attrayante que puisse impossible en effet. Mais
paraître la réalité virtuelle, en attendant que le monde
la démocratisation de cette ne se perde définitivement
technologie nécessitera dans cette nouvelle matrice
plusieurs années encore, p l e i n e d’ i m m e r s i o n s
que l’on parle d’optimisation fantasmatiques, Guennadi
technique, de design et Riguer du programme
– nerf de la guerre – de tarif. LiquidVR d’AMD nous fait
D’ailleurs, Marko, le PDG de part de ce qu’il estime être IA DE LA JOIE

Facebook et indirectement
patron d’Oculus VR – oui,
« le nirvana de la VR ». Pour le
coup, on en est effectivement
À la recherche d’intelligences
on est assez intime je dois encore loin, avec « une acebook, dans le cadre de ses de quoi faire, si je puis dire, car ces
dire… Du coup c’est vrai que
je l’appelle facilement Marko.
résolution de 16K par
œil  (15 360 x 8 640 pixels,
F efforts de recherche sur l’in-
telligence artificielle, lance
technologies concernent aussi bien
les « voitures autonomes, les ordinateurs
Quoi mytho ? On est ami quand même), un taux de un programme européen destiné à capables de détecter des cancers, les
sur Facebook, qu’est-ce que rafraîchissement de 144 Hz, fournir 25 serveurs équipés de huit technologies de traduction instantanées,
vous voulez comme preuve voire 240 Hz (supérieur à GPU à divers instituts travaillant sur etc. » (ça c’est pour le côté « gentil »
de plus ? C’est dingue cette celui du jus de noix de coco, le sujet. Supervisée par le laboratoire de l’affaire). Le laboratoire Klaüs-
jalousie quand même…  –, donc), aucune latence, un Facebook Artificial Intelligence Re- Robert Müller de Berlin ouvre le bal,
pense que l’adoption de design compact, le tout sans search (FAIR), cette initiative a pour avec pas moins de quatre serveurs
la réalité virtuelle par le fil ». Alors oui, c’est du lourd, but de « favoriser l’essor de nouvelles dans la besace pour mener à bien ses
quidam moyen prendra même si vous avez une technologies fondées sur l’IA  », alors travaux. Les candidatures restent ou-
au moins dix ans. Pas Voodoo 3DFX pour assurer que « certaines des meilleures idées en vertes pour les serveurs restants, et si
le rendu. Mais pour autant intelligence artificielle proviennent du votre projet sur la « reconnaissance des
que Nibiru ne nous ait rayé la monde académique et que ces chercheurs melons mûrs par IA » est retenu, vous
peinture d’ici là, évidemment doivent mener leurs recherches avec des aurez droit à l’envoi de chercheurs
qu’on y arrivera. Psy technologies informatiques parfois limi- FAIR pour vous «  aider » dans vos
spécialisé en schizophrénie, tées », comme le précise Yann LeCun, recherches. Ah ben tiens, je me disais
métier d’avenir. directeur du FAIR. C’est vrai qu’il y a aussi.

CPU SÉCURITÉ DRONE

Elle a les La sécurité ou la vie privée Un air de miss


puces révolver
Les nouvelles a fronde contre le FBI qui, à laquelle toute la Silicon Valley devra
architectures AMD
et Intel arriveraient L s’appuyant sur la loi « All
Writs Act » de 1789, veut for-
ensuite se soumettre. «  Étant donné
l’interprétation sans bornes de l’All Writs
pour la fin de l’an- cer Apple à fournir un outil permettant Act par le gouvernement, il est difficile de
née, les AMD Zen d’accéder aux données chiffrées d’un concevoir la moindre limite dans ce qu’il
socket AM4 d’un appareil iPhone 5C en rapport avec pourrait bien obtenir dans le futur (…).
côté, les Intel Kaby la fusillade de San Bernardino, enfle Qu’est-ce qui empêchera le gouvernement
Lake de l’autre, les méchamment. D’une part, la justice a de demander qu’Apple écrive du code
ballots de paille donné raison à la Pomme concernant pour activer le microphone afin d’aider à
qui virevoltent l’inapplicabilité de cette loi permettant la surveillance, activer la caméra vidéo, Un Airbus d’Air France
dans la rue du sa- aux autorités d’obtenir l’aide d’une per- enregistrer furtivement les conversations effectuant la liaison
loon pendant que sonne physique ou morale. De l’autre, ou activer les services de géolocalisation Barcelone - Paris a effectué
le croque-mort les soutiens à Apple se multiplient pour traquer la position de l’utilisateur ? une manœuvre d’évitement
prend les mesures comme les comédons sur le front de Rien.  », déclare en substance le juge le 19 février dernier pour ne
au centre. Les votre petit-frère en phase pubère, allant Orenstein dans le cadre d’une autre pas percuter un drone volant à
productions de de l’EFF à un proche d’une victime, en affaire. Merci qui ? Merci Snowden. 1 700 mètres d’altitude. L’avion
masse débute- passant par Amazon (qui pourtant a était en phase d’atterrissage et
raient au troisième désactivé le chiffrement de FireOS), le drone suffisamment gros
trimestre pour Box, Cisco, Dropbox, Evernote, Face- pour être repéré par le copilote.
Intel, début 2017 book, Google, Microsoft, Mozilla, L’engin est passé à « environ
pour AMD. Nous Nest, Pinterest, Slack, Snapchat, cinq mètres en-dessous de
devrions donc WhatsApp, Yahoo, Mozilla, AVG, l’aile gauche », a-t-il précisé.
disposer de juteux AT&T, Twitter, Reddit, Square, Kicks- Pour info, un drone civil n’est
benchmarks pour tarter et tant d’autres. Pour le FBI, pas censé voler à plus de
la bûche. l’enjeu est de créer une jurisprudence 150 mètres d’altitude.

Canard PC | 71
TECHNO L'ACTUALITÉ DE CE QU'IL Y A SOUS LE CAPOT PC & CO
PAR FISHBONE

Le tour Tavolga Terminal


du TB-T22BT - T-Platforms

périph’ Si vous n’avez rien contre la technologie


russe, voici un ordinateur tout en un en
provenance directe de l’Est, le Terminal
TB-T22BT. « Talvoga », non pour intimer le
silence à quelqu’un alors qu’on est sous
l’emprise de l’alcool et qu’on a du mal à
parler correctement, mais pour « la reine
des prés », en russe donc. C’est poétique, benchmark CoreMark cadencé à 1,2 GHz,
ça nous change des qualificatifs surfaits sa fréquence d’origine, à comparer au score
« Ultra X bidule » habituellement employés de 5,18 CoreMark/MHz obtenu par Intel
par l’industrie. Derrière l’écran IPS Full HD Core i7-2640M), accompagné de 8 Go de
de 21,5 pouces (1920 x 1080) se trouve un mémoire DDR3 max., 8 à 64 Go de stockage
processeur dual-core Baikal-T1 processor Flash, de quatre ports USB 2.0 et d’un
1 GHz basé sur le MIPS P5600 d’Imagination port Ethernet Gigabit. Livré avec Debian
(score de 5,6 CoreMark/MHz au Linux 8, son prix environ reste un mystère.

