Vous êtes sur la page 1sur 84

RESPOND TO ANY PUNCH: THE 5 GATES OF JEET KUNE DO

FORGET
BLOCKING
STRIKES!
PAUL VUNAK
SHOWS YOU HOW TO
DESTROY THEM p. 50

75TH BIRTHDAY COLLECTOR’S ISSUE


My father’s message
is universal: using no
way as way, having no
limitation as
limitation.”
—Shannon Lee

AUG/SEP 2015 Display until 9/22/15


blackbeltmag.com

SPECIAL PHOTO ESSAY KOREA’S RARE BUDDHIST MARTIAL ARTS


Ninja Collection
by Stephen K. Hayes
Together in one collector’s edition! Black Belt Books has compiled the best-selling six-book Ninja series

and added to the original material, bridging the gap between the needs of contemporary society and the
essence of the ancient once-secret ninja art.

Hayes, inducted into the Black Belt Hall of Fame in 1985, achieved the rare rank of judan (10th-degree
black belt) and was formally ordained in 1991 as a teacher in the 1,200-year-old Japanese esoteric
meditation tradition. Here, in one volume, he shares the secrets of the warrior sage.

To order, call toll-free: (800) 581-5222 or visit amazon.com


contents
8 / 9. 2015

56
BUDDHIST MARTIAL
ARTS OF KOREA
This photo essay comes from
the camera of Black Belt Editor-
in-Chief Robert W. Young,
who traipsed around South
Korea in search of
martial monks.

COVER STORY
32 BRUCE LEE LEGACY LIVES ON!
In this exclusive interview, Shannon Lee talks about new
SURMHFWVLQYROYLQJKHUIDPRXVIDWKHUDQGUHYHDOVZK\VKH·V
devoted her life to preserving his message.

FEATURES
40 5 GATES OF JEET KUNE DO
First-generation JKD student Richard Bustillo describes and
demonstrates techniques for stopping any punch, courtesy of
wing chun and jeet kune do.

44 FIT FOR THE RIGHT FIGHT


Tactical trainer Scott Sonnon explains why being in shape for a
sport is different from being in shape for self-defense. Bonus:
Two gun disarms and exercises designed to enhance them.

50 PATRIOT MISSILE SELF-DEFENSE!


Paul Vunak teaches a private lesson on the science of
GHVWUXFWLRQV'RQ·WWKLQNWKHVHWHFKQLTXHVFDQEUHDNERQHV"
Ask Anderson Silva and Mike Tyson.

62 ART OF THE KRIS


A Black Belt writer traveled to Southern Thailand to get up close
and personal with the kris knife, as well as the masters who
make the blade and teach its use.

66 LEVELING THE FIELD


Meet Staff Sgt. Jessica Field, proud member of the U.S. Air
)RUFHDQGFHUWLÀHGLQVWUXFWRURI0&0$3WKH0DULQH&RUSV
Photo by Robert W. Young

Martial Arts Program.

DISCLAIMER: BLACK BELT COMMUNICATIONS, an Active Interest Media Publication, as publisher, does not endorse and makes no representation, warranty or guarantee concerning the safety or effectiveness of either the products
and services advertised in this magazine or the martial arts or other techniques discussed or illustrated in this magazine. The publisher expressly disclaims any and all liability relating to the manufacture, sale or use of such products and
services and the application of the techniques discussed or illustrated in this magazine. The purchase or use of some of the products, services or techniques advertised or discussed in this magazine may be illegal in some areas of the
United States or other countries. Therefore, you should check federal, state, and local laws prior to your purchase or use of these products, services or techniques. The publisher makes no representation or warranty concerning the legality
of the purchase or use of these products, services and techniques in the United States or elsewhere. Because of the nature of some of the products, services and techniques advertised or discussed in this magazine, you should consult
a physician before using these products or services or applying these techniques.

“Bruce Lee” is a registered trademark of Bruce Lee Enterprises LLC. The Bruce Lee name, image and likeness are intellectual property of Bruce Lee Enterprises LLC. Photos © Bruce Lee Enterprises.
SEMINAR BY
V L A DIMIR VA SILIE V

T O R O N T O , C A N A D A
MULTIPLE ATTACKERS SYSTEMA MANUAL SYSTEMA
Surrounded. Confronted with A monumental and HAND TO HAND
multiple attackers. Be prepared. captivating guide to Systema training drills. -OSTIMPORTANTlLMOFTHE
CROWD concepts and practice ENTIRECOLLECTIONEssentials
programs, with remarkable for total control of any empty-
Survive inside an active and
aggressive crowd. real life chronicles. hand attack. Bonus segment –
PAGES Secrets of the Russian
Total 1 hr 31 min defense from chain.
2-FILM BOOK & Breath Masters.
DVD SET PAGES 2 hrs 25 min
SET
CLOTHING AS A STRIKES STREET CRIME LESSONS FROM CAMP
WEAPON Instruction by Mikhail Ryabko Foresee and prevent the crimes Vladimir Vasiliev presents what
Magnify takedowns, escapes and Vladimir Vasiliev. of pickpockets and harassers. it takes to excel in fighting.
& strikes, conceal punches, Awesome ways of delivering Training AT FULL RANGE in
kicks and knife draws. KNIFE IN A FIGHT
and taking strikes. Survive and prevail in unexpected, the field, forest and water.
Brilliant use of clothing 1 hr 25 min high-speed, real knife attacks. 1 hr 30 min
as a self defense weapon.
2-FILM 1 hr 30 min
1 hr 25 min
SET
BREATH FOR DYNAMIC
INTERNAL CONTROL Bodyweight massage, tissue JOINT BREAKS
Use your breath to detect and Professional control through
eliminate stress and tension. joint and limb destruction on
Exclusive breathwork to the move.
maximize your abilities.
1 hr 40 min 1 hr 20 min
1 hr 15 min DVD plus CD
2-DISC 2 hrs
SET
NEW YORK SEMINARS ESCAPE FROM HOLDS CONTACT, IMPACT
Fast-pace warm up. Train to KNIFE DISARMING & CONTROL
win against grappling and Unarmed against a blade ... control any holds, locks, chokes, Drill series on taking tension
knife slashing. grips and strangulations. out of the body and total
1 hr 20 min
Basic and advanced tactics. preparation for contact.
1 hr 35 min

FIGHTING IN DEFENSE IN GUN DISARMING


Japan 2009, 2011 THE WATER CONFINED SPACE Disarming handguns from
V. Vasiliev’s dynamic and Take your training to the new Instant action in an office all positions and distances.
depth, conquer your panic or very tight space. 1 hr 10 min
on ground work, hand-to-hand, and survive any conflict in
knife and multiple opponents. the water.
4 hrs on 2 DVDs 1hr 15 min

MOVEMENT AND PERSONAL


PRECISION PROTECTION
Sergey Ozereliev and Innovative ways to increase The top skills of Russian
Vladimir Vasiliev – natural bodyguards for defending
movements and knife work. every joint and muscle group. your loved ones.
2 hrs 15 min 1 hr 35 min

BEAT THE ODDS IMPROVISED


Defense against two or three by M. Ryabko, V. Vasiliev &
attackers. When the odds are Stark – simple – overwhemling. OLUME 1: DEFENSE
against you learn how to beat Turn personal carry items
them down. work while empty-handed supplement Systema
1 hr 5 min 1 hr 5 min against a stick. Film Collection.
1 hr 20 min 2 hrs 25 min on 2 DVDs.

ON SALE! ANY 3 DVD TITLES FOR $69 ANY 5 FOR $99 ANY 7 FOR $129 OR ANY 10 FOR $169! OR DOWNLOAD FOR $9.95 EACH

EMAIL OR CALL FOR YOUR Toll Free: 1-866-993-0400 Shipping charges extra

FREE PREVIEW DVD International: +1 905-886-0483


training@RussianMartialArt.com
AND CATALOG! Money Order, Check or Cash

Visit us online for more great products, classes, Send to: V. Vasiliev - 137 Birch Ave.,
seminars, and over 250 Systema Schools. www.RussianMartialArt.com Richmond Hill, ON Canada L4C 6C5
($/--$0*.$)**0

CONTENTS BLACK BELT - AUGUST/SEPTEMBER 2015 - VOLUME 53 - NUMBER 5


K?<F==@:@8CJFLI:<=FI
18
D@:?8<CA8E@:?ËJ INHERITANCE
D8IK@8C9C8;<:FE:<GKJ# New column! Kyle Cordova is the newest
star in the world of tricking, and a Black Belt
8E;;8D@K?LIKJ@C8K;M;j contributing editor (and his wife) gave him
his start in the martial arts!

20
FIGHTBOOK
What did Miyamoto Musashi, Jigoro Kano
and Helio Gracie have in common? They all
fought in martial arts challenge matches and
changed history.

22
DESTINATIONS
,QWKHÀUVWSDUWRIDQHZVHULHV$QWRQLR
Graceffo outlines the Chinese wrestling
WUDLQLQJKH·VXQGHUJRLQJZKLOHSXUVXLQJD
D9:K?<<E?8E:<;M<IJ@FE 3K'DW6KDQJKDL8QLYHUVLW\RI6SRUW
8:iXj_:flij\@e;\]\ej`m\Be`]\KXZk`Zj
;M;#(?fli)*D`e%)0%0,
24
D9:MFCLD<) PAYCHECK
;M;#(?fli(0D`e%)0%0, New column! In “The Business of
D9:MFCLD<* Tournament Promotion,” Don Rodrigues,
I\]c\oKiX`e`e^;i`ccj18;peXd`Z#JZXcXYc\ $ODQ*ROGEHUJDQG6\HG$KPHGWDON
8ggifXZ_KfI\]c\o;\m\cfgd\ek DERXWWKHORJLVWLFV³DQGÀQDQFHV³RI
;M;#(?fli*-D`e%)0%0, tournaments.
D9:MFCLD<+
Jg\\[Jkfgj18:fdgi\_\ej`m\I\m`\nf] 10 EDITOR’S NOTE 26
=`^_k$Jkfg`e^;\]\ej`m\8ggc`ZXk`fej
12 TIMES
KARATE WAY
;M;#,,D`e%)0%0, 'DYH/RZU\H[SORUHVDGR]HQVD\LQJV
WKDWUHÁHFWWKHVXSUHPDF\RIWKHVZRUGLQ
D9:MFCLD<, 71 ESSENTIAL GEAR WUDGLWLRQDO-DSDQHVHFXOWXUH
I\m\ij\$>i`gBe`]\=`^_k`e^
K_\D9:8ggifXZ_ 76 BLACK BELT PAGES
;M;#(?fli+-D`e%)0%0, 28
D9:MFCLD<- 82 FROM THE ARCHIVES HOW-TO
8:fdgc\k\>l`[\Kf:Xiip`e^8e[ New column!/RQJWLPHPDJD]LQH
;iXn`e^KXZk`ZXc=fc[`e^Be`m\j contributor Loren W. Christensen bares his
;M;#(?fli*)D`e%)0%0, soul in this honest essay on how the martial
DUWVKHOSHGKLPEHDWSURVWDWHFDQFHU
VOL. 53 NO. 5.%/$&.%(/7 ,661
 8636   LV SXEOLVKHG EL
PRQWKO\ E\ &UX] %D\ 3XEOLVKLQJ ,QF DQ 30
$FWLYH,QWHUHVW0HGLDFRPSDQ\$GYHUWLVLQJ
FIT TO FIGHT
9cXZb9\ck
DQG HGLWRULDO RIÀFHV DW $Q]D 'ULYH
?Xccf]=Xd\ 8QLW ( 6DQWD &ODULWD &DOLIRUQLD 
)'(' 7KH NQRZQ RIÀFH RI SXEOLFDWLRQ LV  Can martial artists lift weights without
)ODWLURQ 3NZ\ %RXOGHU &2  3HUL VDFULÀFLQJWKHVSHHGDQGÁH[LELOLW\UHTXLUHG
N\Xgfej RGLFDOVSRVWDJHSDLGDW%RXOGHU&2DQGDW
@ejkilZkfi DGGLWLRQDO PDLOLQJ RIÀFHV 32670$67(5 WRSUDFWLFHWKHLUPRYHV"<RXEHW+HUH·V
Send address changes to Black Belt, P.O.
%R[3DOP&RDVW)/ everything you need to know.
&XVWRPHU VHUYLFH     6XE
=fle[\if]D9: VFULSWLRQUDWHVLQWKH8QLWHG6WDWHVDUHRQH
:9:#;Xd`k_likJ`cXk \HDU&DQDGD)RUHLJQ 86 74
IXQGVRQO\ 7KHSXEOLVKHUDQGHGLWRUVZLOO
QRWEHUHVSRQVLEOHIRUXQVROLFLWHGPDWHULDO COMPANY SPOTLIGHT
:f$_fjkf] 0DQXVFULSWVDQGSKRWRJUDSKVPXVWEHDF
FRPSDQLHG E\ D VWDPSHG VHOIDGGUHVVHG 0DQWLV6ZRUGVKDVEHHQDWRSVHOOHURI
K_\9\jk;\]\ej\ UHWXUQ HQYHORSH 3ULQWHG LQ WKH 8QLWHG martial arts cutlery since 1997. Find out
K\c\m`j`feJ\i`\j 6WDWHV E\ 55 'RQQHOOH\ 6WUDVEXUJ 9$
 E\ %ODFN %HOW &RPPXQLFDWLRQV //& KRZWKHFRPSDQ\KDVPDQDJHGWRVXFFHHG
DQ $FWLYH ,QWHUHVW 0HGLD 3XEOLFDWLRQ $OO ZKLOHVRPDQ\RILWVFRPSHWLWRUVKDYH
ULJKWVUHVHUYHG5HSURGXFWLRQZLWKRXWSHU
GURSSHGRIIWKHUDGDU
NNN%JK8PJ8=<D<;@8%:FD
PLVVLRQLVVWULFWO\SURKLELWHG
®
ANKLE / KNEE / BACK / SHOULDER / WRIST

TRAIN LIKE A KING


Martial Arts injuries can occur from contact,
overstraining or falls and can occur to all body
parts. KingBrand’s BFST® Wraps are designed to
heal injuries quickly and effectively by focusing
energy deep within the injured area, stimulating
blood flow in the underlying tissue to heal your
injury. Visit our website to learn how KingBrand’s
full line of BFST® and ColdCure® Wraps for backs,
1-844-672-9440 shoulders, elbows, knees, wrists and ankles will
keep you training like a king.

www.kingbrand.com
LONG LIVE LEE JUN FAN! VOLUME 53, NO. 5 AUGUST/SEPTEMBER 2015

GROUP PUBLISHER Cheryl Angelheart

B
UXFH/HHRR]HVIURPWKHLVVXH,QVRPHLQVWDQFHVLW·VWRWDOO\ GROUP BRAND DIRECTOR Alexander Norouzi
LQWHQWLRQDODQGLQDWOHDVWRQHLW·VSXUHO\FRLQFLGHQWDO EDITOR-IN-CHIEF Robert W. Young
2EYLRXVO\ZHKDYHWKH´/LWWOH'UDJRQμRQWKHFRYHU7KDQNV GROUP ADVERTISING DIRECTOR
WR6KDQQRQ/HHDQGWKH%UXFH/HH)RXQGDWLRQIRUSURYLGLQJWKH Donna Diamond Riekenberg
FODVVLFLPDJH ADVERTISING ACCOUNT MANAGERS
$OVRLQWKHLQWHQWLRQDOGHSDUWPHQW:HKDYHÀUVWJHQHUDWLRQ-.'VWXGHQW BJ Ghiglione, Julie Stone, Laura (Flores) Thorne
5LFKDUG%XVWLOORWHDFKLQJWKH´*DWHVRI-HHW.XQH'Rμ)RXURIWKRVH SPECIAL PROJECTS ART DIRECTOR John Bodine
JDWHVKHZULWHVFRPHIURPWKHwing chunKHSLFNHGXSZKLOHWUDLQLQJ SPECIAL PROJECTS EDITOR Vicki Baker
ZLWK%UXFH/HHDQG'DQ,QRVDQWRLQWKHVZKLOHWKHUHPDLQLQJRQHLV COPY CHIEF Jeannine Santiago
GHULYHGIURPKLVRQJRLQJSUDFWLFHRIjeet kune doDQGER[LQJ A/R MANAGER Alice C. Negrete
,QWKHLQWHQWLRQDOEXWDOVRFRLQFLGHQWDOGHSDUWPHQWZHKDYH-.'DQG
PRODUCTION MANAGER Patrick Sternkopf
)LOLSLQRPDUWLDODUWVDXWKRULW\3DXO9XQDNZKR·VKHUHWRFRQGXFWDVKRUW
ART DIRECTORS Paul Duarte, Andrius Krasuckas
VHPLQDURQWKHVFLHQFHRIGHVWUXFWLRQV7KHDXWKRU·VLPSHWXVIRUGRLQJWKH
VIDEO/PHOTO EDITOR -RVK%UXP¿HOG
VWRU\ZDVWZRIROGWKHSOLJKWRI$QGHUVRQ6LOYDZKRVXIIHUHGDEURNHQOHJLQ
WKH8)&ZKHQKLVRSSRQHQWSXWKLVNQHHLQWKHSDWKRIDNLFNDQGWKH MARKETING MANAGER Laureen O’Brien
SOLJKWRI0LNH7\VRQZKRVXVWDLQHGDEURNHQÀQJHUZKHQKHWKUHZDSXQFK
DW'RQQLH<HQRQWKHVHWRIIp Man 3DQG<HQ·VHOERZJRWLQWKHZD\ CONTRIBUTING EDITORS
,VD\´LQWHQWLRQDOμEHFDXVHWKHVWRU\KDVEHHQLQWKHZRUNVIRUVRPHWLPH Floyd Burk, Mark Cheng, Antonio Graceffo,
Mark Hatmaker, Mark Jacobs, Dave Lowry, Kelly
WKH6LOYDLQFLGHQWKDSSHQHGLQODWH DQG,VD\´FRLQFLGHQWDOμEHFDXVH
McCann, Keith Vargo
LWZDVWKH7\VRQLQFLGHQWZKLFKWRRNSODFHDIHZZHHNVDJRWKDWSURPSWHG
XVWRUXQWKHSLHFHLQWKLVLVVXH CONTRIBUTORS
1RZWKHLQFOXVLRQRI´%XGGKLVW0DUWLDO$UWVRI.RUHD(PHUJLQJ)URPWKH Steven Abood, Richard Bustillo, Lia Chang, Tami
6KDGRZRI6KDROLQμLQD%UXFH/HHLVVXHLVWRWDOO\FRLQFLGHQWDO7KHVWRU\ Chang, Loren W. Christensen, Vincent Giordano,
LVFRPSRVHGRISKRWRV,VKRWLQ6RXWK.RUHDGXULQJWKH\HDUV,VSHQWWKHUH Ian Lauer, Richard D. Lewis, Jason William McNeil,
UHVHDUFKLQJWKHSHQLQVXOD·VPDUWLDODUWV,UHFHQWO\UDQDFURVVWKHQHJDWLYHV Scott Sonnon
IURPWKDWSHULRGKDGWKHPVFDQQHGDQGÀJXUHGWKH\PDNHDÀQHSKRWR
HVVD\GHSLFWLQJDUDUHPDUWLDODUW BLACK BELT COMMUNICATIONS, LLC
+RZH[DFWO\GRHVWKLVUHODWHWR%UXFH/HH",W·VVRPHZKDWRIDVWUHWFKEXW An Active Interest Media Publication
EHDUZLWKPH%DFNLQWKHV/HHFRQFHLYHGRIWKHKung Fu79VHULHV 24900 Anza Dr. Unit E, Valencia, CA 91355
ZLWKKLPVHOIDVWKHOHDG2IFRXUVHWKDWFKDUDFWHUZDVD6KDROLQ%XGGKLVW Toll Free: (800) 423-2874
PRQN8QIRUWXQDWHO\+ROO\ZRRGH[HFVZHUHQ·WFRQYLQFHGWKDWDQ$VLDQ In CA (661) 257-4066
OHDGLQJPDQZDVDVDIHEHWVRWKH\FKRVH'DYLG&DUUDGLQHWRSOD\.ZDL Newsstand Distribution
&KDQJ&DLQH For information about selling Black Belt magazine,
&RQQHFWLRQPDGH%UXFH/HH«VXSSRVHGWRSRUWUD\WKHSULHVW«6KDROLQ contact BGiacalone@aimmedia.com.
7HPSOH«.RUHD·VWHPSOHPDUWLDODUWV Back issues can be purchased from
$QGWKHQWKHUH·VWKHFRYHUVWRU\ZKLFKWDNHVXVEDFNWRWKH´LQWHQWLRQDOμ Palm Coast Data, (800) 266-4066
FDWHJRU\,QLW6KDQQRQ/HHGHWDLOVWKHODWHVWDQGJUHDWHVWSURMHFWVVKH
KDVJRLQJRQ7RPHRQHRIWKHPRVWPHPRUDEOHSDUWVRIWKHLQWHUYLHZLV
WKLVH[FKDQJH

7RPP\*RQJDXWKRURIBruce Lee: The Evolution of a Martial Artist,


Q: UHFHQWO\GURSSHGE\RXURIÀFHDQGPHQWLRQHG«WKDW\RX·UHZRUNLQJ
KDUGWRVSUHDGNQRZOHGJHRI\RXUIDWKHU·VSKLORVRSKLHV
Efrem Zimbalist III
´7KLVLVZK\,·PLQYROYHGLQWKHEXVLQHVVKRQHVWO\,IP\IDWKHUKDG
A: PDGHDKDQGIXORINLFNDVVPRYLHVLQWKH·VDQGWKHUHZDVDQ
RSSRUWXQLW\WRH[SORLWWKDWE\SXWWLQJSKRWRVRQ7VKLUWVWRPDNHPRQH\³,
EXECUTIVE CHAIRMAN
Andrew W. Clurman
PRESIDENT & CEO
ZRXOGQ·WEHLQWHUHVWHGLQSXWWLQJDOOP\HQHUJ\LQWRWKDW Brian Sellstrom
´7KHWKLQJ,ZDQWWRSXWP\HQHUJ\WRZDUGLVWKHSKLORVRSK\6RPXFK EXECUTIVE VICE PRESIDENT & CFO
YDOXHFRPHVIURPEHLQJDURXQGWKDWDQGWU\LQJWROLYHP\OLIHLQDEHWWHU Patricia B. Fox
ZD\WKHVHOIDFWXDOL]DWLRQDQGVHOIFXOWLYDWLRQZKR,DPDQGZKDWZDONLQJ EXECUTIVE VICE PRESIDENT OF
P\RZQSDWKPHDQV,W·VLQVSLUDWLRQDO«μ OPERATIONS
Kim Paulsen
7KHVWDIIRIBlack BeltKRSHV\RXÀQGDOORIWKLVLVVXHLQVSLUDWLRQDO VICE PRESIDENT GENERAL MANAGER
Nelson Saenz
— Robert W. Young VICE PRESIDENT OF IT
Editor-in-Chief Kristy Kaus
VICE PRESIDENT OF RESEARCH

10 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


ARE YOU IN TOUCH
WITH YOUR MARKET?
We Can Get You Connected.
Go2Karate® is run BY school owners FOR school owners, and offers top-notch
service for incredible results at a lower cost per lead. Learn how our expert online
marketing experience can help you drive leads from the internet to your dojo.

We introduced you We provide listings of Rev Marketing 2 U


to Go2karatesites.com martial arts schools introduces it’s newest
and the response was that have helped many offering - Go2itDeals.com
tremendous! We turn people with personal A site where all your
your Martial Arts School empowerment such as: Special Offers are listed
Business into a Brand. and you act as the merchant.
• Self-Confidence
• Custom Websites • Another way to drive
• Greater Health traffic to your website
• Managed Websites and Fitness
• Provide more reach to
• Search Engine Marketing • Self-Discipline your Special Offers

• Pay Per Click • Sharper Mental Focus • Advertise your business


directly on Go2ItDeals.com
• Respect

Go2It
Marketing & Strategies

FREE WEBSITE SPECIAL!


Just let us know you’ve seen us HERE in Martial Arts Magazine! Today for a
* Free Marketing
Can’t Miss Opportunity: FREE WEBSITE to the 1st 20 CALLERS Analysis and
* with enrollment in a marketing program Receive the

CALL TODAY - 757-296-6605 Marketing

www.Go2KarateSITES.com
TIMES MARTIAL ARTS NEWS YOU CAN USE. READ IT - KNOW IT - LIVE IT

Left to right: Screenwriter Gary Goldman


with actors James Hong, Lia Chang,
Gerald Okamura and George Cheung.
Photo by Tami Chang/Inset Photo by Lia Chang, liachangphotography.com

Peter Kwong and the


DFWLRQÀJXUHVEDVHGRQ
his character.

BLACKBELTMAG.COM
BIG TROUBLE IN LITTLE
CHINA — THE REUNION
“They have returned. And this time, and star Kurt Russell decided that
they are not alone!” the film would be more appealing to
— David Lo Pan audiences if it had a contemporary
setting, so Jack became a trucker
On an otherwise normal Wednesday and his horse “Porkchop” became a
night (well, as normal as Los Angeles stolen big rig named “The Porkchop
gets), in an otherwise normal corner Express.”
of the Little Tokyo district, in the Perennial kung fu bad guy Gerald
otherwise normal and oh-so-dignified 2NDPXUD³ZKHQQRWEXV\WU\LQJ
Japanese American National to stir up some extra big trouble by
Museum, a normal visitor expecting a leading the audience in chants of
normal museum visit might have been “Wing Kong! Wing Kong!” during
shocked right down to his soles as he WKHEHPXVHG&KDQJ6LQJDFWRUV·
rounded an otherwise normal corner VSHHFKHV³UHJDOHGHYHU\RQHZLWK
and stumbled on a reunion of the the tale of how he brought his whole
greatest collection of kung fu villains collection of exotic kung fu weaponry
(and a few heroes) ever gathered. to his audition, then was surprised to
&DVWPHPEHUV3HWHU Who were they? The cast and creators be given a pair of gold-plated pistols
Kwong (left) and of Big Trouble in Little China. instead.
Gerald Okamura. “Wang, these Sing Dings …” Legendary henchman Al Leong
“Chang Sings.” UHFDOOHGWKDWKHZDVQ·WRULJLQDOO\
“They got enemies?” cast in the film but was later hired by
“Wing Kong.” &DUSHQWHUDIWHUDFKDQFHHQFRXQWHU
“Who wear red turbans?” with him. James Lew and Jeff
“Holy … Jack, these guys are Imada, both of whom went from Big
animals!” Trouble to big careers as big-time
Hosting a special screening of the fight choreographers and stuntmen,
1986 cult classic that many martial credited the film for being their first big
artists and kung fu fans call their fave, break.
the theater was positively packed with 2WKHUFDVWPHPEHUV³LQFOXGLQJ
Eric Lee, Peter Kwong, George
&KHXQJDQG/LD&KDQJ ZKRDOVR
co-starred in The Last Dragon)³
Representatives from both of the took turns answering questions and
sharing their favorite recollections of
making the milestone movie. However,
it was James Hong who had the most
poignant memory to share.
in attendance and mingling freely with “Indeed!”
Several decades older than the rest
In fact, so many fans showed up for RIWKHFDVW+RQJ³ZKRSOD\HGWKH
the charity event that the film started lead villain, the undead wizard David
/R3DQ³VDLGWKDWWKHILOPLQJRIBig
made sure everyone who wanted a Trouble in Little China will always be
picture or autograph got one. near and dear to his heart because it
“We really shook the Pillars of marked the first time in his 60-plus-
\HDUILOPFDUHHUWKDWKH·GEHHQSDUWRI
After the credits and applause a (practically) all-Asian cast in a big-
budget American movie.
came down front for an exclusive “In front of the camera, there was
question-and-answer session with .XUW5XVVHOODQG.LP&DWWUDOO³WZR
the audience. Writer Gary Goldman &DXFDVLDQV³DQGHYHU\RQHHOVHZDV
liachangphotography.com

Asian,” Hong recalled. “We still have a


the original version of the screenplay, way to go, but that was the first time I
Photos by Lia Chang,

bumbling hero Jack Burton was an HYHUWKRXJKWWRP\VHOI¶:RZZHKDYH


Old West cowboy who stumbles into ILQDOO\DUULYHG·μ
a 19 th FHQWXU\&KLQDWRZQZKLOHWU\LQJ And then the evil Lo Pan smiled and
shed a tear.
James Hong VWXGLRH[HFVGLUHFWRU-RKQ&DUSHQWHU — Jason William McNeil

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 13


COMPANY DEVELOPING WOMEN’S
ARMOR FOR WEAPONS COMPETITION
8QLÀHG:HDSRQV0DVWHUDQ RI8:0´7KHPRVWVLJQLÀFDQW
$XVWUDOLDEDVHGÀUPWKDW·VSURPRWLQJ GLIIHUHQFHWRWKHZRPDQ·VDUPRULV
DQHZIRUPRIFRPSHWLWLRQUHYROYLQJ the design of the chest plate, which
around weapons combat, has will feature interchangeable pieces to
UHYHDOHGSODQVWRGHYHORSWKH/RULFD allow for adjustments to be made to
$PD]RQDYHUVLRQRILWVXQLTXHDUPRU ÀWYDULRXVVL]HV:HDUHDOVRORRNLQJ
that will enable women to take part in at a special helmet design with a
IXWXUHHYHQWV more feminine look.”
UWM has spent the past four UWM consulted with Samantha
\HDUVUHÀQLQJWKHSURWRW\SHRI 6ZRUGVDQH[SHULHQFHGPHGLHYDO
WKHPHQ·VDUPRUZLWKWKHGHVLJQ FORVHFRPEDWÀJKWHUWRJHWKHULQSXW
H[SHFWHGWREHÀQDOL]HGODWHUWKLV for the female armor design and the
\HDU7KHDUPRUXVHVWKHFRPSDQ\·V prospect of a competition for women.
proprietary sensor technology and ´,DPYHU\H[FLWHGWRVHHKRZWKH
medical algorithms to determine what UWM female armor will look, and I
GDPDJHZRXOGKDYHEHHQVXVWDLQHG WKLQNWKDWLW·OOFHUWDLQO\EULQJDORWRI
by the competitor had he or she not H[SRVXUHWRZHDSRQVEDVHGPDUWLDO
EHHQZHDULQJWKHSURWHFWLYHVXLW arts forms that perhaps many people
The information is collected from 54 GRQ·WHYHQNQRZDERXWμVKHVDLG´,W·V
sensors spread out across the body, fantastic to see UWM will be opening
with many being read thousands of up the competition to women, which
WLPHVDVHFRQG,W·VWKHQZLUHOHVVO\ ZLOOHQDEOHJUHDWHUGLYHUVLW\LQFRPEDW
VHQWWRDQDGYDQFHGVFRULQJV\VWHP VW\OHV7KHZD\ZRPHQÀJKWFDQEH
WKDWDOORZVDQDO\VLVRIHYHU\VWULNH quite different to men, so audiences
including its force, location and FDQH[SHFWWRVHHGLIIHUHQWYLVXDO
WUDXPDSURÀOH possibilities.”
“With women, it is particularly )RUVHOOVDLGWKDW8:0KDGUHFHLYHG
important to protect the top of the many inquiries from men and
SHOYLVDQGKLSVDVWKHVHDUHDVDUH women who want to participate in
PRUHYXOQHUDEOHIRUZRPHQWKDQIRU the inaugural competition, which is
men,” said Justin Forsell, chairman planned for 2016.

CENTURY PARTNERS WITH AMERICAN


TOP TEAM’S RICARDO LIBORIO
Century Martial Arts has joined IRUP%UD]LOLDQ7RS7HDPEHIRUH
forces with famed instructor and joining Dan Lambert in 2001 to

Armor Illustration Courtesy of UWM • Ricardo Liborio Photo Courtesy of Century


American Top Team co-founder create American Top Team. In the
Ricardo Liborio. The relationship nearly 15 years since its inception,
PDNHV&HQWXU\/LERULR·VH[FOXVLYH American Top Team has spread
HTXLSPHQWSURYLGHUDQGPHDQV across the country with more than 40
that Liborio will assist the Century locations and has produced countless
UHVHDUFKDQGGHYHORSPHQWWHDP champions. As head instructor, Liborio
with the testing and marketing of new has coached many of those martial
products. It also means Liborio will be artists. That, combined with his own
a featured demonstrator at the 2015 H[WHQVLYHWUDLQLQJJLYHVKLPXQLTXH
Martial Arts SuperShow in Las Vegas. insight into products and apparel that
´7KHUHDUHVRPDQ\H[FLWLQJWKLQJV &HQWXU\ORRNVIRUZDUGWRXWLOL]LQJ
JRLQJRQDW&HQWXU\DQG,·PKDSS\WR ´:HDUHPRUHWKDQH[FLWHGDERXW
WHDPXSZLWKWKHPWRKHOSGHYHORSQHZ our partnership with world-renowned
products and grow the martial arts martial artist Ricardo Liborio,” stated
community,” Liborio said. “Century is Paul Webb, president of Century
part of my martial arts family, a group Martial Arts. “Throughout his career,
WKDW,·YHJURZQZLWKWKURXJKWKH\HDUV master Liborio has taught the same
,·PORRNLQJIRUZDUGWRZRUNLQJZLWK tenets to his students as we pride
WKHLUJUHDWWHDPWRFUHDWHLQQRYDWLYH RXUVHOYHVRQDW&HQWXU\UHVSHFW
and functional new products.” humility and hard work, along with a
$QDWLYHRI%UD]LO/LERULRKHOSHG true passion for martial arts.”

BLACKBELTMAG.COM
BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 15
NEWS BITES
Kenpo 5.0 founder Jeff Fariborz Azhakh failure,” she posted. positive reviews from
Speakman is in talks appeared with host “Ernie is now home and martial artists looking for
to develop a reality-TV and former NFL player currently undergoing a laugh. The fisticuffs in
series called Perfect Tony Gonzalez on a dialysis treatment 3 the film come courtesy of
Weapons. A promo piece National Geographic times per week for 4 Diana Lee Inosanto. “I
is available on YouTube. show investigating the hours a day while waiting taught her kali and JKD
“unbendable arm.” A for a kidney transplant.” to prepare her for her
Some local Japanese promo piece for the Find out how you can role,” she said.
politicians have teamed segment, called You help at gofundme.com/
up to create council to &DQ·W/LFN<RXU(OERZ is erjrofficial. %ODFN%HOW Hall of
foster ninja-themed on YouTube. Famer and judo icon
tourism during the 2020 A group of martial Hayward Nishioka was
Olympics in Tokyo. Morné Swanepoel, arts–practicing nuns recently promoted to
a South Africa–based in Nepal refused official ninth dan.
The taekwondo skills martial arts teacher, efforts to evacuate them
of Paige McPherson, a MMA coach and fitness so they could administer 7RQ\%ODXHU·V Annual
bronze medalist at the instructor, has joined aid to victims of the Combatives Camp will
2012 Olympics, were the %ODFN%HOW staff as a recent magnitude-7.8 take place August 22-23,
featured in a two-minute- blogger. Read his posts earthquake. 2015, in Las Vegas.
plus online ad from at blackbeltmag.com.
Mercedes-Benz. Kung-fu Kingdom has Kung fu great Dennis
Destiny Reyes has posted a 10/10 review Brown has been selected
Beth Tarini has created a GoFundMe of %UXFH/HH·V)LJKWLQJ to play the American
launched a campaign to page to raise money for Method: The Complete coach in Shanghai
raise funds to study how Ernie Reyes Jr. “My Edition. kungfukingdom Dragons, a U.S.-China
taekwondo can be used brother Ernie Reyes .com/bruce-lees-fighting- MRLQWYHQWXUHWKDW·V
to treat ADHD. crowdrise Jr. was recently in the method-book-review/ slated to begin
.com/fightadhd ICU (Intensive Care filming in August 2015.
Unit) fighting for his life The Melissa McCarthy Release is scheduled
SoCal hapkido master suffering from kidney comedy Spy opened to for May 2016.
INHERITANCE

KYLE’S RISE IN THE BIZ wasn’t by ac-


cident. It started 20 years ago, he said,
when my wife gave the 4-year-old his
ϐ 
  
   Ǥ 
  ǡ    

  -
rate studio, where we both trained him
to black belt.
I remembered the determined young
martial artist participating in every
available activity. He attended regular
classes, open workouts and Friday-
night sparring sessions. He took part in
all the camps and seminars and was a
regular at tournaments. In fact, he was
overall grand champion in a local point
series in 2001.
That same year, Kyle earned his black
belt. Then we got the news that the Cor-
dovas were moving. Losing this star stu-
dent was a bummer for the whole dojo.
I asked Kyle about his memories
from our time together. He said one of
the most vivid involved turning 8 and
wishing he could test for his black belt.
“But I couldn’t due to my age,” he said.
“For two years, I received no real pro-
motions. This didn’t bother me because
I had my eyes on the prize. But I knew
what I had to do to achieve my goal.
Earning my black belt was one of my
favorite accomplishments in life.”