Wooting One
Wooting
EK-KIT Dans la famille des claviers mécaniques pour
joueurs qui sortent de l’ordinataire (ah tiens, je
P240/P280/360 - EKWB crois que je ne l’ai jamais faite celle-là…), voici
le Wooting One, en provenance de la société
Refroidir les composants de de gamme », avec un tarif qui néerlandaise Wooting. Non, ils sont ne pas encore
votre machine avec de l’eau, suit cette logique : de 320 à connus mais qu’importe, puisque leur approche
ça vous tenterait bien, mais 340 euros selon le modèle. est pour le moins intéressante. Car les touches
c’est un peu comme le saut à A priori, nous ne sommes donc du clavier, en plus d’être mécaniques, s’avèrent
l’élastique : vous avez envie, mais pas dans une offre à la petite analogiques. Comprendre qu’elles fonctionnent
peur de vous lancer. En plus, semaine trouvée au rayon de la même façon qu’un sticker de manette, ce
déjà que vous peinez à ne pas promo d’une grande surface, qui permet, dans un cadre vidéoludique à vocation
vous blesser avec les meubles entre un paquet de sablés et divertissante, de contrôler précisément une
en kit d’origine suédoise… des cahiers de coloriage avec voiture dans un jeu de course ou le coup d’œil furtif
Heureusement, EKWB a pensé des lapins. Les différences de votre héros planqué derrière un mur comme
aux gens dans votre situation entre les kits concernent un gros lâche. Certes, cela change les habitudes ;
et propose à la vente trois kits principalement la taille il reste à tester la précision de la chose mais
complets de watercooling, les (120 mm, 140 mm) et le nombre au moins, c’est innovant. Par ailleurs, Wooting
EK-KIT P240/P280/360. Les de ventilateurs inclus (2 ou 3). parle de touches mécanique rouges Cherry MX
pièces sont estampillées « haut Actuellement en vente environ. Red, mais en mieux. Le clavier est rétroéclairé
RGB et ne dispose pas de pavé numérique. Un
clavier à suivre, en attendant un prix ou une date
de disponibilité (non, pas environ, j’ai pas envie).

72 ||Canard
CanardPC
PC
GADGETS

Dreem Rhythm
Puisqu’il est analysée en temps
aujourd’hui devenu réel. Une fois le
inconcevable de dormeur plongé dans
vivre sans disposer le sommeil profond
d’un périphérique ou (lent), Dreem émet un
une application pour son par conduction
nous y aider, voici osseuse afin d’allonger
Dreem de la société la durée de ce dernier.
neurotechnologique Car plus vous dormez
Rythm. Il s’agit d’un profondément, plus
casque connecté vous êtes en forme
qui se porte pendant pendant la journée,
le sommeil, afin nous explique-t-
– prétendument – on. Outre cette
d’améliorer ce fonctionnalité, celle
SkyWall 100 dernier et donner un du réveil au meilleur
regard inspiré à son moment de vos
Les personnes souhaitant lutter efficacement contre utilisateur. Couplé phases de sommeil
la prolifération des drones – à l’instar des personnels à l’incontournable est également de la
chargés de la sécurité de zones sensibles par application, Dreem va partie. En attendant la
exemple – jetteront un oeil intéressé sur le SkyWall procéder à un électro- commercialisation, les
100, un bazooka lance-filet destiné à rattraper ces encéphalogramme inscriptions à la phase
bestioles en plein vol. Inventé par quatre ingénieurs de l’activité cérébrale de test sont ouvertes.
britanniques, ce bazooka à air comprimé lance le afin que celle-ci soir 350 dollars en aviron.
filet à une distance de 100 mètres, avec un temps
de rechargement de huit secondes. Pour aider le
tireur à atteindre sa cible, un système de visée l’aide
à pointer le bazooka au bon endroit pour anticiper
le déplacement du drone. Une fois capturé, le filet et
sa proie rejoignent le sol paisiblement à l’aide d’un
parachute, car l’objectif n’est pas la destruction du
colis livré par les airs… euh non, de l’appareil je veux
dire. Si le projet va à son terme, le SkyWall 100 sera
disponible en fin d’année. Fonctionne également à
l’horizontale pour capturer des enfants hyperactifs ou
qui répondent de manière insolente à leurs parents.

Eagle-360 Goodyear
Le pneu sphérique, c’est peut-être veiller au grain et informer
l’avenir. Goodyear a présenté correctement l’IA qui gérera les
au dernier salon de Genève véhicules autonomes auxquels
l’Eagle-360, un concept de pneu les Eagle-360 sont destinés.
imprimé 3D et maintenu par « À l’avenir, les pneus concepts
« lévitation magnétique », censé de Goodyear auront un double
offrir une meilleure sécurité et rôle : celui de bases créatives
manoeuvrabilité. La conduite est pour dépasser les limites d’idées
annoncée comme « plus fluide » conventionnelles, et celui de
et les risques de dérapage réduits, bancs d’essai pour de nouvelles
sans parler de la possibilité de technologies de pointe », a
braquer à 360°, ce qui relèguera déclaré dans une envolée lyrique
les créneaux à la préhistoire Joseph Zekoski, vice-président
de l’automobile. De multiples et directeur de la technologie
capteurs sont implémentés pour de Goodyear. C’te classe.

Canard PC | 73
TECHNO CONFIGS DE CANARD FIABILITÉ, PERFORMANCES, PRIX

Configs de Canard NOS TROIS CONFIGS POLYVALENTES

Bien choisir une nouvelle machine exige du temps et un certain goût pour les chiffres : il convient d'analyser en profondeur les performances de centaines de
composants puis, une fois la litanie de benchmarks scrutés à la loupe, s'assurer qu'aucun composant n'ira en brider un autre et que tous soient compatibles entre
eux. Pour vous faciliter la tâche, nous avons imaginé les Config' de Canard. L'objectif ? Vous faire profiter de notre expertise sur les multiples composants que nous
testons à longueur d’année en vous proposant trois PC "tout faits", au rapport performances/prix imbattable. Quel que soit votre budget, vous aurez l’assurance d’une
sélection soignée de composants, issue de méthodologies sadiques et de nos procédures de test les plus cruelles. Bien que polyvalentes, les Configs de Canard sont
d’abord des machines de joueurs et nous avons privilégié les performances graphiques maximales dans les différentes gammes de prix.

A fin de vous faire profiter en pratique de nos conseils,


celles-ci sont proposées à la vente chez notre partenaire
Materiel.Net, montées et testées par leurs soins. La démarche
une indépendance totale vis-à-vis des composants. Nous
attirons également votre attention sur le fait que nos choix ne
sont pas dictés uniquement par les performances brutes et le
n’a rien de lucratif : nous ne touchons pas un centime de prix. L'évolutivité et les taux de retour SAV constatés jouent
commission sur les ventes, ce qui nous permet de conserver aussi un rôle prépondérant.

ENTRÉE DE GAMME
ŽŶĮŐƵƌĂƟŽŶĚŝƐƉŽŶŝďůĞĐŚĞnj

Ducky XXViI 6mois Ě͛ĂďŽŶŶĞŵĞŶƚŽīĞƌƚƐ


ăĂŶĂƌĚW,ĂƌĚǁĂƌĞ͊
environ
600 €
P our cette 27e³HMXMSRRSYWEZSRWPSRKYIQIRXV³Ǽ³GLMªFEWGYPIV
SYTEWWYVPIWRSYZIEY\5IRXMYQO]PEOI.PW EZ²VIIRH³ǻRMXMZI
qu'à performances égales, le surcoût pour l'ensemble de la plateforme
Processeur
Ventirad
Intel Pentium G3258
Stock
70 €
0€
WIVEMXHI GIUYMRIWINYWXMǻITEW1I5IRXMYQ, YRHYEPGSVI Carte mère Asus B85M-G C2 75 €
RAM 2x Crucial DDR3 4 Go PC12800 70 €
-EW[IPPª,-^VIQTPMXXSYNSYVWWSRSǽGIEZIGFVMSHERWP IRXV³IHI
Carte graphique GeForce GTX 950 OC 180 €
KEQQIIXMPHIQIYVIPIWIYPªTSYZSMV´XVISZIVGPSGO³XV²WJEGMPIQIRX
Carte son Intégrée à la carte mère 0€
3SYWZSYWGSRWIMPPSRWHIPITEWWIVHMVIGXIQIRXªSY,-^GIUYM
Disque dur Seagate Desktop HDD 1 To 55 €
devrait rester silencieux avec le ventirad de base. Il est accompagné par
Graveur DVD Sony Optiarc AD-5280S 20 €
YRIGEVXIQ²VI&WYW'2, WPSXWQ³QSMVI\,SHI))7
Alimentation Corsair CX430 50 €
une GeForce GTX 950 et un disque dur 1 To 7 200 tr/min de Seagate. Boîtier Cooler Master N200 50 €
)²WUYIZSXVIFYHKIXPITIVQIXXVEENSYXI^PYMYR)HI,S

MILIEU DE GAMME
environ

6mois
ŽŶĮŐƵƌĂƟŽŶĚŝƐƉŽŶŝďůĞĐŚĞnj environ
CanHard XXViI Ě͛ĂďŽŶŶĞŵĞŶƚŽīĞƌƚƐ
ăĂŶĂƌĚW,ĂƌĚǁĂƌĞ͊
нϮŵŽŝƐăĂŶĂƌĚW͊ 1 100 €
R MIRHIRSYZIEYTSYVPE(ER-EVHHITYMWP ³HMXMSRTV³G³HIRXIc
les tarifs des composants principaux n'ont que peu évolué. Nous
VIQTPE±SRWXSYXHIQ´QIPI)'<,SHI(VYGMEPTEVPI
Processeur
Ventirad
Core i5-6500
Cooler Master TX3 EVO
225 €
20 €
Carte mère Gigabyte GA-B150M-D3H 95 €
*:4HIEQWYRK IXRSRTEVPI'<UYMW EZ²VIZVEMQIRX
RAM 2x G.Skill Value DDR4-2133 4 Go 60 €
XVSTTSYWWMJ.PVIWXI³ZMHIQQIRXEGGSQTEKR³TEVYR-))HI8S
Carte graphique GeForce GTX 970 350 €
1E(ER-EVH<<:..MRX²KVIXSYNSYVW,SHI))7YRIGEVXI
Carte son Intégrée à la carte mère 0€
Q²VI,MKEF]XI,&'2)-IXYR(SVIM UYEHGSVIª
SSD Samsung 850 EVO - 256 Go 95 €
c,-^(¿X³GEVXIKVETLMUYIRSYWGSRWIVZSRWPE,I+SVGI,8< Disque dur Barracuda SATA 6 Gb/s - 2 To 85 €
970, capable de faire tourner sans sourciller tous les jeux récents avec Graveur DVD Sony Optiarc AD-5280S 20 €
YRXV²WLEYXRMZIEYHIH³XEMP1 IRWIQFPIIWXEPMQIRX³TEVYRI7EMHIV Alimentation FSP Raider S 550W 60 €
;HI+5IXTVIRHTPEGIHERWPIXV²WWSFVI QEMWXV²W³P³KERX Boîtier Fractal Design R5 110 €
)IǻRI7HI+VEGXEP)IWMKR

HAUT DE GAMME

12mois
ŽŶĮŐƵƌĂƟŽŶĚŝƐƉŽŶŝďůĞĐŚĞnj

Duck Nukem XXVII Ě͛ĂďŽŶŶĞŵĞŶƚŽīĞƌƚƐă


ĂŶĂƌĚW,ĂƌĚǁĂƌĞ͊
environ
1 900€
нϯŵŽŝƐăĂŶĂƌĚW͊

M algré la hausse substantielle de prix du Core i7 6700K due à la


pénurie sur les CPU Skylake depuis leur lancement, nous avons
choisi de conserver cette plateforme qui demeure la plus rapide
Processeur
Ventirad
Core i7 6700K
Noctua NH-U12S
470 €
65 €
Carte mère Asus Z170-P 135 €
actuellement pour les jeux vidéo. Cette bête de course (quad-core RAM 2x Kingston HyperX Fury DDR4-2133 8 Go 120 €
HT à 4/4.2 GHz), refroidie par un Noctua NH-U12S et accompagnée Carte graphique GeForce GTX 980 550 €
HIc,SHI))7XVSYZIVEWETPEGIWYVYRI&WYW>5MPI Carte son Intégrée à la carte mère 0€
cœur vous en dit, vous pourrez même l'overclocker facilement jusqu'à Disque dur Barracuda SATA 6 Gb/s - 3 To 110 €
4.5 GHz. Côté graphique, l'excellente GeForce GTX 980 nous paraît SSD Crucial MX200 - 500 Go 185 €
XSYXIMRHMUY³I3SYWGSQTP³XSRWGIXXIGSRǻK HIPY\IEZIGYR)HI Graveur DVD Sony Optiarc AD-5280S 20 €
,SYRHMWUYIHYVHI8SIXYRIEPMQIRXEXMSR,SPHQSHYPEMVI Alimentation Corsair RM650x 120 €
72\HI(SVWEMV Boîtier Cooler Master Silencio 652S 120 €

74 | Canard PC
TECHNO

SteamOS
2016 ne sera pas l'année de Linux Le gourou
des amateurs
par Dandu de manchots,
avec ses
faux airs de
Corbier.

Les réglages dans les jeux sous Linux


Ce jeu est plus rapide sous
sont prévus pour les néophytes.
SteamOS. Bienvenue en 1999.