FOR KYLE, a career-changing moment


came at the 2003 Compete Nationals,
where he was representing his new


ǡ    ǯ

    

Dojo Serves as Launchpad for Top Tricker!   Ǥ


   Dz " #ǡdz 
fascinated the youth.
“Tricking originated on the sport-
The mother of a former student dropped by the dojo recently. “Did you know
karate circuit in the early 1990s be-
that Kyle is working in the entertainment business now?” she asked. “He’s cause competitors wanted to add more
done a lot of jobs in the industry and was even in the remake of Footloose.” ϐ   
  
  
by Floyd Burk routines,” Kyle said. “It’s a mixture of
martial arts, gymnastics and acrobat-

H
er announcement jogged actor in Footloose for the angry dance ics with martial arts being the core as-
my memory, and recollec- scene in which Ren does his acrobatic pect. I instantly became captivated with
tions from 14 years ago routine and for the scene in which he tricking, and if Mr. Hamlin never took
started surfacing. For seven 
 ϐ
 % "
  "Ǥ me to the Compete, I’m not sure where
years, Kyle Cordova took karate lessons Having worked with several people I would be today.”
from my wife Martha and me. He was in show business over the years, I Kyle set out to learn more about
a standout, and we were looking for- wondered out loud if Kyle had earned tricking — with his parents’ full sup-
ward to mentoring him for many years,      

   Ǥ  port. “He started to trick at age 13,” Re-
but his family relocated to Sacramento, didn’t take long to get an answer be- alynn said. “We sent him to gymnastics
California, when he was 10. cause Kyle, along with his father and classes and signed him up for private
Photo Courtesy of Floyd Burk

Words from his mom Realynn brother, appeared in the doorway. lessons. He went to tricking camps.
brought me back to the present: “Kyle Instead of the fuzzy-headed kid I re- We even got him personal instruction
credits you and sensei Martha for membered, he was now a 6-foot-tall with a well-known tricker. Kyle did a
helping him get where he is today. So athlete with the good looks of a lead- lot of learning on his own, too. He’d
do I.” ing man. watch videos and then try the tricks
Eager to talk about her son, Realynn Responding to my question, Kyle himself. He crashed and burned many
explained that he’d doubled the lead  

   Ǥ times, but his perseverance was un-

18 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


stoppable. His martial arts training That’s not to imply that tricking is Chris Brown, as well as tricking perfor-
was the backbone of his work ethic guaranteed to put you on the fast track mances at the Billboard Music Awards,
and stick-to-itiveness.” to success, Kyle said. As proof, he ex- Billboard Latin Music Awards and MTV
plained the twists and turns his career Video Music Awards. He’s appeared at
OVER THE YEARS, Kyle developed his has taken: “In 2010 I stopped compet- fashion shows and corporate events,
own style of tricking, a blend of classical ing and convinced my mom to let me and worked on Glee and The Goldbergs.
martial arts techniques, intricate tran- 
) 

 #  Ǥ ϐ
  He’s tricked on The Voice and Dancing
sitions and power moves. “It is mental

ǡ  
 ǯϐ

 With the Stars. He’s taught his craft to


and physical stimulation,” he said. “You on a blow-up mattress. I eventually celebrities, which builds connections
grow to love the rush of adrenaline be- moved into an apartment with my  
    
 
% %  # %

" 
fore, during and after landing the trick friends. During this time, I also signed without having to audition.
because in that moment, you’re free   # Ǥϐ
%  - “A couple of years ago, the industry
from problems and stress, from any- sic video with Chris Brown called 12 didn’t even know what a tricker was,”
thing and everything. In those couple of Strands: Matrix.” Kyle said. “Now auditions will list the
seconds, you are the trick. Everything The Footloose role started with a cat- 
Ǯ " ǯ ǯ 

" #
ϐ
in your mind and body is pushing itself tle-call audition at which hundreds of and tricks — which is great progress
toward the execution of the maneuver. hopefuls vied for chances to be dancers for the sport.”
You’re in your own world.” and extras, Kyle said. “Immediately after Looking back, he said he’s grateful for
If you’re wondering how free-spirited my audition, the choreographer asked all that the martial arts have given him
tricking translates to showbiz success, about my measurements and if I’d ever in preparation for this career. “The life
you’re not alone. For the answer, think doubled someone. I had not, but I told lessons I learned and the physical abil-
about what you see on television. Ev- him it was something I was highly in- ity [I developed] have shaped my life,”
erywhere you look — movies, music terested in. Within one day, my agency he said. “I am truly thankful to the in-
)
ǡ
   Ȅ
   ϐ- contacted me, telling me I was booked as structors and mentors I’ve had.”
ping and twisting, kicking and punch- the double [for the lead actor].”
ing. That performance-oriented form of  ABOUT THE AUTHOR: Floyd Burk is
martial arts is tricking, and producers KYLE’S RESUME quickly grew. It now a San Diego-based 10 th-degree black belt
with more than 40 years of experience in the
and casting agents are constantly look- includes music videos with Rihanna, DUWV+H·VDOVRVHQLRUDGYLVHUWR,QGHSHQGHQW
ing for people who can do it. Justin Bieber, Nicole Sherzinger and Karate Schools of America (iksa.com).
FIGHTBOOK

IN THE MARTIAL ARTS, the critic


of another person’s style is seen as a
negative force, and people’s sensibili-
ties are upset if anyone suggests that a
particular art is not as good as another.
There are several reasons for this dis-
like of criticism.
First, a group belief often develops
when people engage in a shared en-
deavor — whether they’re doctors,
lawyers or martial arts teachers. That
belief holds that all criticism within
the group is negative, that everyone is
equally praiseworthy and that every-
one should play nicely together.
Second, many people see the martial
arts solely as a vehicle for self-expres-
sion. Even in the face of a near lack of
combative utility, they maintain that
there are artistic and psychological ben-
ϐ
  Ǥ
 ǡ    -
tial art works or not is beside the point.
Third, some people see martial arts
only as martial sports and don’t think
self-defense is needed, relevant or pos-
sible in the modern world.
Finally, there are those who feel an
obligation to not hurt another instruc-
tor’s business or feelings by criticizing
his style. Many jiu-jitsu instructors, for
example, will not say anything negative
about other schools for fear they won’t
be brought in to teach at those schools.
Out of concerns that they’ll lose money,
they choose to remain silent.
Helio Gracie was not one of those
people.

GRACIE BELIEVED that martial art-


ists who claim to teach self-defense
have obligations — to women who are
training to avoid being raped, to chil-
dren who are training to avoid being
abducted, to adults who are training
to avoid being cornered in a dark alley,
to cops who are training to boost their

Musashi, Kano and Gracie — Martial Arts chances of subduing violent suspects
even when backup is miles away.
That’s why in his younger years, Gra-
Challenge Matches cie challenged representatives from
other martial arts schools in Brazil
When asked about the aesthetics of a certain martial arts bout, Helio Gracie who were promoting themselves as
RQFHUHSOLHGJUXƛ\Ŝ$ƘJKWLVDƘJKWŝ self-defense teachers. It was his way
E\6WHYHQ$ERRG of exposing potentially fraudulent
practices. When a person was selling

I
t wasn’t that he didn’t see beauty in Judging whether a martial art is self-defense to the public and the pub-
Photo by Rick Hustead

the art of jiu-jitsu. He merely thought good is very different from judging lic was getting something else, Gracie
it was imperative to emphasize that whether a dance or a painting is good. wasn’t pleased.
ϐ# #    
    
- Dancing and painting possess various In a way, Rorion Gracie followed
tentially dire consequences for the loser   7  ǡ   ϐ# #   in his father’s footsteps when he co-
and sometimes for his or her family. about effectiveness. founded the Ultimate Fighting Cham-

20 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


pionship in 1993. Rorion insisted that # Ǥ     )  # 
 -   )     
   
"
 
 Ǥ
the bouts take place with no rules — to  
        " #                 # 
determine how well an art will work 
 Ǥ  ǡ  ϐ 
   )
) 
  ǡ  -
   ϐ#Ǥ   ǡ 

 %  ) ǡ
 
        #      
 
     #  
people could claim that a tactic or tech-
 ǡ         % -
     Ǥ
nique that wasn’t permitted would 7  
 #   
#   
 )      

 Ǥ  
     

    )    
 
 OBVIOUSLY, CHALLENGE matches
        
)   
 
)  #
)   
ϐ  Ǥ  )   )   )  %  
   
  ϐ 
 ) 
    ǡ   ǡ   #  
  -   

      Ǥ 
 ǡ
)  
#   
  
 ) -
 %   
 Ǥ ?  ǣ #

  ) 
     -
 7  
  
 

    Kano’s tenjinshinyo jujitsu teacher    )    
  ǡ
sports entertainment. Hachinosuke Fukuda erected a 6-foot- 
 "
 
ǯ  #  #  Ǧ   
 
    ǯ ϐ

 %ǦPʹǦ

 # 
   "   -   7     )  %   
  
    #      
 # #   -     
"
     ǡ Dz      test and come out on top.
) Ǥ  ǡ   #  )  
# 

 
#  ? ǡ
tradition in the martial arts.  # Ǥdz  
remains in place.  ABOUT THE AUTHOR: Steven Abood
JAPAN SAW  
   #  
   

"       #  has a jiu-jitsu black belt from Relson Gracie,


a judo black belt from Steven Alphabet, and
    
#
  
Ǥ 
      )
) # % 
 tot- instructor rank in jeet kune do and kali from

 
   %  ϐ    suka  


 #
  Dan Inosanto.
   

  
 

    
  

 # Ǥ
Heads were collected to keep track of EMPOWERING WOMEN
the outcomes. One of the projects author Steven Abood is passionate about is getting more
 
  %    )- women into the martial arts. To that end, he teaches a course called Invincible
Woman Self Defense at Florida International University. He recently launched a
Ǥ
 ?  ǡ # 
"#  
campaign to convince martial arts instructors to donate a lesson so the course can
 
 ȋPQX͵ǦPͺQͺȌǡ      be made available for free through domestic-violence shelters. (Those instructors
  

   
 # #  will be featured in a national video campaign.) iwproject.com
in musha shugyo,
  
 #-
DESTINATIONS

ǯ 
  ) Ǥ   %  Ȅ  

%  Ȅ 

 
   "Ǣ  ǯ 
   
 
 
 ǯ   

#  
  #      Ǥ
   ǡ  "   %  
% # %% Ǥ
    #  
 
  
 ) #ǡ 
       
 
    ʹPX 
 ǡ 
   
"  % % #  #  %  "

 
)   Ǥ  #   ) 
%  "
  
 #  ǯ % 
   
   
 

      -
 # ǯ 
 
 Ǥ 
 
 
    " 
 " 
 

 "     
 
    %   
      
"ǡ  # 
   
  -

Ǥ  
    "   

-
ǯ# %  Ǥ

      #
ǡ ǯ  %  

  Ȅ )  
  
   

-
      ǡ  ǯ   
 
ǯ  
  # 


ǡ 


) Ǥ  
  

 # 
  
 
 -
  
 
   )
 -
  
 

 ) #

 " %
Ǥ

CHINESE THROWS       #Ǥ


         #     ǡ 

#  


Ǧ
 
  #  

  Ǧ%
Ǧ
Pursuing a Martial Arts Degree at  #
) Ǥ
    

 ǡ           %


Shanghai University of Sport    




   

  
 #   
 
 #
 

Part 1: Chinese Wrestling 


  #Ǥ
 # 

" #     #   



     #Ǥ   ǡ ǯ


In spring 2013, I was accepted into the Ph.D. program at Shanghai University  %  " # ?     -
RI6SRUWWKHRQO\LQVWLWXWLRQLQWKHZRUOGWKDWRƗHUVDGRFWRUDWHLQPDUWLDO      # 
  -
 #Ǥ       
  #Ǧ

"ǡ 
arts. My major is wrestling, and my dissertation topic is a comparison of the           #   "
traditional Chinese version and the modern Western way.   
      
  "  
E\$QWRQLR*UDFHƗR  # 
#Ǥ   ǡ     7  % -
       
ǣ 
   

O

    #  % ϐ
 
     # # Ǣ       
  #
 #
ǡ 
 ǯ

 
#)   )  %   ǯ        7 # 


 ǡ ǯ-
   
 
   -   Ǧ # # 
ϐ   ? Ǥ
  #Ǧ

"Ǥ
      ) Ǥ  -  "  
 
ǡ 
%  
   
 #    #   

    ǡ     san da  #     #Ǥ   

 #  #Ǧ

" 
   
ǯ
 
Photo Courtesy of Antonio Graceffo

 
  #ǡ    % "
 
  ?    
Ǥ    #Ǧ

" 
  
 Ǥ        ǡ  
      
 Ǥ ϐ#

 
#

 ϐǤ


Ǧ
    #       -  )     
     Ȅ
 
 
Ǥ THE TRADITIONAL    #    †X QXȄ   # 

   ǤǤ
#   ǡ      

 
 Pʹ      "ǡ  )   #  "  
  ǯ #  7   
  #    % )  
  
   )  %  
  #Ǥ

  % 
 ? Ǥ   
#   #  #
 Ǥ       )  ǡ    
   7  
  " 
 
 Ǥ 
   )   "  ǯ 
 
gi ?  
  

  Ǥ

22 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


The “real” wrestling techniques those — unless you want to give up points. allow any legal technique that results in
experienced gents tend to favor often You can obtain points for throwing a throw even if it’s not a traditional one.
involve taking an opponent’s balance in your opponent out of the wrestling For example, I use a lot of body-lock or
three directions. For example, the wres- circle, but only if he’s not touching you body-lock-and-lift throws and get away
tler grabs the other guy’s jacket with one when he goes out. If he’s still holding with it. However, I can’t swear that such
hand on his sleeve and the other on the your arm, for example, no points are nonstandard techniques are allowed
opposite lapel. The hand on the sleeve awarded. At the end of the time limit, everywhere. Some masters are very
lifts his body, while the hand on the lapel usually two two-minute rounds, the traditional, and I can imagine them as-
pushes him back. At the same time, the points are tallied. Whoever has the sessing a foul if you use a Greco or free-
wrestler’s foot trips him. That moves the most points wins. style throw.
opponent up, back and down. There are other regulations. Once you
lock up with your opponent or begin a AS A MARTIAL ARTIST who plans to
BECAUSE THE PIN isn’t recognized 
ǡ
 ) 
 
ϐ)  - return to MMA competition, I appreci-
in Chinese wrestling, bouts are scored onds to complete it. Otherwise, the ref- ate Chinese wrestling because the up-
on points. A clean throw is worth two eree will separate you. The art gained per-body-control throws are useful for
points. A throw in which the opponent its nickname “fast wrestling” because it ϐ# #

    Ǥ )  %  ǡ

   PͺXǦ # ϐ   forces you to act quickly. the art uses high single- and double-leg
worth three. If you throw your foe and Interestingly, my Ph.D. adviser refers  " 
 ǡ    ϐ  
   -
wind up going to the mat together, you to Western wrestling as “slow wres- tive than shooting in low on my knees.
get only one point. tling” because you can take as much These two techniques are excellent for
A fall is scored when any part of the time as you need to complete a throw. augmenting san da leg-catch or kick-
body except the feet touches the mat. When he found out you can clinch for catch throws, as well.
This means that if you can force your op- 30 seconds or longer in MMA events,

ǯ" 
 ϐ

ǡ

 Ǥ  he pretty much gave up on the whole (To be continued.)
also means that you can’t execute sacri- Western hemisphere.
ϐ 
  
 #
  From the experience I gained in Bei-
ABOUT THE AUTHOR: Antonio
ϐǤ 
ǡ 
 ǯ   
 jing and Shanghai, I’ve concluded that *UDFHIIR·VERRN:DUULRU2G\VVH\LVDYDLODEOH
in which your knee touches the ground referees in Chinese wrestling often will at amazon.com
PAYCHECK

The Business of Tournament Promotion


$PRQJWKHYDULRXVHQWHUSULVHVPDUWLDODUWLVWVXVHWRƘQDQFLDOO\FDSLWDOL]HRQWKHLUH[SHUWLVHSHUKDSVWKHPRVWXELTXLWRXVLV
the tournament.
E\0DUN-DFREV

BOTH GOLDBERG  
# 

I
ǯ  
ǡ #ǫ  ϐ   % ǡ  "        

 
#Ǧ 

 #       
  #   # 

 
 ϐǦ 
 

)  ? 
     
 
     Ȅ   ǡ )     ) Ǥ   
  
   
  
ǡ    % 
 ϐ- #Ǧ 



% #  Ǥ 
 
ǡ %##   ǯ -
ers to local dojo,  
 
    
 ǡ 
ǯ  
 ϐ   )     %  ǡ    Ǥ    -

    
      ǯ %#
# %  
 % Ǥ      
 
 

 # 

  
 
ϐǤ      ǥ 
   
    

 #  #
 Ǥ ǫ     
or is it?    
   
 
#   " 
 #  # 
 
Dz  "   

   
 
    
 
  
)  # ǡ 
  ǡ 

  
     Ǧ


#   
  ǡdz 
 
 )    7  
 - 
  ) ǡ %
% Ǥ

# ǡ 
           Ȅ  # 
 ?  Ǥ Dz    
 
   

  

  
ǡ

  # " - 
 7 ǡ ǯ    
 #        
  )  % ǡdz    ? Ǧ
  
 
      Ǥ  
 
ǯ  )    
 
   %       
  Ǥ
Dz     ϐ 
  ǡ 
 
#  ) 

 
 Dz  %# #  # 
  ǡ 

ǯ  
" #
 

 ?  )  
 "  
  Ǥ  ) 

 )  #
ǯ

  # 
 Ǥ
 ) 
ϐ     
 ǯ  

% #     


 #  # "   
  ǡ%
 )   -

ϐ    #ǡ ϐ    %   #
 Ǥ       

  # #  % 

)  ǡ #      7  
-   
 
        -  Ǥ  
 # 
   
 ǡ 
  )  #Ǥdz    ǡ    ǡ   )   
     Ǥ   
  
Photo by Arztsamui/Shutterstock.com

   % 7 ǡ   ǡ     


   
  Ǥ
AT THE TOP
 
# ǯ 
Ǧ
  
    
     - Dz ǯ  

    #  # -
   #  #

    
 
    ‹ǡXXX)
Ǥ  # )  
      
) Ǥ  ǡ  
 ǯ
    "  ŒXǡXXX  
 )  #  #  %
   "  
ǡ 

  % 
  Ǥ )  
  "      ǡ

% #  Ǥ 


 

    
-

 # 
    "    - Dz   
 ϐ   
 Ǥ  
    ) Ǥdz

  )  ǯ %  


   )   #     
Ǥ      

# -
 %   
#


   #
  )  
Ȅ
    ǡ  
ǡ  PP 

  

 % "Ǧ
Ǧ% "  " Ǥ  
-   #  ǡ )   Ǥdz      ǡ   

    

24 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


independent promoters capable of hold-  ) ǡ  
ϐ 

  small tournament that will attract 200
ing a sizable open grappling event on his how to get insurance, as well as pro- competitors. If you charge those com-
own. The support he gets from his vast vide a pool of potential competitors petitors $50 apiece and each brings
student body makes this feasible. 
ϐ  Ǥ one spectator, whom you charge $10
Attempting to promote any martial One key component of that last item for admission, you’ll come close to
arts tournament without a school to is reciprocation: School A supports breaking even.
provide support is almost inconceiv- events staged by School B, and in re- 
 #     
ϐǡ 
ǯ  

able. In addition to serving as competi- turn, School B supports tournaments consider alternative income sources.
tors, that student base — and, ideally, put on by School A. They include food concessions, ven-
some family members — will be able “I always tell people interested in pro- dors (martial arts equipment compa-
to help set up the venue, work as score- moting a tournament that if you’re not nies that pay to set up a booth) and
keepers and timekeepers, and clean up willing to give up 20 weekends a year sponsors (companies that pay to have
at the end of the day. going to other tournaments, don’t think their name shown at the venue or in the
“You absolutely have to have a good %


 #



 ǡdz
- program). Do everything right, and you
staff [and volunteers] to make sure drigues said. may end up with a few thousand bucks
  
     ϐ  ǡdz 
- If all this sounds like a lot of effort, it is. at the end of the day.
drigues said. “I’ve actually gone to “Even for a small event, you have to Fortunately, organizing tournaments
tournaments where they forgot to put in a huge number of hours on pre-
 
 % ϐǤ
bring pencils for the scorekeepers. You   #ǡdz

% #  Ǥ Dz  


 
ǯ “Tournaments provide an impor-
need people you can trust to take care and you think it will succeed, you’re tant service in the martial arts com-

   #Ǥdz 

 #
 Ǥdz munity by allowing students to test
 

 
#  
    "  
) ǡdz  


)  ϐ  
  # 
- ALTHOUGH ORGANIZING a tourna- said. “A good, well-run tournament
ganization with a track record in tour- ment can bring in a nice supplemental can also help grow the industry and
nament promotion. Two such groups income for a martial arts instructor, you satisfy the needs of a certain group of
            
 
 shouldn’t make plans to get rich. martial artists.
of New England and the Amateur To hold an event, you’ll need to lay “There’s nothing wrong with also
#  

    Ǥ     -
 
 
Ǥ 
#    
ϐ # 
    
#  
ǯ 
tives can give advice on how to stage $12,000 is a reasonable amount for a  # # 7  ) Ǥdz

We know
your risks.
Our policies constantly
respond to changes in
your industry because
the most dangerous risk
is the one you never
saw coming.
Specialty insurance for
martial arts schools
martialartsinsurance.com 800-900-1155
facebook.com/markelhealthfitness
KARATE WAY

6XSUHPDF\RIWKH6ZRUGDV5HƙHFWHGLQ-DSDQHVH&XOWXUH
,Q(QJOLVKRXUVODQJH[SUHVVLRQVDQGLGLRPVUHƙHFWWKHUROHƘUHDUPVKDYHSOD\HGLQRXUKLVWRU\1RGRXEW\RXŚYHKHDUG
PDQ\RIWKHPŜ+HŚVƘULQJZLWKERWKEDUUHOVŝŜ<RXVKRXOGVWLFNWR\RXUJXQVŝDQGVRRQ
E\'DYH/RZU\

I
n Japan, the sword was the weap- It means the spacer is stuck — it’s pre- So the “menuki street” — dori is Japa-
on that dominated. Whether you venting the sword from being drawn, nese for “street” — means the central
were a samurai who carried two a potentially dangerous condition if a element that keeps the town together.
swords or a member of another ϐ# Ǥ Futokoro-gatana is another old term,
class who wore a single long or short Nukisashi naranu is a related expres- one that refers to the small dagger that
sword, the blade played an enormous sion. It refers to being unable either to was concealed in the folds of the ki-
role in your culture. As a result, the draw or resheathe your sword. In other mono. Women often carried them. The
Japanese language absorbed a num- words, you’re completely frustrated. word has come to mean someone who’s
ber of idioms — some of them just as secretly advising someone else — in
   
     
 ϐ  Ȅ MANY JAPANESE who use these idi- other words, a person who can be de-
that refer to the sword. These idioms oms have no idea what they originally pended on behind the scenes.