Vous vous souvenez de notre énorme dossier sur les vous en retrouverez péniblement 2 000 environ sous SteamOS.
Steam Machines dans le Canard PC de novembre 2015 ? Pour rire encore un peu plus (j'entends les sarcasmes d'Ivan le
Non ? C'est normal, nous ne l'avons pas écrit parce que Fou jusqu'ici), même la version Mac OS X de Steam en propose
PIPERGIQIRXW IWXJEMXHERWP MRHMǺ³VIRGIK³R³VEPI2EMW davantage (environ 3 000). Avec le compte de Guy Moquette, seuls
RSYWEZSRWUYERHQ´QIH³GMH³HIXIWXIVXIEQ4 113 des 296 jeux sont compatibles, par exemple (et pas toujours
les plus récents). La suite reste encore plus gênante : les rares
titres que vous pourrez installer sous SteamOS tourneront dans

I
l faut bien l'avouer, un OS dont l'emblème est un manchot la majorité des cas moins rapidement que sous Windows. Linux
peut en faire réagir certains dans la rédaction. Pourtant, est un OS bien meilleur que Micro$oft Windaube… sauf pour les
SteamOS cache bien le Linux qu'il a sous le capot : le système jeux visiblement. La perte varie de « OMG, j'ai 114 FPS au lieu de
de Valve démarre directement sur l'interface Big Picture de 117 » à « J'ai à peu près autant de FPS que dans un épisode de Dragon
Steam, la même que celle que vous pouvez activer sous Windows, Ball Super ». En enfilant une barbe postiche pour ressembler à
avec votre config' de Canard flambant neuve. Nous n'allons pas Richard Stallman, nous pourrions tout de même vous indiquer
détailler l'installation ou l'histoire du système – un dossier dans que SteamOS est plus rapide que Windows : la version Linux
le prochain Canard PC Hardware s'en chargera – mais quelques d'OpenArena – clone open source de Quake III Arena, bienvenue au
explications s'imposent tout de même. Valve a créé SteamOS à XXe siècle – atteint 371 FPS, alors que sous Windows, les joueurs
partir d’une Debian, une distribution Linux dont les noms de code se traînent à 330 FPS. Plus sérieusement, dans les rares cas où il
proviennent de héros de Toy Story. SteamOS 2 (la version actuelle) est possible de mesurer les performances, comptez facilement 10 à
se base donc sur Debian Jessie, la cowgirl aussi rousse que notre 15 FPS de moins à configuration identique, soit de quoi passer de
maquettiste Miss Katonic. L'installation ne pose pas de problème : « fluide » à « ça ramouille pas mal quand même ». La vraie question
il suffit d'insérer une clé USB de 2 Go dans votre PC pas trop existentielle que nous nous posons, c'est quelle est la raison qui
vieux et d'effacer tout le disque dur. Oui, par défaut, SteamOS pousse certains à passer à SteamOS ? Parce que même en oubliant
n'accepte absolument pas de cohabiter avec Windows. Si les lignes le catalogue ridicule, les performances bien trop faibles et les bugs
de commande ne vous effraient pas et que vous connaissez la en pagaille – notre clavier est resté bloqué en QWERTY et les
différence entre UEFI et BIOS, ça devrait passer crème. Sinon, écrans 21:9 ne sont pas gérés proprement –, l'excuse idéologique ne
restez sous Windows 10. tient pas : SteamOS dépend totalement d'un client fermé (Steam)
et installe des pilotes propriétaires pour les cartes graphiques afin
OpenArena est plus rapide ! Le frisson de la honte va survenir au de ne pas se retrouver avec un framerate en secondes par image. La
moment de l'installation des jeux : mais où sont-ils ? La ludothèque seule catégorie de la population qui pourrait justifier un passage
Steam sous Linux est en effet ridiculement pauvre : alors que les à SteamOS ? Les radins. Windows 10 en version OEM vaut
suppôts de Bill Gates peuvent acheter pratiquement 8 000 titres, 130 euros et SteamOS est gratuit. Daubé, mais gratuit.

Canard PC | 75
D
PLUME PUDDING CLASH ROYALE

LE COFFRE
dossier ET LA DEMANDE
Le diabolique modèle
économique de Clash Royale

Et si le futur du free-to-play, ce n’était pas


seulement d’améliorer son expérience de jeu en
payant, mais aussi de dégrader celle des autres
joueurs ? Et si le futur c’était maintenant ?
Bienvenue dans Clash Royale.

par
netsabes

D
epuis quelques
années, Supercell fait
Royale with cheese
partie des éditeurs Dans Clash Royale, chaque joueur
dominants sur mobile, se constitue un deck de huit cartes
avec ses jeux Hayday, (à équilibrer entre unités d’attaques
Boom Beach, et surtout terriennes et aériennes, tanks, tou-
Clash of Clans. Pour relles défensives, sorts, etc.) et défie
ceux qui préféreraient se plonger un adversaire au pif sur Internet.
la main dans un bol d’acide plutôt Le terrain, toujours le même, est di-
que de toucher à Clash of Clans (un visé en deux camps. Chaque joueur
choix qui peut se comprendre), rap- dispose de trois grosses tours  :
pelons que son principe est similaire deux situées sur des chemins (qui
à Mighty Quest for Epic Loot : vous mènent au côté de l’adversaire) et
construisez votre base qui se défen- la dernière placée en retrait, entre
dra toute seule, puis vous allez atta- les deux. La victoire est attribuée
quer celle des autres joueurs. Clash au joueur qui détruit la troisième
Royale, qui vient de sortir sur iOS tour de son adversaire ou, à défaut,
et Android après deux mois de soft- à celui qui en a éliminé le plus. Vos
launch (voir encadré), est le nouveau unités suivent toutes (ou presque)
gros jeu de Supercell, mais il mise sur les chemins allant de votre tour à
des mécaniques de jeu et un modèle celle de l’adversaire : il faut donc
économique très différents. Ce qui choisir soigneusement quelle unité
ne l’a pas empêché de squatter immé- poser où et quand, à quel moment
diatement le trio de tête des apps les défendre, quand attaquer, savoir
plus rentables. Il faut dire que Clash perdre quelques points de vie pour
Royale, côté jeu, représente une belle favoriser une contre-attaque…
petite réussite  ; j’ai moi-même bien Clash Royale est assez basique (il
du mal à le lâcher et j’y ai déjà consa- ne compte d’ailleurs que 48 cartes
cré plusieurs dizaines d’heures, alors parmi lesquelles faire son deck, on
que je n’y suis qu’un joueur médiocre. est bien loin d’un Hearthstone) mais
Le principe : un mélange ultra- parvient malgré tout à se renouveler
simplifié de jeu de cartes à collection- presque à chaque match, grâce à des
ner, de tower defense et de MOBA, le combats qui se jouent souvent sur le
tout dans des matchs en temps réel fil, sur une bonne décision ou une
si rapides et intenses qu’ils durent au seule erreur. On a bien connu, du-
maximum quatre minutes. rant la période de soft-launch, des

76 | Canard PC
Le monde parallèle
Jouer sans payer du soft-launch
J’ai joué presque sans arrêt à pour les fusionner nécessite quelques
Clash Royale depuis début janvier heures à peine. Mais après trois Le soft-launch est l’équivalent
(pardonnez-moi) : il m’a fallu six semaines, quand toutes vos unités mobile des bêtas : un éditeur
semaines pour atteindre le niveau seront au niveau sept, il vous faudra sort une version non terminée
huit (sur un maximum de douze) et 200 cartes par fusion, soit en moyenne de son jeu, mais accessible
sept pour débloquer presque toutes une semaine. Par unité. Et là, Clash uniquement depuis une poignée
les cartes. Les premières semaines Royale devient fort fastidieux pour le de pays (traditionnellement la
sont tranquilles : avoir assez de cartes joueur ne souhaitant pas payer. Nouvelle-Zélande, le Canada,
l’Australie et les Pays-Bas, allez
savoir pourquoi). N’importe qui
peut se créer un compte iTunes
soucis d’équilibrage favorisant les pour obtenir supposément les meil- lié à l’App Store d’un de ces pays
joueurs abusant de tourelles défen- leures cartes. IRUYIPUYIWQMRYXIWc MPZSYW
sives, mais Supercell a petit à petit WYǽXHIXVSYZIVYRIEHVIWWI
redressé la barre pour favoriser les Jeu à la carte TSWXEPIZEPMHI KSSKPI^PEǻPMEPI
decks plus offensifs, et donc sou- Certes, mais ce serait oublier que locale de votre multinationale
vent bien plus intéressants à jouer chaque carte peut évoluer : quand préférée, par exemple) et vous
(quoi qu’il arrive, mieux vaut perdre vous avez deux cartes identiques pouvez ensuite télécharger
contre quelqu’un qui sait construire (c’est le premier palier ; ensuite il librement les jeux gratuits en
une attaque plutôt que contre un en faudra 4, puis 10, 20, 50, 100, soft-launch. En revanche, vous
adversaire se contentant de balan- 200, 400…), vous pouvez utiliser ne pouvez pas y dépenser
cer des sorts de loin jusqu’à détruire votre or pour les fusionner, don- d’argent, à moins de posséder
une de vos tours). Et tout ça est bel nant une plus grosse barre de vie et aussi une carte bancaire du
et bon, mais ça n’a finalement pas plus de dégâts aux unités. Bonus : même pays que votre nouveau
grand-chose à voir avec le modèle chaque fusion fait monter la propre compte iTunes. Le soft-launch
économique de Clash Royale. barre d’XP du joueur, qui finira par est très pratiqué chez les gros
grimper de niveau… ce qui donne- éditeurs de jeux mobiles : Clash
Ça passe où ça Clash ra à ses tours plus de points de vie Royale a été en soft-launch
Le modèle de financement de Clash et de dégâts. En pratique, un joueur depuis début janvier, Assassin’s
Royale n’a qu’un rapport lointain dépensant de l’argent pour acheter Creed IdentityHITYMWǻR
avec le jeu en lui-même, mais influe des coffres pourra donc avoir des le prochain Angry Birds y est
pourtant profondément sur les par- unités beaucoup plus fortes qu’un déjà… La pratique permet non
ties. Attention, suivez bien, comme joueur évoluant dans la même seulement de juger de la viabilité
souvent avec les free-to-play sur mo- arène que lui. À présent, abordons d’un jeu (avant Clash Royale,
bile, c’est intentionnellement abcons. le plus gros souci du jeu : vous vous Supercell a par exemple soft-
Chaque victoire vous rapporte un en souvenez, tous vos matchs sont launché puis annulé Spooky Pop)
coffre, qui contient de l’or, parfois classés, et de votre classement dé- mais aussi de régler son modèle
des gemmes et surtout des cartes. pend votre arène, et donc ulti- économique et éventuellement
Chaque coffre demande plusieurs mement ce que vous gagnez dans l’équilibre du gameplay.
heures (de trois à vingt-quatre) pour chaque coffre. Un joueur payant ne
s’ouvrir et vous ne pouvez en avoir se contentera donc pas de progres-
que quatre à la fois. Si vous gagnez ser plus vite : il participera active-
et que vous avez déjà quatre coffres, ment à ralentir la progression des
vous n’en obtiendrez pas de nouveau uits en les faisant chu
joueurs gratuits chu-
(vous pouvez bien sûr dépenser des assement, causant par-
ter dans le classement,
gemmes pour accélérer l’ouverture age en arène infé-
fois un passage
d’un coffre et libérer une place). olique. Dans ces
rieure. Diabolique.
Jusque-là, ça reste du free-to-play très conditions, personne dans
classique, et au moins Clash Royale mon clan (oui, oui, comme
ne vous empêche jamais de jouer. Par récédents
dans les précédents
ailleurs, le contenu des coffres est in- upercell,
titres de Supercell,
dexé sur l’arène où le joueur évolue, les clans sontt essen-
et qui dépend de son classement (car tiels à la vie du jeu)
oui, tous les matchs sont classés) : un né quand
ne s’est étonné
coffre d’arène 5 aura plus de cartes nos joueurs les mieux
et d’or qu’un coffre d’arène 4, mais voué avoir
classés ont avoué
surtout des cartes différentes. Dans dépensé au u moins
ces conditions, on pourrait penser 200  euros chacun.
que l’achat de coffres n’apporte pas opage :
Pire que le dopage :
grand-chose ; il faut après tout mon- nsti-
le dopage insti-
ter en arène (et donc en classement) tutionnalisé.

Canard PC | 77
JJE VIS DES HAUTS ET DES BAS
S

P
PAR IZUAL

LA GUERRE, C'ÉTAIT MIEUX AVANT

Wagram de coke
Échapper à l'étreinte d'un jeu vidéo n'est pas facile, mais j'y suis parvenu. Vous avez devant vous un
homme neuf. Une seule règle régit désormais ma vie : l'interdiction de jouer à Arma 3. Non, je n'ai
aucun problème à respecter cette contrainte, je suis sevré je vous dis ! À l'origine, c'était d'ailleurs
pour me vacciner une bonne fois pour toutes que je m'étais tourné vers Napoleonic Wars, une
obscure extension de Mount & Blade : Warband en forme de simulateur d'infanterie napoléonienne.
Je me disais que les mousquets qui mettent trois plombes à recharger, ça allait me dégoûter de la
guerre virtuelle pour de bon. Mais j'avais tort. J'avais merveilleusement tort.