     ϐ 
  meant, just as Americans who say that
martial arts in Japan. something was done “lock, stock and TO ENGAGE in heavy combat, wheth-
barrel” might not be conscious of the 
   %  ϐ 
   % ǡ 
FOR EXAMPLE, if you don’t get along
#   #ȋ 
 ϐ 
"- sometimes called shinogi wo kezuru.
with someone, it’s a case of sori ga awa- ϐ ȌǤ     "
ǡ
 ? - Kezuru means “to shave.” The shinogi is
nai. Sori is the curvature of the sword. ple, that one term for the central street the ridgeline that runs the length of the
A scabbard must be custom-crafted so in a town, menuki dori, came from an- Japanese sword. If you’ve been in stren-
it matches that curve perfectly. Awanai other part of the sword’s furniture. uous combat, the ridge of your sword
means “doesn’t match.” So the sword A menuki is a small, molded orna- will have been scraped.
and the scabbard don’t match.   ϐ 
 
 
ǡ Want a great insult? Tell someone
      ϐ 

 wedged under the silk wrapping. It he’s katana no sabi — “a sword’s rust.”
and behind the hand guard of a sword helps keep the wrapping tight and al-     ǯ 
  # ϐ    
is called a seppa. “Spacer” might be a 
 
 
#  ϐ# wouldn’t be worth risking getting blood
good translation. To be seppa tsumaru on the weapon. As such, it’s vital to on your katana to kill him because that
 
 %     ϐ ǡ     
Ǥ keeping the hilt and the blade together. might lead to rust on the steel.

26 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


Another ancient insult is used to de- 
 %   
  ǯ   
 of their swords touching, each pushing
scribe a person who’s lost his skills: scabbard to smack against that of an- and struggling within inches of the oth-
Mukashi tsurugi, ima no usuba. “He other warrior. It was a serious insult, ǯ Ǥ 

")    ǡ% 


was once a sword; now he’s a vegeta- a challenge of sorts. Swordsmen who  ǡ       Ǥ   
 ǡ
ble chopper.” wanted to test their skills would de- someone would either use the hilt to
Remember, though, that katana no %   
) 
     - smash his opponent’s head, or drop
kizu wa naoseru ga kotoba no kizu wa
  
   
  his sword and start grappling. Tsuba
naosenai. Sword wounds can heal, but scabbard. That gave them the right to   ǡ 
 ) ǡ
  7   

  ϐ  %
 
Ǥ    
 % #  ϐ#Ǥ
 kendo bouts, in which neither the sharp
        
   #     - 
 # 
 
%
# -
TO RECONCILE    ϐ#
 - 
 %    " # 7  
 pling is a factor. The expression means
agreement can be expressed as moto no ϐ# #
) 
  #) Ǥ Dz
% ϐ# #      ǡ-
saya ni osamaru. Osamaru is “to settle” 
ǡ
    Ǥdz
or “to restore.” Moto no saya is “to re- “TO CUT to the chase” can be expressed
turn to the scabbard.” So returning the in Japanese as tanto chokunyu. It means IF YOU FEEL  
   

sword to its original place means mak- “to charge straight ahead with a short the aforementioned idioms on an un-
ing things right and coming to an ac- 
Ǥdz ǯ  
  #
ǯ 
- suspecting Japanese person, remember
commodation.  ǡ
 
#  #
    
  ? 
    Ǥ
The saya
  %%  
 ϐ#    matter at hand. 
 #     
    "  

  ? 
Dz
   ǡdz
saya Tsuba zeriai is familiar to fans of Japa- 

"  
         "
ate.   
   ǡ
  nese period dramas. A pair of samurai 

    " #

 %  )    %
 
) #    are locked in combat, the hand guards Shakespearean English.

“To cut to the chase” can be expressed in Japanese as tanto chokunyu. It


means “to charge straight ahead with a short sword.” It’s a way of saying
you’re committed, you want to get straight to the matter at hand.
HOW-TO

was feeling pretty good. A week later, I


was down 2 pounds, and a week after
that, 5.
I added a ton of highly seasoned veg-
# ǡ  

     ϐ )

and kept busy so as not to be preoccu-
pied with food.
The fourth week was easier. I was a
poster boy for eating right and I’d lost 2
more pounds. And so it went.

MY TRAINING SCHEDULE before cut-


ting weight was as follows:
• Monday: martial arts for 90 minutes
• Tuesday: weights (chest and back)
• Wednesday: martial arts for 90 min-
utes, weightless squats
• Thursday: weights (shoulders)
• Friday: martial arts for 45 minutes
• Saturday: weights (arms), weight-
less squats
• Sunday: rest
I kept this schedule and added two
exercises. First was walking. After
years of hard-core martial arts training,
walking seemed as rousing as playing
a game of croquet, but it encourages
weight loss and bone strengthening,
and it prevents heart disease, diabetes
and high blood pressure.
Because I was training hard with

Beat Cancer weights and martial arts, I walked only


30 minutes a day, but I kept my pace
fast to burn calories.
What could be worse than getting a call from your doctor announcing
The second thing I added was one-
that your prostate biopsy shows two cancerous spots? Getting that call on minute workouts. Research has shown
December 23. Merry Christmas. that people need to move every 20 min-
by Loren W. Christensen utes, even if they train in the evening,
to prevent a variety of health problems.

T
hree months earlier, I couldn’t packing a lot of muscle. He wanted my Little things can help — like walking
have told you what a prostate weight down. to the drinking fountain and standing
was. I knew that most older I’ve been lifting weights since I was while on the phone.
males have issues — although 13 and training in the martial arts — To augment that, I did 60-second
younger ones can, too — but I hadn’t karate, jujitsu and arnis — for 50 years, rounds of martial arts throughout the
given it much thought. I was in good so I knew I couldn’t drop 20 pounds day. For example, I would spar with an
shape, ate healthily, didn’t smoke and in eight weeks without it being mostly imaginary opponent, practice combina-
didn’t use drugs. If prostate cancer muscle. Ten maybe. tions, throw kicks up and down a hall-
wanted a victim, surely it would zap my I was weight-training three days a way, and block and counter while get-
beer-guzzling, burger-gnawing, ciga- week and practicing martial arts three ting up from a chair.
rette-sucking neighbor. days. They were already hard sessions, Because there was no warm-up, my
Nope. It picked me. so the best way for me to drop weight one-minute workouts were done at me-
I’ll spare you the decision-making my was to reduce calories and add short dium speed and with low kicks. I aimed
family and I went through as to which workouts throughout the day. for 10 sessions a day but sometimes did
surgery to have. Instead, I’ll explain how  #  # 
 ǡ  ϐ#    
- 20. Occasionally, I did two- and three-
I used the martial arts to prepare for the mula was simple: Eat less than you minute sessions.
operation and recover afterward. burn. A friend, a former football player While my intent was to burn a few ex-
who knew about cutting weight, said, tra calories, I found that my techniques
ALTHOUGH I WAS FIT, the doctor “Dropping pounds means you eat less improved, too. There were two reasons
said the procedure would go easier if of the foods you like.” for this:
I dropped 10 to 20 pounds. He either  ϐ       Ǥ First, I performed more reps of basic
didn’t factor in or didn’t care that I was By the fourth, I wasn’t as hungry and moves than before I got sick. Second,

28 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


because of my reduced calorie intake rehearsal in my chair or on a medita-
and extra exercise, I was training fa- tion cushion. Now I was doing it in my
tigued, so I had to focus on precision. training area.
The late Joe Lewis would deliberately You don’t have to go through a miser-
exhaust himself before sparring so he % # 
%   

  
was forced to concentrate on strategy workouts. You can do them whenever
and form. you want a day off from training or
By the time my surgery rolled around, need extra practice but don’t want to
I had dropped 19 pounds — some of change clothes or get sweaty.
it muscle — and was in great shape. I One example of what I did is the
peaked on April 13 and had the surgery roundhouse kick. I’d stand in front of a
on April 14. On April 15, my newly im- heavy bag and, because I had to stand

)  ϐ  ) 
  Ǥ ǡ  straight-legged, mentally assume a bent-
like that. leg stance. Then I’d pivot my lead foot
slightly to the outside, slowly lift my
IF LOSING ALL I’d gained in 24 hours rear foot about 3 inches and stop. In my
wasn’t bad enough, the doctor said I mind, I’d whip my rear leg into the bag,
couldn’t do anything physical for eight set it down in front and kick with my
weeks other than walk. “You mean eight other leg. I usually did 50 reps per leg.
days?” I choked, since I’d never gone Another example is the eye gouge–

#  ϐ)  
   #Ǥ cross punch combination. I’d look at
“Weeks,” he said. “Damage the work I BOB’s eyes and slowly extend my lead
did inside you, and it’ll be eight months.” hand about 12 inches. Mentally, though,
As it turned out, I could move only ǯ   ϐ #    

like a newborn fawn anyway. The pain eye sockets, hear his scream and see his
was in the stratosphere, but the creep anguished face. Then I’d slowly extend
factor from having two drain catheters a cross punch a few inches, although
coming out of me and six bleeding in- mentally I could see, feel and hear my
cision sites in my belly was higher. By ϐ  

  ?Ǥ †X
day three, however, I slow-walked 100 reps on each side.
yards down the block — and barely
wobbled back. I did it again the next AT SEVEN WEEKS, I started walking
day, and by day four, I was up to a per- while throwing relaxed but fully ex-
spiring 200 yards. Each day and each tended hand techniques and low front
passing week, I increased the distance kicks, both without hip torque and with
toward a goal of walking 45 minutes a a relaxed core. I couldn’t do many, but
day. By week four, I’d made it. each day, I added more. At week eight,
   #
) % "ϐ) ǡ the doctor said I could resume training

 ϐ#  

     but advised me to go s-l-o-w-l-y.
exercises. After training for many de-     #   ϐ %   
cades with weights and martial arts, I martial arts knowledge and my physi-
knew I could keep my core relaxed and cal response weren’t in sync. But as I
uninvolved. My “resistance” consisted had done in the previous four months,
of walking around my training area I drew on the cornerstones of the mar-
while curling an 8-pound club. I did the tial arts — perseverance, indomitable
same thing with shoulder laterals and spirit, goal setting and internal strength
triceps kickbacks. — to beat the pain.
The result: I’m on the path back.
PRIOR TO THE SURGERY, I showed
the doctor a couple of karate moves,
and he blared, “Absolutely no.” My only  ABOUT THE AUTHOR: A martial artist
since 1965, Loren W. Christensen has written
option was to do mental martial arts more than 50 books, one of which is Mental
workouts. Usually, I practiced mental Rehearsal for Warriors. lwcbooks.com

POWER OF THE MIND


Mental rehearsal, sometimes called mental imagery or visualization, is a natural
process and one of the most powerful psychological tools for improving your
martial arts. Some 90 percent of athletes and 94 percent of coaches surveyed at
the U.S. Olympic Training Center said they used mental rehearsal. Of those, 97
percent of the athletes and 100 percent of the coaches agreed that it improved
their performance.
FIT TO FIGHT

Strength Without vers through space. They’re powered,


of course, by the contraction and relax-
that easy to put on. It takes years to add
substantial amounts of mass. You’re in
ation of muscles. It’s important to note no danger of waking up huge!
6DFULƘFLQJ6SHHG that muscles don’t push; they only con-
tract or relax, which is why muscular
Furthermore, if at any time you feel
like you’ve gained too much muscle,
DQG)OH[LELOLW\ balance is so important.
Consider the arm as an example. The
you can simply stop lifting. The added
mass will subside over time. Always re-
E\,DQ/DXHU&6&6 main muscle groups involved in move- member that it’s what you put in your
ment at the elbow are the biceps and mouth, more so than what you put on

Q: “I want to get stronger, but I


avoid weightlifting because
I’ve always heard it makes you slow
 Ǥ 
 ϐ ? 
 ǡ

 
your biceps and relax your triceps. The
opposite holds for an arm extension.
the barbell, that affects how much mass
gets added to your body.

 
ϔ   Ǥ

ǫdz The same basic principle applies across SECRET NO. 2 — FLEXIBILITY If you
the body. lose it, you’ll experience reduced range

A: Old-school weightlifting is
one of the best ways to build
strength. Weight workouts are also a
So what does this mean for martial
artists? You need to choose your ex-
ercises intelligently so they promote
of motion and decreased speed. For
   
ǡ 
ǯ  ϐ    %  #
concerned. The good news is this is
tried-and-true method for improving muscular balance. Pushing exercises very easy to combat. Just take a little
your personal power output. There are, (bench press, shoulder press and so on) time every day to warm up your mus-
however, a few secrets to success you must be countered by pulling exercises cles and stretch. It will pay huge divi-
may not know. Once you master them, (barbell row, lat pulldown, etc.).    ϐ ?%   Ǥ
you’ll drastically improve your strength Balance also pertains to different You probably knew that already,

 ϐ  #
  % 
 parts of the body. For example, as you but did you know that, done right,

   
ϐ  Ǥ work to develop your upper body, don’t weight training can actually im-
neglect your lower body. prove flexibility? When you work
SECRET NO. 1 — BALANCE  ϐ This is not to say that you have to through a full range of motion with
glance, the word “balance” probably work opposing groups or all muscle a weight, you put your muscles in a
makes you think about standing on groups on the same day. Rather, you fully stretched position during the
one foot for an extended period, but need to devote roughly equal attention relaxation phase. In essence, each
in this case, I’m referring to muscular to each body part throughout the week. set of an exercise is a series of short
balance. When it comes to movement, Martial artists often fear that weight stretches followed by contractions.
the human body is essentially a series training will make them bulky and slow. As long as you maintain proper form
of levers. It follows that a martial art is Speaking from years of experience with and work through the full range of
an expression of the movement of le- weights, I can tell you that muscle is not motion, it can be very beneficial.

30 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


When you couple standard lengthening stretches with this pre-
´¼±b¼O|bYÁOY¼n¼|bn8´O8VÊÁ®±b bʼ´bbqbÉF¼Ê
t8´FbÊYÈ|8¼®´´´Fbȼ|´¼±b¼O|t8b¡
Another factor to consider is the   
 
 
   
    -    
 Ǥ
%  #
% ϐ
    # 
     ?   
 % 
 
     

 %  #



"
Ǥ 
ǡ
- 
 
)  
    
 Ǥ     ? 
ǡ 
 
  ?-
       
 Ǥ     #

 ) Ǥ    "  


 
 Ǥ
"
   Dzdz #)   Ǥ 
   
         
   ǡ       Ȅ  
-      
 
 7  STILL NOT SOLD
  #    #ǫ
)           ϐ%  
  
)  ǡ 
   
    "  
 


"
  dojo
    
  
   
)   
 Ǥ 
 
   
 

% 
ϐ ?% Ȅ        % -              ϐ ǡ
 % " % 


 

 
    ?   Ǥ ǯ  #can 
    -  Ǥ  #  %##  
# 

  "   #  
  % 

Ǥ  
ǡ%
 ǯ ) 
Ǥ  
   ) Ǥ      ?    ǡ
   #
  ǡ   % 

    Ǥ )
     
  
 
  ǯ        ǯ)  )  % Ǥ


  % #
  ? 
Ǥ
  )    #
      ǫ
 #ǡ       Ǥ 
      ? 
  )  
   
# ## )   #Ǧ Ǧ
-

      #  #      Ǧ  

ǡ  Ǧ
ϐ- 
 #
#   
Ǧ 


 Ǧ   

    %  #Ǥ ǯ
   -  #   #Ǥ

    ǡ
ǯ " 
 ϐ ?%-  
  
   Ǥ #  
   


 #   % 
  ǯ 
%      # %

    Ǧ  
   # 
Ǥ

     
Ǥ -
      #   
     ABOUT THE AUTHOR: Ian Lauer is a cer-
WLÀHGVWUHQJWKDQGFRQGLWLRQLQJVSHFLDOLVWDQGD
SECRET NO. 3 — RELAXATION 
ǯ)   Ǧ
ϐ ǡ  
  ? ÀUVWGHJUHHEODFNEHOWLQNDUDWH+HᅣVFXUUHQWO\

% %         
 %  
"
  #%  VWXG\LQJ$PHULFDQNHQSRLDQODXHUFRP
Bruce
Lee
ac y L i v e s On!
L eg

E X
C L
U S
I V E

“Bruce Lee” is a registered trademark of Bruce Lee Enterprises LLC. The Bruce Lee name, image and
I N T

likeness are intellectual property of Bruce Lee Enterprises LLC. Photos © Bruce Lee Enterprises.
E R
V I E
W

Shannon Lee Talks About New Projects Involving Her Famous Father and Reveals
Why She’s Devoted Her Life to Preserving His Message
INTERVIEW BY ROBERT W. YOUNG
Your father’s name has been in the walk. That person you see in Enter the and he’s always genuine. Of course I’d
news a lot recently. Probably the Dragon was that person in real life. I had all my father’s notes and writings
biggest story came in late March, just don’t think that can be replicated. on this particular project for years and
when Brett Ratner, director of the years, but Justin provided the impetus
Rush Hour movies, talked about a So you’re saying that your father to make us say, “Let’s do it the way
possible plan to remake Enter the is an icon not just because of his Bruce Lee would have wanted.” He
Dragon. martial arts movies. It’s because cares a lot about the project. The hope
Actually, we’re not involved in that. of the man behind them, his is that it will be this brilliant piece of
Warner Bros. owns Enter the Dragon, philosophies, his knowledge of entertainment, and we’re doing our
and certainly they can remake it if ϔ Ǥ best to make that happen.
they’d like to. I do think it would be  ϐ  Ǥ  

#   
silly to remake that movie because the the scenes in Enter the Dragon, and he The next thing that’s putting
thing that made it such a smash was added so much of the philosophical Bruce Lee in the news is the 75 th
Bruce Lee. If you take him out of it, you dialogue that was in the movie. All anniversary of his birth, which is
basically have a James Bondian plot    
 %    Ȅ   ϐ #  %#  'Ǥǯ
with some person doing what I’m sure pointing at the moon, the art of   ǫ
would be interesting and fun action ϐ# #
ϐ# #Ȅ    We’ve actually been celebrating my
sequences, but I don’t know that it’s from him. And then there’s his own father’s birthday all year, but there are
possible to make that into a classic — physicality and skill. I just don’t know also things coming up. On our social
not without Bruce Lee in it. that it can be replicated … or that media outlets — Facebook, primarily,
anyone should try. (laughs) but also Twitter and Instagram —
When The Green Hornet was made we’re doing 75 special posts in honor
 
ϔ   What can you tell us about Warrior of the 75th birthday. They consist
Chou was selected to portray Kato, 
ǡ    of other people’s remembrances,
fans found themselves comparing Ƭ

"ǡ  #  Ƭ thoughts and quotes about my father.
him with your father, and in the

ǫ We’ll be doing some video interviews
eyes of most, Chou was seen as We have a deal with Cinemax. We just with people who knew him, as well.
“unworthy.” It would seem that any closed our deal with Jonathan Tropper We’re doing lots of specials and
actor or martial artist chosen to to write it and Justin Lin — he’s my giveaways — for example, 75 limited-
reprise Bruce Lee’s character in partner on the project — to direct the edition items that are available through
   
 ϔ pilot. We’re getting ready to work on our store. We’re doing giveaways of
an impossible battle. the script with Jonathan. By the end of Bruce and Brandon prints because
I think so, too. The thing I always   ǡ 
 
 ϐ #Ǥ ǯ it’s also my brother’s 50th birthday
say about my father is the reason he producing and consulting — helping celebration. We recently started
was so compelling to watch on-screen put a “Bruce Lee touch” on all of it.  
ǯ
ϐ   %

" # Ǥ
and his legacy exists so boldly and On October 24, the Bruce Lee
vibrantly today is because of him. He It must be exciting for you Foundation will hold the Bruce Lee
was such a self-cultivated, authentic, personally to be involved in a crime Festival in Las Vegas. It’s going to
powerful presence, and he expressed drama based on your father’s notes. be a big celebration downtown with
that in his every move, every word So exciting! I have to credit Justin. screenings, speakers, music and other
and every deed. He really walked the I’ve met with him on several occasions, events. We’ll have more information in
a month or so.
That festival will kick off an online
 
   ϐ
  
 
) % ǡ
which is my father’s birth month. In

) % ǡ ǯ  

 #  ?%
and fundraiser in Hong Kong. That’s
all for the 75th . There are other things
happening, too.

What’s happening with the Bruce


Lee exhibit at the museum in
  ǫ
Over the past few years, the
Photo Courtesy of Wing Luke Museum

foundation has worked with different


museums to create exhibits. For
example, we have an exhibit at the
Hong Kong Heritage Museum that will
%   
 ϐ)   Ǥ      )  
exhibit in Seattle at the Wing Luke
Museum, which will be up for another
three years.