C
'est vrai qu'au départ, napoléoniennes sont rythmées par la hors d'une tranchée pour prendre d'assaut
je m'attendais à ricaner déflagration assourdissante des mousquets une colline fortifiée, mais la présence de
devant les toques ridi- et par les « RULE BRITTANIA ! » d'encou- M16 et de lance-flammes à l'autre bout a
cules des grognards et les ragement de vos officiers. On ne joue pas tendance à gâcher un peu la soirée. Alors
tactiques obsolètes des à cette extension pour le plaisir de tirer que là, on n'hésite pas à charger au pas
Austro-Hongrois. Au lieu deux fois par minute ou de se prendre une de course face à une rangée de fusiliers :
de cela, j'ai découvert qu'au XIXe siècle, on volée de mitraille dans la moustache. Non. certes, ils arriveront à buter quelques-
savait faire la guerre, oui messieurs-dames. On y joue pour l'ambiance. uns de nos camarades, mais vu leur pré-
Alors qu'aujourd'hui on se planque dans cision et leur vitesse de rechargement,
des bunkers pour conduire des drones via AUSTERLITZ LE GAULOIS. Qu'on ne se ils ne pourront pas nous empêcher d'ar-
un écran en noir et blanc, nos ancêtres se méprenne pas : si Napoleonic Wars pro- river au corps-à-corps et de faire vibrer
sanglaient dans des uniformes cramoisis et pose une si grande immersion, ce n'est pas les baïonnettes. D'autant que pendant
se tenaient bien droits sur une crête pour parce que la guerre y est redoutablement ce temps, notre horde de cavaliers fonce
montrer qu'ils en avaient dans les chaus- efficace. C'est même tout l'inverse. Parce sur leur artillerie, une manœuvre rare
settes. Bon, après ils étaient décimés par que les fusils y sont si nuls et les prin- à notre époque où demander à une jeep
de l'artillerie, mais au moins ils tutoyaient cipes tactiques si pourris, on peut enfin de charger un canon automoteur AS-90
le panache, vous voyez. Et le panache, c'est y guerroyer en paix, tenter des stratégies relève du sadisme. J'en étais là de mes
précisément le credo de Napoleonic Wars. douteuses et monter à l'assaut sous le feu réflexions (recharger un mousquet laisse
Oubliées, les haches à deux mains et les des mousquets. Oui, parce que je ne sais beaucoup de temps pour cogiter) quand
cris gutturaux de Warband : les batailles pas si vous avez déjà essayé de vous ruer un doute m'a étreint  : et si, au fond, la

78 | Canard PC
guerre moderne n'était pas fun ? a la charge de faire TUT-TUT quand
Dans Napoleonic Wars, pendant que la meute s'ébranle), rajoutez les ar--
certains suent sang et eau dans une tilleurs qui ne savent pas viser et less
tranchée pour repousser les enva- sapeurs qui sortent des sacs de sablele
hisseurs, on peut voir passer des de leur manche, et vous avez un largege
fanfares de cornemuses et de tam- éventail de rôles dans lesquels vous
bours ou des parades de drapeaux glisser.
improvisées. Venez me dire en face
que ça serait possible de nos jours, L'INSTINCT GUÉGUERRE. Mainte-
alors que les snipers pullulent et em- nant que les principes de base du
pêchent toute créativité artistique jeu sont bien mis à nu, il faut tout
sur le champ de bataille. de même que je précise qu'on s'en
fout un peu. Que le fun ne réside
QUAND IÉNA PLUS, IÉNA ENCORE. pas dans la coopération des diffé-
Jusqu'ici, ce que j'ai évoqué de rents corps de métier. Certes, il est
Napoleonic Wars pourrait être dés- amusant de découvrir des synergies,
tabilisant : qu'est-ce que c'est que mais une fois qu'on a compris que la
ce jeu de guerre ultra-violent (ah cavalerie taille l'artillerie en pièces et
bah oui, les coups de sabre dans les qu'un sapeur fera des miracles pour
fontanelles, c'est direct interdit aux aider l'infanterie à tenir une posi-
moins de 18 ans) où l'on peut aussi tion, il n'y a pas grand-chose à voir
parler d'épanouissement person- de plus. Non, la grande particularité
nel et de musique ? Ah, mais c'est de cette extension Napoleonic Wars,
LA grande réussite de l'extension  : c'est d’être un énorme générateur
mêler stratégie napoléonienne et d'anecdotes. Parce que les armes y
liberté d'action. Par exemple, sur le sont peu précises, j'ai traversé une
serveur roleplay le plus populaire qui rivière à deux à l'heure avec mon
organise des batailles à cent contre bataillon sous le feu ennemi sans me
cent en permanence (facile : les bons condamner à la défaite. Parce que les
soirs, il y  a plus de 1 500 joueurs canons y sont nuls, j'ai pu voir le sol-
connectés au jeu), chacune des deux dat qui marchait à un mètre devant
nations en présence dispose de plu- moi, emporté soudainement par
sieurs régiments. Et comme vous un boulet en me laissant indemne.
êtes obligé de coller à votre chef, le Parce que les joueurs de Mount &
champ de bataille est constitué de Blade ont des pseudos douteux, j'ai
plusieurs blocs d'infanterie et de vu passer l'ordre de protéger Staline
cavalerie qui bougent comme dans à tout prix, ben oui écoutez, c'était
un Tetris en apesanteur. Voilà pour notre commandant. Et parce que la
la stratégie. Côté épanouissement guerre avait encore de la gueule à
personnel, ce que je vous ai caché, l'époque de Napoléon, j'ai pu par-
c'est que chaque régiment dispose ticiper à des batailles de cent cava-
de plusieurs rôles : porte-drapeau liers contre cent fusiliers au sommet
inutile, joueur de flûte inutile, fu- d'une colline et j'ai répondu par un
silier quasi inutile avec autant de roulement de tambour furieux à un
précision qu'une frappe occidentale camarade qui me demandait d'ar-
en Syrie et officier inutile (enfin rêter de jouer juste à côté de son
non, il commande la troupe, mais il oreille, merci. Le bon côté, c'est que
a une fâcheuse tendance à attirer les je n'ai plus envie de retourner me
balles). Déclinez ces métiers d'infan- faire headshoter par un buisson à
terie vers la cavalerie (où personne 800 mètres à l'époque contempo-
ne joue de tambour mais où il y a un raine. Le problème, c'est que j'ai une
clairon par régiment, un joueur qui nouvelle addiction. 

Canard
C
Can
an
a ard
a d PC
C | 79
79
À PART ÇA PANIER GARNI Parce qu’il n’y a pas que le jeu vidéo dans la vie, mais que ce serait quand même dommage de trop s’en
éloigner (il fait froid là-dehors, et le monde est dangereux), Panier Garni vous donne l’occasion de découvrir
une sélection de livres, films et autres activités déconcertantes en lien avec un jeu célèbre ou inconnu.

Wolf Hall
Panier Garni : LE JEU
À REGARDER

Crusader
Quatre ans après sa
sortie, Crusaders
Par ackboo

Kings 2
Kings 2 est plus
que jamais l’un des
meilleurs jeux de
stratégie sur PC. Un
chef-d’oeuvre ludique,
Une série de la BBC d’après affiné au fil du temps
les romans de Hilary Mantel,
environ 30 euros le coffret DVD.
par des dizaines de
patchs et une douzaine
Diffusée sur Arte début 2015 et de DLC. D’après
disponible en DVD, cette mini- Steamspy, le temps
série (six épisodes) de la BBC moyen qu’a passé un
est probablement la meilleure acheteur sur le jeu est
représentation télévisuelle de de... 102 heures et six
l’ambiance qui régnait dans minutes. C’est quand
l’entourage d’un roi comme on en même autre chose
joue dans Crusader Kings 2. Elle qu’un Stanley Parable.
raconte l’ascension de Thomas Mon score personnel
Cromwell, conseiller de Henry VIII est de 380 heures,
d’Angleterre au XVIe siècle. et je n’ai pas encore
Cromwell, dans Crusader l’impression d’avoir
Kings 2, ce serait l’équivalent épuisé un quart de
d’un chancelier avec un skill de ce qu’il était possible de faire sur
20 en Diplomatie. Il dut déployer les 700 ans d’histoire (entre le
des trésors d’ingéniosité pour VIIIe et le XVe siècle) que déroule
permettre à son souverain taré de une campagne solo. Vous pouvez
divorcer de sa femme, d’engrosser démarrer en tant que comte français,
légalement sa courtisane Anne duc anglais, doge vénitien, Viking,
Boleyn et d’emprisonner ou chef de tribu mongole, empereur du
décapiter tout un tas de gens selon Saint-Empire romain germanique,
ses humeurs. Lent, sombre (parfois calife... Dans ce merveilleux wargame,
filmé à la bougie), il propose se marier avec une demi-soeur puis
des costumes et des décors assassiner un bambin de trois ans
remarquables, et les acteurs jouent et décapiter un évêque constituent
merveilleusement bien, avec une tactique tout à fait valable pour
Damian Lewis (le rôle principal de préserver la grandeur d’une dynastie
Band of Brothers et Billions) en ou mettre la main sur une province
second rôle de luxe. Un vrai petit bavaroise. Crusader Kings 2 est plus
bonheur pour les amateurs de qu’un jeu : c’est un art de vivre.
séries politiques subtiles.

Le château de Vincennes
À VISITER

Si vous voulez vous mettre dans à chauffer), sa salle au trésor et même


l’ambiance du jeu, n’allez pas à ses toilettes d’époque – un trou dans la
Versailles (qui correspond plutôt pierre qui faisait tomber le caca royal
à la période traitée dans Europa 20 mètres plus bas. Mais je conseille
Universalis) mais au château de vraiment de réserver pour la visite des
Vincennes, qui devint l’un des centres étages supérieurs (voir le site web : cpc.
du pouvoir royal français dès le XIIIe cx/eOZ), qui donne accès à des salles
siècle (c’est-à-dire vers la fin d’une inattendues (je vous laisse la surprise)
partie de Crusader Kings 2). En visite commentées par un guide et à la
Visite gratuite ou libre, foncez vers le donjon et vous terrasse située au sommet du donjon,
9,50 euros pour les verrez l’immense chambre du roi, son d’où vous aurez une vue superbe sur
étages supérieurs,
minuscule bureau (qui était plus facile Paris et les bourgeois de la banlieue est.
à faire de préférence
en été.

80 | Canard PC
Comploter Le répugnant système féodal, si
À FAIRE au bureau merveilleusement bien modélisé dans
Crusader Kings 2, a été aboli en France
le 4 août 1789. Mais ne nous y trompons
pas : il survit encore aujourd’hui dans ce
qu’on appelle « l’entreprise ». Appliquer les
règles qui marchent dans le jeu sont donc
le meilleur moyen de vous assurer une
promotion et ainsi devenir cadre (baron),
cadre sup’ (comte), chef de département (duc)
voire président-directeur-général (roi). Un
collègue vote Front de Gauche ? Dénoncez-
le à son liège (son supérieur hiérarchique)
d’une missive bien sentie (e-mail anonyme
via proxy) pour récupérer son bureau près
de la fenêtre. Votre n+1 pique des capsules
Nespresso ? Balancez-le à la direction puis
décapitez son chat afin d’obtenir son poste
Une activité du secteur
lorsqu’il aura démissionné pour faute lourde/
tertiaire totalement dépression nerveuse. La morale est un luxe
gratuite, pratiquée que seuls les losers peuvent se permettre.
par des millions de
salariés tous les jours.

A Song of Crusader Kings 2 et Game of Thrones représentent le mix


Ice & Fire parfait. Le jeu semble avoir été calibré pour cet univers. Pas
À LIRE

étonnant donc qu’un mod Game of Thrones existe et qu’il


soit phénoménal – probablement l’un des meilleurs mods
jamais développés, tous jeux confondus. Je pourrais donc
tranquillement vous conseiller de re-re-re-regarder la série télé
mais... comment dire... Vous avez déjà croisé en soirée ce mec
un peu bourré qui vous prend la tête deux heures pour vous
expliquer que les bouquins Game of Thrones sont « tellement
mieux que la série, non mais si, je te jure, c’est même pas
comparable » ? Eh bien voilà, c’est reparti pour un tour. À force
de devoir résumer en 45 minutes des intrigues de 850 pages,
la version TV de Game of Thrones est devenue ennuyeuse
et incompréhensible. La dernière saison était carrément
offensante. Alors faites-vous un cadeau : achetez les cinq tomes
déjà publiés (c’est à peine 20 euros en format électronique...) et
lisez-le. Même si vous n’êtes pas un fan de fiction médiévale (je
Cinq romans écrits ne le suis pas non plus) et que vous connaissez déjà le scénar’,
par George R.R. vous allez adorer. Georges R.R. Martin a pondu un chef-
Martin, environ d’oeuvre dont la série télé ne fait que gratter la surface. Non
35 euros en version
papier, 30 en
mais si, je vous jure, c’est même pas comparable....
version ebook.

À ACHETER Un slow cooker Au temps de Crusader Kings 2, la bouffe faible température sur de longues
était dégueulasse. Pas de Burger King, périodes. C’est une sorte de méga-
pas de supermarché Picard, pas de menu mijoteur, vous le mettez en marche le
B9 au jap’ du coin, c’était la grosse dèche. matin avant de partir au boulot et il vous
Les paysans réservaient la viande aux cuit pendant huit heures un morceau
jours de fête, et encore ils devaient se de viande. Ça vous attendrit n’importe
contenter des parties les moins nobles quelle barbaque. Vous pouvez donc y
de l’animal, ce qu’on appelle aujourd’hui préparer des ragoûts délicieux avec, par
les bas-morceaux. Afin de rendre exemple, les bas-morceaux du boeuf
hommage à l’estomac de ces gueux, (le collier, le plat de côte, le paleron, la
Un accessoire de cuisine achetez donc un slow cooker (aussi macreuse...). Ça vous coûtera beaucoup
qui vous amusera deux appelé « crock pot »). C’est l’accessoire moins cher au kilo qu’un faux-filet et la
semaines avant de dormir cuisine tendance ces dernières années. viande, au final, sera encore plus tendre
dans un placard. De 30
Le principe : il permet de cuire à très et tout aussi goûteuse.
à plus de 60 euros selon
les modèles.