34 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


,
Lee s Links
Bruce Lee on Facebook
facebook.com/BruceLee
Brandon Lee on Facebook
IDFHERRNFRP%UDQGRQ%/HH2IÀFLDO
%UXFH/HHRQ7ZLWWHU
#EUXFHOHH
Bruce Lee on YouTube
\RXWXEHFRPXVHU%UXFH/HH2IÀFLDO3DJH
%UXFH/HH)RXQGDWLRQ
EUXFHOHHIRXQGDWLRQFRP
%UXFH/HHVWRUHEORJQHZV
EUXFHOHHFRP
%UXFH/HHH[KLELWDW:LQJ/XNH0XVHXP
ZLQJOXNHRUJEUXFHOHH

We’re in communication with a Lee and his legacy, or has it always lot of people just want to use the name
group in Seattle to work out all the been that way? to create products or businesses,
details for our own space. In the next I think in Hong Kong, it has always but we feel there has to be more to it
eight to nine months, we’ll be doing been that way. When it comes to than that. We try to make sure people
the design and feasibility work, and Greater China, it seems that now understand what the message is.
then I hope we’ll be able to present people want to do more with the
something shortly thereafter. We’re Bruce Lee name. It’s an interesting Tommy Gong, author of Bruce Lee:
also creating an online presence for dynamic because my father’s name is The Evolution of a Martial Artist,
the museum so people can get access very well-known in China, but a lot of 
 
   ϔ
to some of the collections, virtually if the younger generation doesn’t know and mentioned the same thing
not physically quite yet. much about him. They haven’t seen the — that you’re working hard to
ϐǡ  
ǯ"
   spread knowledge of your father’s
Regarding the museum in Hong of his legacy, the inspiration of his philosophies.
Kong: Do you think China is message or the way he lived his life. I’m This is why I’m involved in the
becoming more interested in Bruce  #
ϐ   
    Ǥ business, honestly. If my father had

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 35


made a handful of kick-ass movies in to get value from it. The message I think he had a receptive mind from
the ’70s and there was an opportunity is universal: using no way as way, the beginning and was always very
to exploit that by putting photos on having no limitation as limitation. curious. He liked to push the envelope
T-shirts to make money — I wouldn’t Keeping that alive, inspiring people and test things. When the martial arts
be interested in putting all my energy and putting out something positive in and the philosophies started making
into that. the world is what really appeals to me. their way into his universe, he was the
The thing I want to put my energy perfect vessel for it. He turned it into
toward is the philosophy. So much Do you think the philosophies your a personal quest and started reading
value comes from being around that father is known for grew out of his Eastern and Western philosophy
and trying to live my life in a better martial arts practice, or were they books and using himself as a life
way, the self-actualization and self- conceived by him to be bigger than experiment.
cultivation, who I am and what the martial arts?
walking my own path means. It’s That’s a good question. I would say What’s the best resource for people
inspirational, especially the way my the philosophies grew out of his martial who are interested in Bruce Lee’s
father overcame obstacles and worked arts practice. He started when he was philosophies?
so hard and believed in himself. 13, which is quite young. He really Obviously, Tao of Jeet Kune Do is a
It’s a message worth putting out tried to embody what he learned from great resource. It’s not just a martial
there. It resonates with so many Yip Man. My father would write about arts book. I know people who are
people from different walks of life. suddenly understanding something not martial artists who tell me how
You don’t have to be a martial artist such as what it means to be like water. much they’ve gotten out of it because

36 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


Must-Have Bruce Lee Books and DVDs
Tao of Jeet Kune Do: Expanded Edition paper and e-book
%UXFH/HH·V)LJKWLQJ0HWKRG7KH&RPSOHWH(GLWLRQ paper and e-book
%UXFH/HH7KH(YROXWLRQRID0DUWLDO$UWLVW paper and e-book
%UXFH/HH·V)LJKWLQJ0HWKRG%DVLF7UDLQLQJ DVD
%UXFH/HH:LVGRPIRUWKH:D\ paper and e-book
%UXFH/HH7KH,QFRPSDUDEOH)LJKWHU paper book
&KLQHVH*XQJ)X5HYLVHGDQG8SGDWHG paper and e-book

I think he’d be one hell of a 75-year-


old! (laughs) We’d probably have
YouTube videos of him doing impressive
things at 75. He was a person who was
extremely passionate about life, so I
think he’d be engaged in a lot of things
while still giving himself opportunities
to express himself on any subject,
      ϐ " #ǡ %  # 
ϐ# 
  #Ǥ
But because his journey was one
of introspection and ultimately
expression of that, I believe that he
would have continued to be a teacher.
He had a real desire to help people and

ϐ 
 
       
going on a journey and go through the
process with them. He wanted people
to search inside themselves for their
own path. Maybe not just in martial
ǡ  %      ϐ 
  

cultivation, but I know he would have
been a teacher.

With all this talk about your father’s


focus on philosophy, do you think
that people who regard him only
as a martial arts technician are


ϔ   “This summer,
the moon? we’ll be
it’s balanced between technique and (laughs) I guess it depends on why introducing a
philosophy. And it’s his thoughts from they’re looking. If you’re working on tea product. My
cover to cover. your punching and you’re looking father used to
That little book Bruce Lee: Wisdom at his techniques, there’s obviously drink a lot of
for the Way is a wonderful primer, if good information in that. But he was tea. He would put
you will, because it’s so easy to take concerned about the physical, the
supplements in
6KDQQRQ/HH3KRWR&RXUWHV\RI)HDWXUHÀDVK6KXWWHUVWRFNFRP

in with just a quote and an image per mental and the spiritual aspects of
 # Ǥ 
  ϐ 
   #    " things. So if people are only looking
his tea and drink
up a pearl of wisdom for the day. It’s at the physical, they’re missing a lot of it throughout
a nice entry path into his philosophy. really good things. But they’re on their the day. So we
Of course there are other books with own journey … created a tea
quotes, but I always think of these two that has his
as great gateway books. … And they might come around to supplement
look at the bigger picture later? formula in it. We
On the occasion of the 75 th  ǯ#Ǥ
 ) 
ϐ   will be rolling it
celebration of his birthday, what Lee — whether it’s through martial
out in Southern
do you think your father would be arts, through movies or through
doing now? Would he be a writer, a a cool T-shirt — once he’s in your
California this
philosopher, a moviemaker, a martial consciousness, you can’t help but go to summer.” ³6KDQQRQ/HH
arts instructor, an MMA fan? the next place.

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 37


5 GATES
OF JEET KUNE DO
TECHNIQUES FOR
STOPPING ANY PUNCH AND
EXECUTING AN IMMEDIATE
FIGHT-ENDING COUNTER

BY RICHARD BUSTILLO | PHOTOGRAPHY BY ROBERT REIFF

I
 ) ϐ ?
 
 
#  
wing
chun " #     # jeet kune do   
      
 
        PŒQXǤ
  #   #       


    # #      "      


"  Ǥ      
 #   %  
   
  "  
#  ǣ   #Ǧ# 7  ǡ
 #Ǧ 7  ǡ 
Ǧ#7    

Ǧ 7  Ǥ
 #   
   #      
#   ǡ%
   7   ǯ 
 
Ǧ
#   
Ǥ  ) #   ? )  %
? #
 )
  
 
 ǯ " 
ǡ 

 
  ϐ#  Ǥ 
  
     #  
 # Ǧ   HUN TO JKD
F ROM WING C
   #  Ǧ 
wu-style tai
 %Ǥ  
#  ǡ Lee cut his teeth in
Even though Bruce didn’t begin
   ϐ)    )  ge of his father, he
chi under the tutela rolled in Yip
 
ǡ       til, at age 13, he en
serious training un s to acquire the
ϐ)  #  
   "  
ǡ rpose wa
school. His sole pu
Man’s [OH[Y\SLK
Y]P]L[OLZ[YLL[ÄNO[Z
ZRPSSZULLKLK[VZ\ .
alleys and rooftops
Hong Kong’s back ms : si lum tao’s “little
ee classica l for
Lee learned all thr e” and bil jee’s
s “seeking the bridg
idea form,” chum kil’ PVYZ[\KLU[Z;V
VT@PWHUKOPZZLU
¸ZOVV[PUNÄUNLYZ¹MY hands, and 60 of
chi sao, or sticking
that base he added oden dummy.
designed for the wo
the 108 movements tra inin g Lee received.
only formal
Wing chun was the HULV\ZISVJR
`VMTV[PVUZPT\S[
;OLPKLHZVMLJVUVT constant
theory, interception,
and hit, centerline ha ve struck a
d sensitivity must
forward pressure an me the core of JKD.
use they be ca
chord with him beca — Harinder Singh

40 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


The opponent (left), in a right
lead, is about to attack Richard
Bustillo with a straight left cross
(1). When the man punches,
1
Bustillo simultaneously parries
the blow with his left hand and
punches with his right (2). Note
how the response puts Bustillo’s
left hand in position for his next
Z[YPRL!HSLM[OHTTLYÄZ[[V[OL
jaw that’s executed while he
draws his right arm back in
preparation for his follow-up (3).
If needed, Bustillo can use the
backward motion of his right arm
to yank the man off-balance.
Bustillo continues with a right 2
hook punch to the side or back
of the head, which causes
the man to fall forward (4). He
capitalizes on the opponent’s
downward motion by twisting
clockwise and driving his left
knee up and into the man’s solar
plexus (5). Bustillo then steps
IHJRHUKÄUPZOLZ^P[OHSV^
inside-leg kick (6).

6
Standing in a right lead, the
attacker (left) throws a body punch
that comes from Richard Bustillo’s
1 low-left quadrant (1). Bustillo blocks
the weapon with his left forearm and
simultaneously effects a right punch
to the face (2). Note how he twists his
body slightly to his left to set up his
next move, which entails turning to the
right. Bustillo slams a left punch into
the man’s ribs (3) and follows up with a
right hook to the jaw (4). The jeet kune
KVZ[`SPZ[ÄUPZOLZ[OLZHTL^H`·^P[O
a left knee to the abdomen (5) and a
low kick to the leg (6).
2

constitute an essential component


of self-defense.
Bruce Lee taught us the
importance of being simple,
direct and practical in our
martial arts training and
ϐ# #ǡ   
 

  
   ϐ)  #  Ǥ 
3 %    ǯ    )   
nature, they should not be

    ) Ǥ   ǡ

 #  ϐ) Ǧ#   


 %  )     ) 
blocking. A superior defense


 %
"   
one hand (or foot) executed

   " 
from the other hand (or foot).
 
 ǡ ǯ

4  #
  
  ) 
 

   )  #  
  
" 



)  
  
picture. Rather, my intention is


   ?  
 
ǯ)  
  
 %   )  Ȅ 

     ǯ 
%   
you use this fighting method.
 
% 
  
  
should take a fraction of a second

 
ǡ    ?   

5    #
   
)  
  ) Ǥ ǯ


# 
the full scope of the techniques,

 

    
  "  ǡ 

  ǡ   
  Ǥ  
one central principle you should
    ϐ  

  
 Ǥ

For more information, visit


richardbustillo.com or
6 imbacademy.com.
The opponent (right) assumes a right lead (1). When he punches from the high-left quadrant,
Richard Bustillo parries the blow with his left arm and simultaneously punches with his right
(2). He follows up with a strike that uses the blade of his left hand to hit the back of the neck
(3). Bustillo continues with a right hook to the jaw (4). Now at inside range, Bustillo executes 1
a left knee strike to the torso (5)/LZ[LWZIHJR^P[OOPZSLM[SLNHUKÄUPZOLZ^P[OHSV^RPJR[V
the inside of the opponent’s right leg (6). Note how the main attack sequence — right hook, left
RULLYPNO[RPJR·PZ[OLZHTLHZPU[OLÄYZ[[LJOUPX\L6US`[OLÄYZ[WHY[VM[OLZLX\LUJLPZ
TVKPÄLK[VKLHS^P[O[OLKPMMLYLU[H[[HJR)\Z[PSSVZH`Z12+ZOV\SKILZPTWSLHUKKPYLJ[

BUSTILLO BIO
Q: What martial arts experience
did you stretched out before working
have before you took up jeet kune on 2
do? strength training and JKD tech
A: I practiced judo at 8, boxing niques.
at 12, The second half of the class
kajukenbo at 14, boxing again was
at 19 sparring. Emphasis was put on
and then jeet kune do at 24. being
I studied practical and functional in app
escrima and kali, muay Thai, lication.
catch-as- Perfection, accuracy, speed and
catch-can wrestling, and jujits power
u during — in that order — were the mai
and after learning Bruce Lee’s n focus
JKD. when working on techniques.

Q: Did Lee take offense when


he Q: Did you receive rank directly
learned that you were interest from
ed in Lee?
other arts? 3
A:0YLJLP]LKHÄYZ[YHURJLY[PÄJ
A: He would never take offense H[L
at any MYVT)Y\JLPU:LW[LTILY 
of his students who were inte 0[
rested opened doors and opportunitie
in other martial arts. He practice s I never
d and expected I would be involved
preached being opened-minded in for the
to rest of my life.
all arts. “Using no way as way
” and
“having no limitation as limitatio
n” was Q: Did you ever spar with him
his philosophy. ?
A: I, and all the students, spa
rred
with him at one time or another
Q:/V^KPK`V\YÄYZ[TLL[PUN^ . My
P[O3LL ÄYZ[ZWHYYPUNLUJV\U[LY^P[OO
come about? PT^HZ
humiliating and frustrating. He
A:0ÄYZ[TL[)Y\JLH[[OL  was
nonclassical and nontradition 4
International Karate [Champi al in his
onships] sparring, and I was very tradition
in Long Beach, California. My al, stiff
initial and nervous in the beginning.
impression was that he was aver
age
in appearance. But when he
took Q:>P[OOPZZWHYYPUNWYV^LZZ^
off his shirt and performed his V\SK
art, it Lee have done well in point kara
was: “Wow! This is the real dea te?
l. He’s A: The traditional martial arts
H^LZVTL¹/L^HZ]LY`JVUÄ
KLU[HUK competition of point karate has
self-assured. evolved
into today’s mixed martial arts
, which
Bruce would have loved. It’s
Q: What impressed you most? closer
to the concepts of his jeet kun
A: His physical power and exp e do. 5
losive Each MMA competitor is effe
speed when he executed his ctively
practicing his or her own jeet
JKD techniques, coupled with kune do,
whether he or she realizes it
his presentation of his concep or not, and
ts, is expressing his or her own
philosophy and martial arts train individual
ing. martial arts skills. Of course,
there are
rules in MMA competition suc
Q: What were Lee’s Chinatow h as no
n classes biting, no eye strikes and no
like? hitting
to the groin area. As in all mar
A: The average class size was tial arts
competition, the rules are for
about 12. It was always intense the safety
of the competitor.
and combative. We warmed
up and
— Paul J. Bax 6
*ƬǔǔăǒŘɡƬnj ʁŘăɡ ʁǜʊ<ǔǏƬʁƬǜ
From Being in Shape for Self-Defense!
BY SCOTT SONNON
Photos Courtesy of Scott Sonnon
ĶǒŘǜǔʊǒ
Ƭ nj ʁǜǒƬǞǜ
ƬʊʊƬ
ǜǒˁʊǔŘʊǜ can be poison you to face uncooperative opponents

    Ǥ ǯ%    Ǧ

ǡ Ǧ%    
 ?   
Ǥ
%  Ǧ   
 
#ϐ#Ǥ

#
%    #
 Ǧ
velop the wrong energy, but you also might be developing your muscles in a way ŘƬ ˁǜʁŘǔƬƞǜƞƬƬǚɡ ˁʁŘŽǔǚȊ
   # 



 
 

  7 Ǥ ǔǜ  ǜ Ƭ ǒǔǚƬ ƬƬƋˁǜǔ  ǜǒƬ ʊǘǔǚǚʊ

ǡ
#%  " #
 ϐ
 
#ϐ#Ǥ     ˁǔǜƬƞǜˁʊƬɵ


) 
ǡ

   ϐ  


  

 

 Ǧ Your biomechanical preparation deter-
   Ȅ ) 
#
 
   )
)  
#
 
ϐǤ mines whether your training is helping
    ?   
 
"

%Dz  ϐ dz%
Ǧ you learn how to absorb and deliver
ing three questions, highlighting some relevant research, and demonstrating two power while moving the way one does
 Ǧ    7   ?       # 
 #  Ǥ   ϐ#Ǥ 
%ǣ ǯ%  



 
 
#   ) 
 
    Ǧ
  
 
 throw a pebble from good footing than
  Ǧ 
  
ϐ ǡ    
      
     Ǧ ϐ  

 
Ǥ
     #  Ǧ     Ǥ  

    ǡ 
practitioners have watched the power
of their strikes and kicks evaporate on
CRUCIAL QUESTIONS though the attackers are using poor impact, leaving their opponent virtually
Have you trained the right energy sys-   7 Ǥ   
%  %      Ǥ   
  Ǧ
ǜƬnjʁǜǒƬǞ ǒǜ ˁɻʁƬƬɡƬƋǜǔ ɵ although they’re exerting themselves, tial artists failed to develop their struc-
Your metabolic preparation deter- the attackers retain enough energy   

#
  ?   Ǥ
mines whether your training is getting to deliver that “lucky shot” at just the
you ready for physical exertion that #  Ǥ    "  
  Æ Being unable to generate power and
     

  ϐ#Ǥ  ϐ#  from having developed good timing transfer it to the target while moving
not a marathon; it’s more like a sprint and energy conservation through re- — or from a position you momentarily
that may or may not be followed by petitive encounters with victims — for ϐ 
  %   ) Ȅ
some jogging and then another sprint  ǡǯ"    #Ǥ is one of the dangers of focusing only on
Ȅ
 Ǥ kata  Ǥ
 

ǯ
 
Many videos of street assaults show Æ   #

 #    ϐ#  the development of the awareness and
incidents in which untrained attackers one of the dangers you face when you mobility you need for self-defense in a
knock out trained martial artists even elect not to engage in drills that force    )
 Ǥ

EXERCISE TO ENHANCE SAMBO GUN DISARM 1 The two-handed


GLDJRQDOFUXQFKXVLQJDFOXEEHOOGHYHORSVWKHPDUWLDODUWLVW·VDELOLW\WR
strike with the elbows. Such techniques derive power from abdominal
FRQWUDFWLRQDQGIURPWKHSRVWHULRUFKDLQRIPXVFOHVQRWPHUHO\IURP
WKHVKRXOGHUV:KLOHO\LQJRQKLVEDFN6FRWW6RQQRQUHDFKHVRYHUKHDG
and grasps the clubbell as shown (1). This position pre-stretches his
XSSHUERG\HQDEOLQJKLPWRPD[LPDOO\FRQWUDFWKLVPXVFOHVGXULQJWKH
H[HUFLVH1H[WKHH[KDOHVDQGWLJKWHQVKLVFRUHWKHQH[SORVLYHO\SXOOV
with his right elbow moving toward his ribs and his left arm driving that
hand forward while his core contracts (2).