Canard PC | 81
CANARD PEINARD

Le 1er avril (hahaah... euh non rien) Total War : Warhammer


dans Canard PC n° 336 Hitman, The Culling, The Division

Aide de jeu
La grille de Maîtresse Paule Cul Les mots se croisent sans se
regarder, comme des chats, dans
Retrouvez en kiosque le nouveau livre de Maîtresse Paule Cul : Mes grilles de mots l’indifférence générale.
croisés : la Culture, avec un grand Cul ! - 20,99 euromillions (aux éditions DTC).

Horizon allemand. Vertijeannecalment.


1. FPS vraiment sauvage. 2. Mettra I. Jeu d’avion pour les initiés.
en relation. Période d’essai. 3. Au II. Rendra moins tolérant.
bout du doigt. Pas sur la même III. Écran de tablette. Unité
longueur. 4. Hack & slash kick- de mesure liquide. IV. À la
starté. Titre d’AC/DC. 5. Marque fin des URL costariciennes.
de cognac. Version originale ori- Hameau du Maghreb qui n’a
ginale. Règle d’architecte. 6.  Jeu rien à voir avec des robots.
de voitures bleu blanc rouge. V.  Attaque de MMORPG.
7.  Possessif. Exclamatif. Associa Rédacteur presque aussi facile
"cœur" avec "bonheur" (élue à écrire que le kouign-amann
pire rime du monde). 8. Mythe mythologique. VI. Yael chan-
presque aussi facile à écrire que teuse. À la fin des noms de do-
le kouign-amann (et idéal pour maine ougandais (rooh allez,
les verbicrucistes sans état d’âme). faites semblant de vous inté-
Deux pas gaulois. 9. Assemblasses resser un peu…). VII. Acteur
(oui c’est moche hein, c’est de l’im- anglais célèbre pour avoir
parfaitasse du subjonctivasse). joué dans… euh, dans…  eh
bien le fantastique Kick-Ass 2
SOLUTION DE 
LA GRILLE DU N° 334

que j’espère que vous ne re-


garderez jamais pour vérifier. croustillante qu’est l’"Ovomaltine Partie du pain idéale pour tarti-
Partie de voiture. VIII. Abat. Ré- Crunchy" (non je ne fais pas de ner avec une merveilleuse pâte à
duction d’hectare. IX. IA de Mass pub, j’aide le lecteur !). Forme tartiner dont j’ai fait la pub parlé
Effect. Arsenic de PC. X. Céréale d’avoir. (Non mais je vous assure, pour aider le lecteur). XII. Man-
qui donne son goût unique à c’est encore meilleur que du Nu- gerais trop de pâte à tartiner AOC
cette fabuleuse pâte à tartiner tella.) XI. Élément de Hitman. (Appelation Ovomaltine Crunchy).

Bimensuel, paraît le 1er et le Siège social : Rédaction Premier rédacteur graphique : Impression Les indications de prix et
15 de chaque mois. Est édité 14 rue Soleillet - BAL 62 - Directeur de la publication : Jean-Ludovic Vignon Imprimé en France par : d’adresses données dans
par Presse Non-Stop, SAS 75020 Paris Jérôme Darnaudet Rédacteurs graphiques : Aubin Imprimeur les pages rédactionnelles
au capital de 86 400 € Rédaction en chef : Ambroise Thomas Rainfroy, Katell Diffusion : PRESSTALIS du magazine le sont à
Immatriculée au RCS Paris. Administration Garel et Sébastien Rio Chabin et Marie Lemaire Commission paritaire : titre informatif, sans but
450 482 872 Tél : 01 43 49 42 27 redacchef@canardpc.com Secrétaires de rédaction : 0219 K 84275 publicitaire. Les manuscrits,
Rédacteur en chef online : Sonia Jensen ISSN : 1764-5107 photos et dessins envoyés
Président : Secrétariat : Pauline Carmet et Cécile Fléchon Tous droits réservés à la rédaction ne sont ni 
Ivan Gaudé
Jérôme Darnaudet pauline@pressenonstop.fr
Ont participé à ce numéro : rendus ni renvoyés. Pour
Pierre Dandumont, Dessinateur : Didier Couly Numéro 335 toute réclamation, merci
Associés : Abonnements : Prix unitaire : 4,90 €
Sébastien Delahaye, Théo d’envoyer un chèque de
Jérôme Darnaudet, Domisys, abonnements@canardpc.com
Dezalay, Cécile Fléchon, Publicité 100 euros à la rédaction.
Gandi, Ivan Gaudé, Pascal Ivan Gaudé, Freddi Malavasi, Denis Date de parution : Si vous n’avez pas de
Hendrickx, Olivier Peron Courrier des lecteurs : denis@canardpc.com 15 mars 2016
Olivier Peron et Pierre- réponse, merci de renvoyer
et Michael Sarfati courrier@canardpc.com Tél : 09 66 88 42 27 Dépôt légal à parution
Alexandre Rouillon un chèque de 100 euros.

82 | Canard PC
*Offre valable du 16/03 au 23/03/2016. Modèle présenté : PC Portable Asus GL742VW-T4144T
Retrouvez l’ensemble de nos conditions générales de vente sur notre site internet. Conformément à l’article L.121-21 du Code de la consommation, le consommateur dispose d’un délai de 14
(quatorze) jours pour exercer son droit de rétractation. Domisys, rue Olivier de Serres, BP 64505 Grandchamp des Fontaines, 44245 LA CHAPELLE SUR ERDRE CEDEX.
HVVWRFNVGLVSRQLEOHV
EL RAPIDO

F pVXUFKDTXH¿FKHSURGXLWYDODEOHMXVTX¶DXPDUVGDQVODOLPLWHGH
TOUS VOS JEUX À LA VITESSE DE L’ÉCLAIR
“PARFAIT POUR LES DERNIERS JEUX LES PLUS LOURDS
& LES APPLICATIONS LES PLUS EXIGEANTES”

IUDLVG¶DVVXUDQFHpFRSDUW
 3UL[77&KRUVIUDLVGHSRUWIUDLVGHUHWUDLWHW IUD FLS
UWLFLS QW I¿FK
SDWLRQLQFOXVH PRQWDQWD
LQ

PC GAMING GROSBILL
t$BSUFHSBQIJRVFHBNJOH".%3(Pt1SPDFTTFVSDPFVST".%'9Ë(I[
t(PEFNÏNPJSFWJWFË.I[tUPEFTUPDLBHFt0T8JOEPXTJOTUBMMÏtHBSBOUJFBOT
+ DE 10 000 PRODUITS HIGH-TECH DISPONIBLES SUR LE WEB ET EN MAGASINS
SINS

10 MAGASINS RETRAIT
EN MAGASIN
GRATUIT &
PRÈS DE CHEZ VOUS IMMÉDIAT
Paris 4e - Paris 13e - Villeparisis - Colombes - Boulogne - Rosny-sous-Bois - Thiais - Lyon - Lille - Prosbill Des experts à votre service