46 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


1 2 3

SAMBO GUN DISARM 1 When facing an


attacker, Scott Sonnon assumes a ready
stance and offers to give the man whatever
he wants (1),IKH·VIRUFHGWRÀJKW6RQQRQ
VKLIWVKLVERG\RIIWKHOLQHRIÀUHZKLOH
using his lead hand to control the weapon
(2). His other hand grabs the slide (3) and
provides him with enough leverage to bend
WKHDWWDFNHU·VZULVWVRWKHJXQSRLQWVEDFN
at him (4). Sonnon effects an elbow strike
WRWKHKHDGWKHQVWULSVWKHÀUHDUPIURPWKH
PDQ·VJULSDQGUDFNVWKHVOLGHWRFOHDULW
(5)+HÀQLVKHVZLWKDIRUHDUPVWULNHWRWKH
QHFNDIWHUZKLFKKHKDVWKHRSWLRQRIÀULQJ
the weapon (6).

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 47


EXERCISE TO ENHANCE SAMBO GUN DISARM 2: Scott Sonnon created this medicine-ball exercise to enhance strikes that
GHULYHSRZHUIURPKLSURWDWLRQ)URPDFURXFKHGÀJKWLQJVWDQFHKHOHDQVIRUZDUGDWGHJUHHVDQGOLIWVWKHPHGLFLQHEDOOKLJK
DJDLQVWKLVULEV(1)+HWKHQH[KDOHVDQGGULYHVKLVSDOPKHHOGRZQZDUGPDNLQJVXUHWRFRQWUDFWKLVFRUHDQGÀUHKLVUHDUKLSPXVFOHV

1 2

Have you trained to recover from den stress, recover quickly and regain & Exercise, the authors claim that per-
stress and reacquire your skills during your mental composure so you can 
  ϐ 
 
)  
ŘǞ ǒǜɵ
   ϐ#Ǥ you do in training and the tempo and
Your biochemical preparation deter- pace with which you do them.
mines whether you can rapidly regain PROPER DRILLING Ellen Kreighbaum and Katharine
your wherewithal in order to physi- You can reduce the chance that you’ll M. Barthels wrote in Biomechanics:
cally respond in a violent encounter. be affected by the aforementioned A Qualitative Approach for Studying
This can be challenging because of the dangers by running through properly Human Movement that training spe-
extreme levels of stress that violence or designed self-defense drills on a regu- ϐ  
      ǡ 
  
Ǧ
the threat of violence can bring. lar basis, but that will take you only so tion, speed and type of contraction
How fast you chemically recover far. You also should address the issue produces improvement only for those
determines whether you experience by engaging in the right kinds of phys- 
)  Ǥ  ϐ     #  
courage or cowardice. To paraphrase ical conditioning. the greatest improvements.
Vince Lombardi, excessive stress Exercise science teaches a principle What this means is the transfer of an
makes cowards of us all. This is usually   ǡ  
Dz ϐ  exercise to a skill — in this case, a mar-
what happens when a martial artist adaptation to imposed demands.” It tial arts technique — will happen only
who’s experienced only at sparring in holds that how well you perform is di- if the exercise and the skill are very
the dojo or competing in tournaments rectly proportional to how well you’ve similar. Semyon M. Slobounov noted in
gets caught in an ambush and is un- prepared. (In reality, it’s more accurate Injuries in Athletics: Causes and Conse-
able to recover — even when it’s only to say the worst you’ve prepared is quences that as the degree of similarity
a training simulation. the best you can hope to perform, but between exercise and the skill decreas-
 ǯ % 

    ǤȌ ǡ % ϐ     )  Ǧ
Æ Being unable to regroup and coun- When creating an exercise routine,  ) 
ϐ Ǥ
  ǡ

terattack is one of the dangers of prac- it pays to keep in mind the advice of exercise choices can hurt your perfor-
ticing in only preplanned conditions. ? Ǥ  Dz ϐ 
    #ǣ mance of a martial arts technique.
ǯ 
 % ϐ  
% 
Ǧ Metabolic and Circulatory Responses,” It’s important that your movements
self to the unknown, to surprise situa- which E. Fox, D. McKenzie and K. Cohen are in the same range as the martial
tions that require you to endure sud- wrote for Medicine & Science in Sports arts technique’s movement pattern,

48 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


3 4

1 2

6 7

5 SAMBO GUN DISARM 2 Scott Sonnon adopts a ready position in front of


the gunman (1). When his offer to comply is rejected, he shifts to the left to get
RIIWKHOLQHRIÀUHDQGJUDEVWKHZHDSRQZLWKKLVOHIWKDQG(2). Sonnon rotates
KLVKLSVFRXQWHUFORFNZLVHWRGHOLYHUDQRYHUKDQGVWULNHWRWKHIDFH(3). (Note
WKDWWKHWHFKQLTXHZDVVHOHFWHGWRDYRLGSODFLQJWKHVWULNLQJDUPLQWKHSDWK
RIDEXOOHW +HUHSHDWVWKHVWULNHXQWLOWKHDWWDFNHU·VLQWHQWLRQZHDNHQV1H[W
6RQQRQUHDFKHVXQGHUWKHJXQVRKHFDQJULSWKHEDFNVWUDS(4)2QFHKH·V
HVWDEOLVKHGD´FUDGOHμSRVLWLRQKHGULYHVKLVOHIWHOERZRYHUWKHPDQ·VIRUHDUP
and drops his head (5)EHIRUHH[SORVLYHO\VWHSSLQJEDFNZDUGWRVWULSWKHÀUHDUP
out of his grasp (6)+HUDFNVWKHVOLGHWRFOHDUWKHZHDSRQWKHQXQOHDVKHVD
IRUHDUPVWULNHWRWKHVKRXOGHURUQHFNDQGSUHSDUHVWRÀUHLIQHHGEH(7).

joint position, speed and type of con- performance — consider the following: you can benefit from enhanced tacti-
traction without mimicking the mar- ƒ At 65 percent of your heart-rate max, cal fitness. The next step is creating
tial arts technique too closely. Mel C. 
% # 

 ϐ Ǧ

"  a program that meshes with your
 ǡǤǤǡ ϐ Supertrain- hand/eye coordination. art. Start by analyzing the fighting
ing when he writes that if you simu- ƒ At 85 percent, you begin to lose techniques you use most in the dojo,
late a skill under resistance, you’ll complex-motor skills, which can sab- then find or create drills and exer-
slow the speed and decrease the pow- otage the remainder of your martial cises that enhance those movements.
er of the skill when you’re calling on arts techniques. Make sure your solutions simulate
it for real. ƒ At 100 percent and higher, you lose the necessary range of motion and

  
   # #ϐ  gross-motor skills, such as the ability take place in positions that mimic
practice is the “extreme workout.” Ex- to walk and stand. A host of phenom- the self-defense scenarios for which
   

#  ϐ        
     ϐ   you’re training.
routine that leads to a heart rate that’s     
  
 ϐ    )  To get on the right path, refer to the
greater than the maximum you should in an ambush: tunnel vision, auditory two gun-defense sequences shown
push your heart to in training. (It’s exclusion, short-term memory loss, here and the exercises designed to en-
usually calculated in beats per minute fumbling, stuttering, shaking, freezing,     ϐ    
  

by subtracting your age from 220.) feinting, spontaneous bowel and blad-   "  
)   
  ϐ  Ǥ
When your heart exceeds its max, two der elimination, and so on. By following this lead, you’ll be able
negatives happen: You don’t adapt to (These data come from research con- to do the same for your go-to self-de-
the exercise because your body is no ducted on law-enforcement personnel fense techniques.
longer reacting physiologically; it’s who were in life-or-death situations,
reacting chemically. Even worse, you as described in Sharpening the War-
ABOUT THE AUTHOR: Scott Sonnon is
lose access to the skills you’ve trained rior’s Edge: The Psychology & Science of the founder of the TACFIT Academy, a tacti-
so hard to develop. Training, by Bruce K. Siddle.) FDOÀWQHVVDPEDVVDGRUIRU7DFWLFDODQG
In case you’re wondering why that’s DQDGMXQFWLQVWUXFWRUIRUWKH86)HGHUDO/DZ
something to be avoided at all costs — THE SOLUTION (QIRUFHPHQW 7UDLQLQJ &HQWHU 0HQ·V +HDOWK
QDPHGKLPRQHRIWKHWRSWUDLQHUVLQWKH
   % ϐ  
 # #    No matter which martial art you ZRUOG +H·V D ÀYHWLPH ZRUOG PDUWLDO DUWV
cross-training for enhanced martial arts practice, by now you likely agree that FKDPSLRQDQGÀYHWLPH86$1DWLRQDO6DPER
7HDPFRDFK7$&),7$FDGHP\FRP

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 49


PAUL VUNAK ON THE SCIENCE OF DESTRUCTIONS
STORY BY S.D. SEONG | PHOTOGRAPHY BY COREY SORENSEN

LOCATION: Las Vegas


EVENT: UFC 168
DATE: December 28, 2013
BOUT: Anderson Silva vs. Chris Weidman
ACTION: Silva throws a roundhouse kick, and Weidman reacts by
lifting his leg. Silva’s shin slams into Weidman’s knee, snapping the
NLFNHUȇVEXODDQGWLELD7KHH[FUXFLDWLQJLQMXU\OHDYHV6LOYDȇVORZHUOHJ
and foot looking like they’re disconnected from the rest of his body.

LOCATION: Hong Kong


EVENT: OPLQJRIIp Man 3
DATE: May 2015
BOUT: 'RQQLH<HQYV0LNH7\VRQ
ACTION: ΖQDVFHQHIURPWKHPRYLH7\VRQWKURZVDSXQFKWKDW
SXWVKLVVWLQFRQWDFWZLWK<HQȇVHOERZ'HVSLWHWKHIDFWWKDWLWȇVQRW
DUHDOJKW7\VRQVXHUVDIUDFWXUHGQJHU

“I’ve been talking about destructions for years,” says Paul Vu-
nak, one of the world’s best-known self-defense instructors.
“When MMA fans watched what happened to Anderson Silva,
they witnessed what I’ve seen happen probably 15 times in my
martial arts career. I always knew it was just a matter of time
before we saw that in the UFC.”
Here’s why: A conventional leg check is a technique that en-
tails simply picking up your leg as a defense against a round-
house kick, Vunak says. If the check is done properly, the kick-
er’s shin will smash into your shin. That not only stops the kick
% 
 ϐ  
 

Ǥ
A destruction takes it one step further. It positions your
checking leg so your knee is directly in the path of the kick.
“When you do that, 99 out of 100 times, the guy who kicked you
will be out of commission,” Vunak says. “Sometimes his leg will
break — as Silva found out.
“I knew that probability would guarantee that one of the
checks we see in MMA eventually would become a destruction.
I always thought that if anyone in the UFC took the time to learn
destructions, it would quickly convince his opponents never to
kick him again in a match.”

AUGUST/SEPTEMBER 2015 I BLACK BELT 51


Paul Vunak (left) faces his opponent (1). As soon as the man
unleashes his roundhouse kick, Vunak raises his right leg so his knee
is in the path of the leg (2). He immediately capitalizes on the opening
the pain provides (3) by hitting him with a straight blast (4-5).
(1)

Vunak knows of what he speaks. But if your leg is completely bent — so


“Back in the 1970s, I used to your heel is near your butt — it doesn’t
get my butt kicked at the hurt when someone’s shin crashes
Kali Academy because into it. You may have a bruise the next
I was a teenager spar- day, but that’s it.”
ring with guys in their It’s similar with the elbows, he says
30s,” he says. “Dan — which is what Tyson found out. If
Inosanto felt sorry for 
ϐ ?
  

 
me, so he taught me de- of your elbow in the path of a punch,
structions. A week later, you won’t feel much but you can bet
nobody wanted to kick or your opponent will.
(2) punch me anymore. They just “Think of yourself as a porcupine,
stood there. Then they all started us- with your elbows and knees like the
ing destructions, and nobody wanted tips of your quills,” Vunak says.
to kick or punch anybody in the whole
class. Finally, Dan said, ‘All right, you
jerks! No more destructions.’ When
SOURCE OF KNOWLEDGE
you’re going against somebody who “The Filipino martial arts — I’m
knows these techniques, you don’t talking about kali — is the only sys-
even want to throw a punch or kick tem that defangs the snake, which is
at them.” a synonym for using a destruction,”
Vunak says.
WEAPONS OF DESTRUCTION FMA is best-known for stick and
knife techniques, but the principles
(3) The human body carries four natural also apply to empty-hand destruc-
weapons that can be used for destruc- tions, Vunak says. “If you’re in a stick
tions: the elbows and the knees. “If ϐ#   
ǡ   
ǯ %
"
your opponent throws a roundhouse your attacks like they teach in other
kick, your goal is to make contact with arts. Instead, he’ll smash your hand
his shin using the tip of your knee,” Vu- with his stick. That’s not a block; it’s
" ǤDz  ϐ  ǡ a destruction.
was the most counterintuitive thing I’d Dz ǯ   "  ϐ#Ǥ  Ǧ
ever heard. I thought, Dear God, I’m go- pino martial arts teach that your only
ing to break my knee! chance is to cut your opponent’s knife
“I quickly learned that if you’re hand as it comes in. You can’t block be-
standing straight-legged and you get cause that will just give him another
hit in the knee, sure it’s going to hurt. opportunity to cut you.”
(4)

CALLING ALL KIDS


3DXO9XQDNLVVXFKDVWDXQFKEHOLHYHULQWKHEHQHWVRIPDUWLDODUWV
training for everyone that he encourages all the instructors in his
Progressive Fighting Systems organization to teach at least one physically
challenged child at no charge. Most of them discover how enriching the
experience is and go on to teach more than one, he says.
%HFDXVHLWFDQEHWRXJKWRQGLQWHUHVWHGNLGV9XQDNZRXOGOLNHWR
appeal to Black Belt readers who may know a child in need of the kind of
VHOIHVWHHPERRVWRQO\WKHPDUWLDODUWVFDQJLYH*RWRJKWLQJQHWWRJHW
in touch with a local PFS instructor.
(5)

52 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


The opponent (right) threatens Paul Vunak, who already has his
elbows held high for a possible destruction (1). When the man
punches, Vunak repositions his left elbow into the path of the punch
(2). As his adversary reacts to the pain (3), Vunak kicks him in the
groin (4)DQGQLVKHVZLWKDQHOERZWRWKHKHDG(5).

(1)

CHALLENGE OF DEPLOYMENT struction against a leg


technique would seem
Just how hard is it to take a small 
 %  
  ϐ Ǥ
object like a knee or an elbow and in-   ǡ 

Ǧ
sert it in the path of an incoming kick  %

" "ǡ
or punch in time to intercept the at- 
   
ǯ
tack? “Destructions are just like any know whether it will

  
 #  #  ϐ#ǡdzǦ %   # " "ǡ Ǧ
"  Ǥ Dz
 ?  ǡ  
 %
  )  " "
 
 " "ǡ

   %  
ǡ 
ǯ 
% % so how can you determine
 
  
 Ȅ ǯ where to set up your destruction?
 
 
 
   %Ǥ   ǯ
 Dz  
ǯ     ϐ#  
ǯ "

much difference between that and     
ǡ
 ) 
 (2)
putting your elbow up. The distance differentiate a high kick from a mid-
from your shoulder to your elbow  ) " "  
" "
%  % 

when doing a destruction and the  Ȅ ǯ
 
%Ǧ
distance from your shoulder to your ǡdz  "  Ǥ Dz  
  "  

hand when parrying a jab are roughly " " 
 #  ǯ    #
 ǡ
 
)    
  " "ǡ 
ǯ  #
 # 
 #  "
" 

different. whether you try a destruction or not.
Dz  %    
 
ǯ  )  
 Dz
    
 #   " "ǡ

)  
 %

 "      the skills you use to determine the
for it to be a destruction. Your elbows  #
 " "
ǯ  # Ǥ 
should be more or less in front of your does change is that when it comes in
  

    ǡ  Ǥ  ǡ 
ǡ  

 #   "ǡ

 
  " 

"" 
ǯ  ) # 
"  Ǥ 
  #ǡ

(3)
your stomach open the way Thai box- get about a destruction because you

ǡ%
 


 
 ǯ# 
"   Ǥ "
for your face. If your opponent aims   #
   Ǥdz
  %  

 ǡ  ϐ 
 
   
  ǡ  #    Ǧ
 #  ǡ       
 
 tion requires all the attributes you
%
  
 
)      Ǥ   
 ϐ# 
   
ǡ

 ) 

 )  ǡ
  " ǤDz

"  ǣ 


elbow and your nose in a straight    


"ǡ  #ǡ   #
 Ǥ   )  

ǡ ǯ   # and knowledge of spatial relation-
 Ǥdz ships that it takes to block a weapon
 "    Ǥ
 ) ǡ  #   Ǧ  
%  
 
Ǥdz

(4)
ACCIDENTAL DESTRUCTION OR INTENTIONAL TECHNIQUE?
ΖWȇVXQFOHDUZKHWKHUWKHQJHUIUDFWXUHVXHUHGE\ER[HU0LNH7\VRQDW
the hands of kung fu stylist Donnie Yen was an intentional destruction or
the result of accidental contact. “Either way, it’s a good reminder that if
you spar enough, you’re eventually going to run into an elbow or a knee,”
Paul Vunak says.
“But if you do it on purpose, you have incidents like the Anderson Silva
JKWȋKHDGGVȊ7KDWWHFKQLTXHZDVWDXJKWWRKLVRSSRQHQWE\D1HZ<RUN
trainer named Ray Longo. Ray is a full instructor under me. He’s been
WHDFKLQJGHVWUXFWLRQVIRU\HDUV7KDWWHFKQLTXHZDVWRWDOO\LQWHQWLRQDOȋ

(5)

BLACKBELTMAG.COM
Destructions are an implementation of the Filipino martial arts strategy
of defanging the snake, says Paul Vunak (left). To demonstrate, he and
his opponent take up training knives (1). The man attempts to cut,
prompting Vunak to attack his knife hand — in essence, defanging the
snake that’s attacking him (2). His technique ends the exchange and
WDNHVWKHZHDSRQKDQGRXWRIWKHJKW(3- 4).

(1) BETTER THAN BLOCKING incoming weapon? “The same thing as


when you try a block and miss,” Vunak
Why should you add new techniques says. “If you position your elbow for a
to your arsenal and devote training destruction and fail to stop the punch,
time to them when you already know  ϐ  
 

how to block? “When you block a your face. That’s no different than if
strike, you’re not accomplishing any- you attempted a block.
thing,” Vunak says. “You just give your “If you go for a leg check and your
opponent a chance to hit you again. timing is off, your opponent is going
However, if you use a destruction on to kick your leg. If you go for a low leg
a kick, you can make your opponent check and he kicks high, he’s going to
end up like Anderson Silva. If you use a kick you. That’s the nature of combat,
destruction on a punch, you can make and it’s the same when you use de-
your opponent end up like Mike Tyson. structions. They don’t have any magi-
“Some people think they can hurt cal properties.”
you with a hard block. That’s silly. It’s For that reason, it’s best to have a
(2) never worked in the his- backup plan, Vunak adds. For exam-
tory of the martial ple, if a punch is coming your way and
arts. But what you think the time is right to use a de-
has worked struction, it’s a good idea to move your
many times head out of the way at the same time.
is when a guy “When using destructions, you need
tries to kick the same footwork, the same agility,
you, you hit his the same head movement and so on,”
shin with your he says.
knee instead of “And by the way, you don’t do a de-
your shin and he struction on every blow,” he adds. “If
can’t continue. Or he 
ǯ     ϐ#    # 

throws a jab at you and a double jab, a cross and a kick, you
instead of parrying it, you make sure might use a couple of plain old blocks
ϐ 

 %
  against the jabs, parry the cross and
he can’t continue.” take the kick, maybe on accident. And
In a nutshell:
" #  ϐ# then he throws another punch and —
(3) not unlike erecting a shield around boom! — you destroy it.”
the targeted body part. Yes, it can stop At most, you should employ a de-
an attack, but to be fail-safe, it needs  
 #  

 )  ϐ) 
to be able to stop every subsequent at- techniques your opponent throws, Vu-
tack. In contrast, using a destruction nak says. “A destruction is not some-
 "  ϐ #   
     thing you can just use when you’re

 #  "Ǥ
 "  ϐ#
 getting out of your car and a bad guy
your enemy to eliminate his capacity runs up to you and throws a punch,”
to attack again. he says. “You have to set it up and have
“A block defends against a strike,” the timing and distancing right. That
Vunak says. “A destruction destroys will give you the best chance of suc-
the strike and the weapon.” cess.”

BACKUP PLAN Paul Vunak is a Southern California–


based instructor of jeet kune do and the
What happens if you try a destruc- Filipino martial arts. For more information,
(4) tion but don’t make contact with the YLVLWÀJKWLQJQHW

54 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


58 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM
Traditional training is often undertaken out-
doors in natural settings with minimal gear.
The main stances and techniques of bul mu do forms have
been depicted in temple paintings.
Life as a Temporary Martial Monk
South Korea created its Temple
Stay program to help visitors better
]VLMZ[\IVL*]LLPQ[U1\WЄMZ[
various kinds of practice sessions,
such as chanting, sitting mediation
and the tea ceremony. Participants
[\ZQ^M\WÅVL\PMQZ\Z]M[MTN_PQTM
PIZUWVQbQVO_Q\PVI\]ZM;QVKM
1992, a temple called Golgulsa has
hosted seon mu do training programs
NWZ\PW[M_PW_Q[P\WM`XMZQMVKM
Buddhism through one of Korea’s
*]LLPQ[\UIZ\QITIZ\[<PQ[Q[PW_I
typical day in the program unfolded:
4:00 a.m. Wake-up call
4:30 a.m. Chanting and
sutra reading
5:00 a.m. Meditation
"IU 2WOOQVOWZ_ITSQVO
6:50 a.m. Breakfast
8:30 a.m. Cleaning temple grounds
9:00 a.m. Martial arts training
11:00 a.m. Chanting
11:50 a.m. Lunch
2:00 p.m. Work
5:00 p.m. Break
5:30 p.m. Dinner
6:00 p.m. Chanting
7:00 p.m. Martial arts training
9:00 p.m. End of the day
9:30 p.m. Bed

Many of the activities have a deeper


meaning than their names indicate.
.WZM`IUXTMNWWLQ[MI\MVKWUU]VITTa
3VW_VI[JIT_WWSWVaIVOthe
XZIK\QKMITTW_[ILPMZMV\[\WZMÆMK\
WV\PMU[MT^M[IVLPW_\PMaPI^M
\PMXW\MV\QIT\WI_ISMV\WIX]ZM
life. It’s a form of active Seon (Zen in
Japanese) meditation that nurtures
the understanding of the need for
order, harmony and ultimately respect
_Q\PQV\PM\MUXTM<PI\QV\]ZVNW[\MZ[
a deeper sense of compassion for the )UWVS_PWPI[
XMWXTM_PW¼^MUILM\PMUMITXW[[QJTM ]VLMZ\ISMVI^W_
of silence treats
— Gregory C. Brundage and Gray Mills a form as moving
meditation.

FROM THE BLACK BELT ARCHIVES


Read “Temple Martial Arts Training: From the Shaolin Monastery to Modern Times,” the May 1998 story
WKDW5REHUW:<RXQJZURWHDERXWRQHRI.RUHD·V%XGGKLVWPDUWLDODUWVDWEODFNEHOWPDJFRP

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 61


ART OF THE
World War II saw Thailand’s military
field marshal ban it outright. His goal
was to impose Thai culture on the
region, and his “solution” involved
prohibiting residents from wearing
Malay sarongs, speaking the local
language and fabricating kris.

KRIS
The citizens of Yala were upset
because they regarded the kris as part
of their culture. Their love of the blade
stemmed from their first exposure
to it some 300 years ago when the
then-governor invited a renowned
Indonesian bladesmith named Toe
Panaesarah to craft a special kris
SOUTHERN THAILAND’S for his village. In those days, it was
TRADITION OF KNIFE MAKING customary for high-ranked officials
AND KNIFE FIGHTING to wear an ornate kris at ceremonies
STORY AND PHOTOGRAPHY BY VINCENT GIORDANO and functions — as a symbol of power.
They would often offer a kris as a token
of friendship when a dignitary would
visit and when an ordinary citizen did
a good deed for the community.
Once that special kris was received
by the governor, it grew in reputation
and was eventually dubbed the
Kris Panaesarah. Its maker went on
to teach the locals how to fashion
different styles of the weapon. What
made his method stand out was his
mastery of pattern welding, known
as pamor. Considered the genesis of
the blade’s spirit, pattern welding

IN
entails combining various metals in
Yala province, 500 miles south many forms of silat — which the Thais layers, then applying heat to bond
of Bangkok, lies a village that’s call sila — that grew from the martial them and using acid to highlight
renowned for preserving the traditions of Malaysia and Indonesia, the boundaries between the layers.
ancient art of kris making. but few foreigners have heard of them. The master’s knowledge of pattern
The kris (also spelled keris or krit) One needs to travel all the way to welding and blade craftsmanship
is a distinctively shaped dagger the southernmost tip of Thailand to was so extensive it was recorded in
that’s both a weapon and a spiritual find the cradle of the kris. Yala and its The Panaesarah Book of the Kris.
object with numerous myths and neighboring provinces have long held
superstitions attached to it. a Muslim majority with close to 70 THAI TRANSFORMATION
The origins of the kris aren’t clear, but percent of the population being Malay- One hundred years later, the
we do know that the modern version speaking Muslims and the remainder heads of the Thai village organized a
of the weapon has existed since the Thai and Thai-Chinese Buddhists. In competition designed to find the finest
mid-14 th century. It likely originated in the past decade, this region has lived kris in the southern provinces. Among
East Java, where it was derived from under a blanket of fear because of an the tests the candidates were subjected
an older style of blade, possibly one anti-government insurgency that’s to was shattering a thick earthenware
of Hindu origin. The kris eventually claimed the lives of more than 4,000 jar filled with water. Only the knives
spread from Java to other parts of the people of both religions. of Bun Dai Sara’s clan passed the test,
Indonesian archipelago and then to the As of yet, no military official or earning the family the respect and
Southeast Asian regions now known as insurgent leader has tried to prevent admiration of the entire region.
Malaysia, Brunei, Philippines, Thailand the people of Yala from making kris Sara’s popularity and stature in the
and Singapore. knives even though production is community rose as a result, and the
technically illegal. Perhaps it’s because governor of the province selected him
MARTIAL ARTS MECCA the code of conduct adhered to by to craft his personal kris. The master
Thailand has fostered the the craftsmen keeps the blades from also was tasked with training a new
development of an array of arts, but falling into the hands of those who generation of artisans who could not
unfortunately it’s only the indigenous would use them for illicit purposes. only make the weapons but also wield
ones that attract attention from The tradition of kris making was them in combat.
scholars. For example, the region boasts nearly lost for a generation when A modern descendant of this lineage

62 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


Teeparee Atabu poses
with a kris and its sheath.
is Teeparee Atabu. This former farmer he first must pick the appropriate
began studying the art of the kris under time to begin. This is because the SIT-REP
Tuan Bukut Long Saree and remained kris and each component that goes Thanks to Teeparee Atabu, the
with him until he died in 2004. into it are imbued with symbolism. art of the kris, once a closely
While Atabu maintains a deep The next step is to determine the guarded secret, is now taught via
respect for tradition and follows the desired blade shape, either straight vocational courses held at cultural
rules of conduct to which his ancestors or curved. The straight blade is the centers in southern Thailand.
adhered, he embraces a more open older design and the more common His wish is to give anyone who
attitude designed to ensure this one, while the curved blade is more wants to devote his or her life to
martial treasure will survive. That’s iconic. Mythologically speaking, the learning this traditional part of his
why he agreed to share with me — straight blade symbolizes a serpent culture, regardless of that person’s
and, indirectly, with Black Belt readers in meditation and the wavy blade a religious or ethnic background, an
— the details of his art. serpent in motion, Atabu explained. opportunity to do so. The kris, when
When Atabu is about to create a kris, The other components of the kris viewed as a symbol of spiritual
strength, can bring people together,
he believes. By spreading this
notion, he hopes to sow the seeds
of unity in a world that’s plagued by
sectarian violence.

SILAT IN ITS
HISTORICAL
CONTEXT
6ULVM[OLÄYZ[Black Belt features
to investigate the art of silat
appeared in the June 1965 issue.
Now you can download that
article in its entirety. Just visit
blackbeltmag.com/free-guides/ and
look for the one labeled “Pencak
Silat: Techniques and History of the
Indonesian Martial Arts.”

64 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


are the hilt and sheath. ram kris, the dances that hold the
The most important hilt key to unlocking the complicated
to originate from the patterns of movement and strategy.
Yala region is the tajong. This enables them to assimilate not
Regarded as one of the only the techniques of the kris but
most powerful versions, also the intricacies of the culture.
it’s often seen on warrior In the past, the ram kris was
weapons. The tajong performed at important social
evolved from an early gatherings. The display of the
Shiva-influenced design practitioners’ skill at dance, as well as
to one that resembles their ability with the blade, served to
a bird (said to be the entertain and attract new students. In
kingfisher), betraying modern times, the ram kris is viewed
its Hindu and Majapahit mostly as a component of the martial
influences. The goal of the craftsman, art — although it still can be seen at
Atabu said, is to ensure that the hilt FIGHTING FUNCTIONALITY special community events.
is beautiful as well as functional — The term “kris” is believed to come That exposure helps ensure that the
which is why the carved head must fit from an old Javanese word that means kris will remain an important part
snugly in the palm of the hand much “to stab” or “to pierce.” That etymology of life in Thailand’s Yala province,
like the grip of a pistol. reveals much about the way the kris is providing residents with an invaluable
In the Bun Dai Sara lineage, the used in combat — primarily as a close- link to their past. The fact that the knife
sheath of the kris is large and range thrusting weapon. The sinuous lineage and the art that accompanies it
sturdy. That’s because the fighting nature of the blade enables it to do have taken hold in neighboring Pattani,
system includes techniques for maximum damage to soft tissue while Narathiwat and Songkhla provinces
simultaneously using both sheath and permitting the user to easily remove it serves as reassurance to the martial
blade in battle. The sheath has a long, from an enemy’s body. The techniques arts world that this treasure won’t be
rounded body and is often covered for doing this are practiced with a lost any time soon.
with silver or gold. It can have a live blade because it’s believed this
sapay, a “sheath wing” crosspiece teaches not only proper mechanics but
with upward-curving ends. also respect for the weapon. ABOUT THE AUTHOR: Vincent
Giordano is a New York–based martial
On average, it takes a month to craft Atabu guides his students through a artist, researcher and documentary
a kris, Atabu said. Two weeks are carefully constructed course of study ÀOPPDNHU)RULQIRUPDWLRQDERXWKLV'9'
devoted to the hilt, one week to the that lasts two years. They begin with WLWOHG9LOODJHRIWKH.HULV7KH$UWRI%XQ
'DL6DUDYLVLWWKDLNHULVFRP
sheath and one week to the blade. isolated footwork patterns and the

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 65


Bu tt as a M arin e
Fe m al e Airm an Kicks
ogram Instructor!
Corps M ar tial Ar ts Pr

sickening sound of a bone Note Field’s use of the word


breaking was the first “practical.” Because she was an
indication her elbow had snapped. Air Force intelligence analyst
“It was just an armbar,” she said. “I facing imminent deployment
thought I could get out of it.” on a top-secret mission in
Didn’t it hurt? the Third World, she had big-
“Not really,” she said, flashing a time safety concerns.
big Hilary Swank smile. “I’m double- “I wanted to learn a martial
jointed, so I don’t have the same pain- art that could get me out of a more of a range tailored to
receptor feedback as most people. jam, if needed, and my friends outside-the-box situations.”
But then it popped, and I said, ‘Oops!’” recommended the Marine MCMAP specializes in
It was just another day at the office, Corps Martial Arts Program,” outside-the-box thinking —
it would seem. In this case, however, she said. which is evidenced, in part, by
the office was a sweat-soaked gym, Unlike the Marines, which dumped its emphasis on using weapons
and the laborer was the first Air its LINE system in 2002 and replaced of opportunity. “It’s driven by
Force female to become certified as it with MCMAP, and the Army, the philosophy of ‘one mind, any
a Marine Corps Martial Arts Program which launched its Modern Army weapon,’” said Black Belt Hall of
instructor. Combatives Program in 2007, the Air Famer Leon D. Wright, a certified
Meet Staff Sgt. Jessica Field. Force didn’t have a widely available MCMAP subject-matter expert and
self-defense program in 2010, when the former head instructor at the
Field was searching for instruction. MCMAP (Far East) School.
That forced her to look elsewhere, but That philosophy appealed to
“I had dabbled in martial arts she concluded that the other fighting Field’s practical side. Gunnery Sgt.
for years,” Field said. “In college, I systems to which she had access Wilson Dunn, a MCMAP black belt,
practiced aikido and Brazilian jiu- lacked the practicality she needed. described it in a similarly practical
jitsu, but I was looking for something “I explored other options but liked way: “You search your surroundings
practical.” MCMAP the best,” she said. “It has for anything you can use as a weapon

66 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


Leon D. Wright got started in the
Asian ways of combat in 1969, whe
n he
[VVROPZÄYZ[shotokan lesson. Ove
r the
ensuing decades, his passion for
against the enemy. [For example], I “indoctrination to violence.” The the arts
never wavered. In 1982 he enlisted
could use this computer monitor to goal is to enable fighting men and in the
Marines and stayed until 2003, whe
bludgeon you.” women to come out on top in a one- n he
retired as a gunnery sergeant.
His statement was blunt, but it on-one — or one-on-two — battle
In 2001 Wright helped launch the
revealed an essential component for life, Dunn said.
Marine Corps Martial Arts Program
of MCMAP — it teaches students Field admitted that MCMAP (Far
East) School in Okinawa and serv
how to apply violence to achieve training pushed her out of her ed as
its chief instructor. In 2003 he was
an objective in a clinical way, comfort zone again and again. As named
a MCMAP subject-matter expert.
“detaching emotions like fear, intimidating as that might sound, The
same year, he retired from the Corp
hesitation — things that get Marines she insisted the program is safe and s but
was allowed to remain in Afghanis
killed,” Dunn added. the instructors are encouraging tan to
Field summed it up: “I liked the and patient with new practitioners. continue teaching Marines.
realism.” They welcome students from all >YPNO[SH[LYYLJLP]LKHJLY[PÄJH[LVM

military branches who are brave appreciation from Col. George Brist
ol,
enough to hit the mats, she said. founder of MCMAP, on behalf of
Brig.
As for her broken elbow Gen. Larry Nicholson, commending
In MCMAP, instructors have — “That’s not uncommon,” him for having volunteered his time
to
Marines sparring from day one, Dunn said, “because these are train personnel at Camp Leathern
eck in
referring to this approach as combatives, and there are risks Afghanistan.
— Editors
BLACKBELTMAG.COM
involved” — Field admitted it
was her fault for not tapping.
Although the injury occurred
in January 2015, her limb has
healed completely and shows
no indications of having been
damaged. Examining the arm, all
anyone can see now is a honed
musculature, a visual testament
to Field’s conditioning.
“I weighed 175 pounds before I
joined the Air Force,” Field said.
“That’s why I’m so committed
to fitness.” MCMAP was
the driving force behind
her transformation, and it
continues to be a pillar of her
healthy lifestyle. In addition to
her martial arts training, the plucky
NCO lifts weights, does calisthenics
and runs with her husband, a
former Marine who also trained
in MCMAP. But —
“We don’t spar,” Field said.
“For the sake of our marriage.”

MCMAP sprouted from roots that


date back to the earliest days of the
Corps, when Marines in boarding
parties had to rely on hand-to-
hand fighting techniques. The
ensuing decades saw the system


evolve considerably with help from
numerous martial arts experts.
The modern incarnation of the
Marine Corps Martial Arts Program
also incorporates techniques designed
to injure or incapacitate, not just to kill.
That’s a fairly recent response to calls
for the U.S. military to use nonlethal
force in certain situations. Case in
point: Marines often find themselves
involved in police actions, crowd and
riot control, and other situations that
require them to interact with civilian
aggressors.
Obviously, such assignments demand
versatility with respect to technique,
as well as practitioners who can make
decisions on the fly. The decision-
making ability comes from the training,
while the techniques come from a
variety of martial arts, including those
from the East (aikido, karate and so on)


and those from the West (boxing).
Field is a fan of that diversity. She
believes that everyone who studies
self-defense should know how to
throw a jab, but she said her favorite

BLACKBELTMAG.COM
part of the combative arts is ground to spread expertise and get other
fighting. “I like jiu-jitsu,” she said. instructors certified — to get it to
“I’m small, and it helps me fight the Air Force or anyone interested,”
bigger, stronger guys.” she said.
Bolstered by her training, the staff Because she earned her instructor
sergeant seems much taller than her tab, she’s certified to teach the art to
5 feet 4 inches. “That’s the confidence members of all the armed services, To download “MACE
you get from MCMAP,” she said. “It so she’s in a prime position to preach (USMC): How the Martial
carries over into every part of your the gospel of MCMAP. Arts Center of Excellence
life. You carry yourself differently Produces Fierce H2HC
when you walk into a room.” Fighters Through MCMAP,”
go to blackbeltmag.com
What do Marines think and click on “free guides”
about the first female airman in the navigation bar.
Like most modern fighting systems, to become certified to teach their
the Marine Corps Martial Arts art?
Program uses belts to denote rank. “It’s impressive,” Dunn said. “It’s
Specifically, it features the Marine- good to see airmen appreciate the
friendly colors tan, gray, green, value of training. I commend anybody recently rolled at Fort Meade,
brown and black, Dunn said. who does that. We all take the same Maryland, where they took
Field holds a green belt with an oath to preserve and protect the turns submitting each other. Field
instructor tab, which she earned Constitution.” found herself tapping when her elbow
during a grueling course held at the Wright said he admires Field’s clicked painfully during a submission
Martial Arts Center of Excellence in accomplishments, which offer attempt from the Marine, and Sawyer
Quantico, Virginia. For reference, tangible proof of the validity of had to fight off several chokes initiated
green belt is the level expected of MCMAP. “It works for all who decide by Field. The Marine fought valiantly
Marine Corps infantry troops. She to be part of it,” he added. “Going against one such choke but finally
said she hopes to test for her brown through the training process is the tapped as her face turned purple.
belt by the end of 2015 and has same for everyone — there’s no Both Field and Dunn said the
petitioned the Air Force to allow her special treatment. The training has pain they experience in the gym —
to wear her rank with her camouflage been proven for both men and women including those occasions when an
uniform like the Marines do. in combat, not only physically old injury gets tweaked and the blood
One of the goals of Field’s training but also mentally.” supply to the brain gets momentarily
is to convey to others the notion Marine 2nd Lt. Aleksandra halted — is worth it. The reason is
that combat skills learned from Sawyer, who owns a MCMAP simple: That kind of “hard Corps”
MCMAP can benefit any service gray belt, said she training ultimately increases the
member who’s interested in thinks Field is odds that they’ll survive on the
self-development. “I’d like awesome. The two battlefield.

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 69


YOUR WORKOUT’S PERFECT

SIDE
KICK
SUPPORT PERFORMANCE AND RECOVERY
WITH TRUE ATHLETE—A WIDE RANGE OF
SPORTS NUTRITION PRODUCTS, INCLUDING
HORMONE-FREE NATURAL WHEY PROTEIN.
CONTAINS NO ARTIFICIAL FLAVORS, COLORS
OR SWEETENERS.

Available at
#iamatrueathlete
ESSENTIAL
GEAR
&(1785<0$57,$/$576·
VERSYS VS.BOB
0[»Z[OLÄYZ[MYLLZ[HUKPUNIHNVU[OLTHYRL[[VV
LYHSS[OL
ILULÄ[ZVM[OL*LU[\Y`=:^P[O[OLHKKLKMLH[\YLVMH
)6)SPRL[VYZV^P[OHYTZ;OPZ\UPX\LJVTIPUH[PVUHSSV^Z
H[OSL[LZ[VL_WLYPLUJL[OLTVZ[YLHSPZ[PJ[YHPUPUNV\[ZPKLVM
SP]LZWHYYPUN
(SEE WEBSITE FOR PRICING)
CENTURYMARTIALARTS.COM

2720,;·625,*,1$//,7( REEBOK’S ALL TERRAIN THUNDER SHOE


MARTIAL ARTS SHOE ;OPZUL^[YHPSY\UULYMYVT9LLIVRPZKLZPNULK[VKLSP]LY
;OPZZSPWVUZOVLOHZILLUHILZ[ZLSSLYMVY6[VTP_MVYTVYL J\ZOPVUHUKJVTMVY[V
YVHK·^OPJOTHRLZP[WLYMLJ[
[OHU`LHYZHUKUV^P[»ZUL^HUKPTWYV]LK;OLSPNO[^LPNO[ MVYTHY[PHSHY[PZ[Z^OVJYVZZ[YHPU;OLV\[ZVSLMLH[\YLZ
HUKÅL_PISL:[PUNYH`ZVSL^YHWZ`V\YMVV[MVYLUOHUJLK HNNYLZZP]LS\NZMVYVW[PTHS[YHJ[PVU[OLTPKZVSLOHZKYHPU
IHSHUJL^P[OV\[HK]LYZLS`H
LJ[PUN`V\YRPJRPUNWV^LYVY`V\Y OVSLZMVYJSVZLLUJV\U[LYZ^P[OW\KKSLZHUK[OL\WWLYPZ
HIPSP[`[VMLLS[OLÅVVY9LJVTTLUKLKMVY[YHKP[PVUHSTHY[PHS THKLVMTLZO^OPJOTLHUZ]LU[PSH[PVUPZHNP]LU
HY[Z44(HUK`VNH $125
$69 REEBOK.COM
OTOMIX.COM

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 71


/((0255,621·6
COMBATIVES COURSES
In conjunction with Paladin Press, self-defense authority
Lee Morrison has released a 215-minute DVD set titled
Primal Combatives and a 187-page text titled The Complete
Book of Urban Combatives.;OL`V
LYTHY[PHSHY[PZ[ZH
chance to learn Morrison’s hard-core approach to stopping
thugs and criminals.
$70 AND $25, RESPECTIVELY ($80 FOR BOTH)
PALADIN-PRESS.COM

DON WILSON AND CYNTHIA ROTHROCK’S TRADITIONZ


These two greats of the martial arts world have joined forces to launch
Dragon Traditionz. The company markets a product line composed
of active wear for martial artists and anyone else who appreciates
shirts and hoodies with great graphics, great materials and great
construction.
$24-$35 EACH
TRADITIONZ.US

:+,67/(.,&.·6
MARTIAL ARTS PODCAST
Whistlekick Martial Arts Radio is a weekly podcast (think
syndicated radio show) on which traditional martial artists tell the
inspiring stories that only martial artists can tell. Listen on your
computer, or download to your smartphone or iPod to enjoy the
interviews on the go.
(FREE ON ITUNES OR STITCHER)
WHISTLEKICKMARTIALARTSRADIO.COM

%$65877(1·6
INSPIRATORY MUSCLE TRAINER
This training device is designed to restrict your air intake while
training or during breathing exercises with the goal of strengthening
your lungs and diaphragm. It comes with a nose clip to force you to
breathe through your mouth and 15 air-intake caps, each of which
ZWVY[ZHKP
LYLU[ZPaLHWLY[\YL
$50
AMAZON.COM
72 BLACK BELT I AUGUST/SEPTEMBER 2015
ACTIONFLEX’S KURO-OBI SERIES
Kuro-Obi, meaning “black belt,” is the latest series of
THY[PHSHY[Z[YHPUPUNKL]PJLZMYVT(J[PVU-SL_;OL`V
LYH
strengthened core, thicker piston diameter and more rigid
feel for realistic training. Designed for the advanced martial
artist, the series includes a sword, escrima stick, nunchaku,
shoto knifeHUKZ[H

$39-$70 EACH
CENTURYMARTIALARTS.COM

BLACK BELT FRAGRANCES


These high-quality, perfume-grade fragrances are perfect for women
and men. Customization options make them suitable for fundraising
campaigns for martial arts schools and events. Inquire about distribution
opportunities and discounts for bulk orders.
(CONTACT FOR PRICING)
BLACKBELTFRAGRANCES.COM
COMPANY SPOTLIGHT

High-Quality Asian and European Weapons


at Reasonable Prices by Floyd Burk

A
dmit it — you love swords. are enthusiasts who are drawn to ninja a quality sword can last for many years.”
In fact, there’s a good chance weapons, sword canes and knives.  7    ǡ  ϐ  Ǧ
you own one. If you don’t, you Why is interest in swords and re- tions martial artists in the market for
probably want one. Bad. lated tools and implements spreading a sword not to go overboard. If all you
Word to the wise: Don’t try to satisfy so rapidly within the martial arts com- want is a functional blade for cutting
your craving for a long blade by buying  ǫ Dz ǯ  
ǡdz   ϐ  and training, you don’t need to take out
a cheapo. You’ll quit using it after you said. “People are practicing [with a second mortgage on your house. The
 "  
 ϐ    #Ǥ ǯ   weapons] earlier in their martial arts middle of the price continuum is where
better to buy a sword that’s worth own- career. This just naturally increases you want to be, he said. “[Our swords]
ing — such as the ones distributed by the swording pool.” look as nice and cut just as well as some
Mantis Swords. of the more expensive swords sold
ONE OF THE KEYS to successful around the country.”
“THE COMPANY started in 1997 with swordsmanship is having a qual- If, on the other hand, you’re looking
myself and two friends,” said Shawn %  
  ǡ  ϐ  Ǥ
 for an objet d’art, you’ll need to take
  ϐ ǡ

   
ǯ
Ǧ want a real weapon, not a fake one. A extra precautions. If you’re consider-
owners. “We had a martial arts class fake sword that you pick up at a strip ing buying a sword that’s advertised as
together, and we did not want to spend mall is like a kit car. On the outside, it an antique or an “investment,” have it
several thousand dollars on a sword. may look like a Lamborghini, but un- appraised by a professional before you
Consequently, we started the company derneath, it’s just a dune buggy chassis
ǡ  ϐ  ǤDz     


just to order swords for ourselves. Lat- and motor. When subjected to hard use, fakes out there.”
er, we started ordering for other prac- a subpar sword — just like a kit car —
titioners in the class, and the company will begin falling apart. I should know; FOR ALL OTHER potential sword buy-
was born.” I’ve made the mistake of buying a few ers, Mantis aims to simplify the selec-
From those humble beginnings, Man- over the years. tion and purchase procedures. “Our
tis (mantisswords.com) grew into one Those sword shortcomings stemmed mission is to be the best provider of
of the largest online sword stores on just from doing basic technique drills. high-quality Asian and European weap-
Earth. It now ships product to more Forget about trying tameshigiri (test- ons at reasonable prices with the very
than 48 countries and military bases cutting) — unless you want to take %  
  ) ǡdz  ϐ  Ǥ
around the world. your life into your own hands. He and the other Mantis owners
Photo Courtesy of Mantis Swords

The Mantis inventory runs the gamut Mantis strives to make sure such ca- have decades of training under their
of Asian weaponry. It includes items for tastrophes don’t befall its customers. belts, and they continue to learn. In
all the traditional Japanese blade arts, “We have used and have cut with every addition to being their passion, bladed
as well as Chinese- and European-style sword we offer, unlike other companies,” weapons are their business, and they
swords. Those who prefer more exotic   ϐ  ǤDz 
ǡ   

Ǧ ϐ#      
    "
ǡ  
offerings like Viking throwing axes and en Oriole model and have been cutting easier it is to select only the best prod-
Lion Heart swords are also in luck, as with it since 1998. When taken care of, ucts for their customers.

74 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


BLACK BELT PAGES

76 BLACK BELT AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


BLACK BELT PAGES

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 77


41st World Health Fitness Wellness & Martial Arts Expo

Event Workshops Include:


BLACK BELT PAGES

• MARTIAL ARTS
• HEALTHY LIVING
• PHYSICAL FITNESS
• WELLNESS

Stroll through the Dragon Festival Exhibit Hall


• Meet Hollywood Stars!
• Physical Fitness Experts!
• Some of the best Martial Artists of many
styles including Tai Chi and Qigong!
• Browse booths of Health Fitness Wellness
and Martial Arts!

HILTON ORLANDO
6001 Destination Parkway
Orlando, Florida
March 19, 2016
9:00 a.m. to 6:00 p.m.

Enjoy Orlando Florida! (Visit Disney, Universal,


Lego Land, Sea World and much, much more!)

www.StarsForCharityExpo.com
SPONSORS INCLUDE:

The 2016 Stars for Charity


Expo Supports the Wounded
Warrior Project

The only traditional martial arts


system dedicated to Wicked Strong
TheCane
Easy Carry
to Learn Anywhere

GRANDMASTER Black Belt


MARK Magazine
SHUEY Hall of Famer

The World’s Finest


Handcrafted Combat Canes

Design your own Custom Cane


using American Hardwoods.
Custom Engraving Available The gold standard of grippers
Name, Initials, Logo, etc.
11 strengths for all belt levels
Instructional Videos • Free Catalog
Custom Hardwood Canes made in USA IronMind®
800-422-2263 www.ironmind.com

www.canemasters.com Made in the USA.

78 BLACK BELT AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


BLACK BELT PAGES
FOR SALE
Used Books and DVDs,
many rare; new books
and DVDs by 45 year
martial arts practitioner,
including aikijutsu to
3rd degree and
White Dragon kung fu
to 1st degree.
Send $10 for catalogue to:
Stan Wilson
2032 Judson
Manhattan, KS 66502
785-313-5488
sites.google.com/site/weaponsshop

BLACKBELTMAG.COM AUGUST/SEPTEMBER 2015 I BLACK BELT 79


9,6,2135(66),/06 ———REVISITED AND EXPANDED———
,6%$&. FOR THE FIRST TIME IN MORE THAN 30 YEARS!

TAO JEET KUNE DO


OF
BLACK BELT PAGES

&KLQHVH7DRLVW6RUFHU\
7DRLVW6H[6HFUHWV NEW EXPANDED EDITION KAPAP
&KLQHVH0LOLWDU\3URSKHFLHV BRUCE LEE
COMBAT CONCEPTS
By Avi Nardia and Albert Timen / Special Adviser: John Machado
ORDER YOURS
&KL)D7DL&KL3D.XD TODAY! Upgrade your toolbox
of personal combat skills
with Israel’s original fighting art!
+VLQJ,DQGPRUH

YLVLRQSUHVVILOPVFRP

United Alliance of Shoto


Karate-do & Judo
of California
Member of the USA Karate and Judo,
IMAF & AAU Federations, and JKA. BRUCE LEE’S MOST
Robenson
INFLUENTIAL BOOK!
“[Avi Nardia and Albert Timen’s] unique
Dorvil Explore the philosophy behind Bruce style, eclectic approach and contem-
World Karate Lee’s martial art with digitally enhanced porary insight [have made kapap] a
Champion illustrations by Bruce Lee, never-before- truly valuable fighting art.”
5th degree Karate-Do, seen Chinese translations, and editorial Patrick McCarthy
2nd degree Judo & Eighth-Degree Black Belt
Taekwondo, and 1st commentaries by many of Bruce Lee’s
degree Kobudo closest friends and colleagues, including: Authors Avi Nardia and Albert Timen have

Schedule: M/W/F/S/S: 4-7pm sChris Kent codified and taught this legendary system
to civilians, martial artists, law-enforce-
Location: 7415 Crenshaw blvd, sJerry Poteet ment officers and military personnel around
LA,CA90043 sDiana Lee Inosanto the world—and now YOU can incorporate
818-425-6071 / 323-454-0712.
uaskw@aol.com/www.uaskw.webs.com sTim Tackett kapap’s versatility and adaptability into your
own self-defense training!
sRichard Bustillo
sYori Nakamura This full-color book includes:
TRAINING FOR COMPETITION: Thirty-seven years after its initial • 350+ photos of combat protocols
by David Meyer Brazilian Jiu-Jitsu • original kapap fighting theories
publication, Tao of Jeet Kune Do continues
and Submission Grappling • grappling techniques with special Brazilian
to provide the rare opportunity to learn jiu-jitsu adviser John Machado
Brazilian jiu-jitsu champion directly from Bruce Lee—one of the most • position and movement principles for
and world champion coach
David Meyer shares his knowl-
celebrated and inspirational figures in real-life conflict applications
edge of competition-winning martial arts history. • training techniques for multiple defensive
strategies in Training for responses
Competition: Brazilian Jiu-Jitsu
• reality-based combat-conditioning exercises
and Submission Grappling. “Jeet Kune Do is the enlightenment.
Drawing upon his 20-plus • fundamental knife drills
years of teaching, grappling It is a way of life, a movement toward
• striking tactics
and competition experience, willpower and control.”
Meyer helps novice and vet- • pressure points
eran grapplers alike enhance
–Bruce Lee
… AND MUCH MORE!
learn to take calculated risks, develop a game plan, use the Pages: 248tCode: 524tRetail: $26.95
points to their advantage, find a great coach, reduce stress ISBN-13: 978-0-89750-161-3
and much more. With detailed photo sequences and added ISBN: 978-0-89750-202-3 120 Full-Color Pages
insights from grappling authorities like Bas Rutten, Cesar Size 8-3/8" x 10-7/8"
Gracie, Gene LeBell and Wally Jay, Training for Competition Book Code 490—Retail $24.95
gives fighters their best chance at attaining victory! To order, call toll-free: (800) 581-5222
191 pgs. (ISBN-13: 978-0-89750-167-5) or visit blackbeltmag.com/TAO To order, call (800) 581-5222 or
Book Code 495—Retail $24.95
visit www.blackbeltmag.com/shop
To order, call (800) 581-5222 or visit
blackbeltmag.com/shop

80 BLACK BELT AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


Sparring Headgear

SALE!!! COLORS: red, black SIZES: S-M-L-XL #981 - $30.00


Sparring Gloves
Get the complete set of COLORS: red, black SIZES: Child Medium,
Child Large, S-M-L-XL #982 - $30.00
Sparring Gear! Head, Hands, Sparring Boots
COLORS: red, black SIZES: Child x-small, Child Medium,
Feet, and Mouthpiece: Child Large, S-M-L-XL-XXL #983 - $30.00

Special $39.88 Single Mouth Guard


COLORS: clear, red, black SIZES: children, adult
#980 - $1.88
From
the
A rchives
Vol. 16, No. 1, $1.50
The 169th issue of Black Belt was
dated January 1978. The expanded
edition was 100 pages long and
featured taekwondo stylist Pu Gill
Gwon on the cover.

• The higher page count is intended to give the editors room to • “I tore this guy up — ate him like an alligator,” says Don G.
announce the 1977 Black Belt Hall of Fame inductees: Man of the Trent, a kendo-obsessed U.S. Air Force chief master sergeant
Year — Chuck Norris, Karate Player of the Year — Bill Wallace, stationed in Japan. “I know for sure this guy was a better kendo
-XGR3OD\HURIWKH<HDU³$OOHQ&RDJH ZKR·VDOVRUDQNHGWKH SOD\HUEXW,GLGQ·WJLYHKLPDFKDQFHWRÀQGWKLVRXW7RWKLV
No. 1 male judoka in the United States), Judo Instructor of the GD\KHVWLOOGRHVQ·WNQRZKHZDVDEHWWHUSOD\HUWHFKQLFDOO\
Year — Hayward Nishioka, Karate Instructor of the Year — Glenn VSHDNLQJWKDQ,ZDVμ1RVKRUWDJHRIVHOIFRQÀGHQFHWKHUH
Keeney, Kung Fu Artist of the Year — Al Dacascos, and Special •6RPHWKLQJ\RXGLGQ·WNQRZDERXW'DQ,QRVDQWR´)RUWZR
Recognition — Dan Inosanto. years, I trained simultaneously under both Ed Parker and Bruce
• Chuck Norris elects not to join the roster of actors who will be Lee,” Inosanto says. “And on Saturdays, I taught part of the day
added to the cast of Game of Death as the producers labor to for Ed and part of the day for Bruce.”
ÀQLVKWKHÀOP •´:KHQ\RX·UHSUDFWLFLQJchi sao, you are already developing
• Bill Wallace speaks out in defense of his friend, the late Elvis what is necessary for your kicking techniques by practicing your
Presley. Seems a photo of Presley kicking Wallace in the gut was moving stance,” says wing chun stylist Augustine Fong. “Chi
published, along with words that accused “the King” of abusing a VDRLVWKHRQHH[HUFLVHWKDWGHYHORSVZKDW·VXVHIXOIRUNLFNVE\
“hapless sparring partner.” Not true, Wallace says. letting you practice with your hands.”
• “People who have never tried to break a glass bottle think it is so •'RQQLH:LOOLDPVEHFRPHVJUDQGFKDPSLRQDW(G3DUNHU·V
hard,” Pu Gill Gwon says. “Actually, it is one of the easier materials to 14th Annual International Karate Championships. He registers
break. The only important factor in achieving the technique is speed.” during the event, right after a judging controversy erupts
• The No. 10–ranked karateka in Japan is kyokushin stylist Joko between Williams and Sam Shockley. Williams goes on to
Ninomiya. He will later relocate to the United states and found GHIHDW6KRFNOH\DQGÀYHRWKHURSSRQHQWVIRUWKHWLWOH
enshin karate and the Sabaki Challenge. • Black Belt names the top male karateka in the United States:
•´,GRQ·WWKLQNkyudo is all satori,DQGLW·VQRWDOOKLWWLQJWKHWDUJHWμ Dan Anderson, James Cook, Steve Fisher, Steve Mackey, Ray
says Bill Buntin, instructor of Japanese archery. “Kyudo is life.” McCallum, Sam Shockley, Ernie Smith, Ray Sua, Bobby Tucker
• In an ad for its popular kicking jeans, Century Martial Arts gets and Keith Vitali. Hmm … seems like Donnie Williams ought to
SURYRFDWLYH´7KHVHFUHW",W·VLQWKHFURWFKμ7KHFRS\LVUHIHUULQJ be on that list.
of course, to the gusset, which permits maximum mobility when
lifting legs. (Note: Back issues are not for sale.)

82 BLACK BELT I AUGUST/SEPTEMBER 2015 BLACKBELTMAG.COM


versatile fight simulator

VS.BOB

THE NEWEST FACE OF VERSYS


World Leader in Martial Arts Since 1976


UNIFORMS • BELTS • SPARRING GEAR • TRAINING BAGS • WEAPONS

“Century” is a registered trademark of Century, LLC. All rights reserved. © 2015 Century, LLC. #9355