Vous êtes sur la page 1sur 114

HABILIDADES DE AUTOGESTIÓN

Programa de entrenamiento
HABILIDADES DE AUTOGESTIÓN

Programa de entrenamiento

Virginia Arranz
David Aguado
Beatriz Lucía

Servicio de Publicaciones de la Universidad Autónoma de Madrid, 2009


Todos los derechos reservados. De
conformidad con lo dispuesto en
la legislación vigente, podrán ser
castigados con penas de multa y
privación de libertad quienes re-
produzcan o plagien, en todo o en
parte, una obra literaria, artística
R FLHQWtÀFD ÀMDGD HQ FXDOTXLHU
tipo de soporte, sin la preceptiva
autorización.

‹9LUJLQLD$UUDQ]0RQMH
David Aguado García
Beatriz Lucía Martínez
http://www.iic.uam.es

© Ediciones UAM, 2009


Ediciones Universidad Autónoma de Madrid
Servicio de Publicaciones de la UAM
Ciudad Universitaria de Cantoblanco
Ctra. de Colmenar, km. 15
28049 Madrid
Tel. 91 497 4233 (Fax 91 497 5169)
http://www.uam.es/publicaciones
servicio.publicaciones@uam.es

2ª Edición 1ª Impresión
ISBN: 978-84-8344-150-3
Depósito Legal:
Printed in Spain – Impreso en España
H,6%1
Índice

Prólogo.......................................................................... 9
Presentación .................................................................. 11
Introducción .................................................................. 13

$XWRFRQÀDQ]D
1.1. Descripción de la habilidad ............................................... 17
1.2. Ayudas para la práctica
,GHQWLÀFDUVXVFXDOLGDGHVSRVLWLYDV\VXVOLPLWDFLRQHV ................ 18
5HDÀUPDUODVFXDOLGDGHVSRVLWLYDV\PHMRUDUODVOLPLWDFLRQHV
personales a través de la práctica........................................ 20
1.3. Resumen ..................................................................... 22

2. Afrontar el fracaso
2.1. Descripción de la habilidad ............................................... 25
2.2. Ayudas para la práctica
9DORUDUORVHUURUHVGHPDQHUDREMHWLYD.................................. 27
,GHQWLÀFDUODVFDXVDV ....................................................... 28
2.2.3. Evitar las atribuciones internas y estables .............................. 29
2.3. Resumen ..................................................................... 30

3. Autocontrol
3.1. Descripción de la habilidad ............................................... 33
3.2. Ayudas para la práctica
3.2.1. Mantener el control emocional ........................................... 34
3.2.2. Analizar los hechos separando la razón y la emoción ................. 36
8WLOL]DUXQOHQJXDMHQRDJUHVLYR .......................................... 39
3.3. Resumen ..................................................................... 41
4. Asertividad
4.1. Descripción de la habilidad ............................................... 45
4.2. Ayudas para la práctica
4.2.1. Evitar decir «sí» cuando se quiere decir «no» .......................... 48
4.2.2. Demandar sin atacar........................................................ 49
4.2.3. Realizar críticas constructivas ............................................ 50
4.3. Resumen ..................................................................... 52

5. Empatía
5.1. Descripción de la habilidad ............................................... 55
5.2. Ayudas para la práctica
5.2.1. Demostrar interés y atención ............................................... 57
5.2.2. Tener predisposición para comprender .................................... 59
$\XGDUDORWURDFRQÀDUHQVtPLVPRSDUDLQLFLDUHOFDPELR............ 61
5.3. Resumen ..................................................................... 62

6. Adaptación al cambio
6.1. Descripción de la habilidad ............................................... 65
6.2. Ayudas para la práctica
6.2.1. Mostrarse abierto y positivo ................................................. 67
6.2.2. Informarse
6.2.3. Analizar ......................................................................... 68
6.3. Resumen ..................................................................... 69

7. Gestión del tiempo


7.1. Descripción de la habilidad ............................................... 73
7.2. Ayudas para la práctica
3ODQLÀFDUGHPDQHUDHÀFD].................................................. 75
7.2.2. Decidir las tareas y el momento ............................................ 77
7.2.3. Controlar los «ladrones de tiempo» ........................................ 79
7.3. Resumen ..................................................................... 80

8. Solución de problemas
8.1. Descripción de la habilidad ............................................... 83
8.2. Ayudas para la práctica
8.2.1. Emplear el método IDEAR.................................................... 84
8.2.2. Utilizar técnicas creativas ................................................... 85
8.2.3. Plan de acción ................................................................. 86
8.3. Resumen ..................................................................... 88

Anexos ................................................................................. 89
Anexo 1. Metodología ............................................................... 91
Anexo 2. Cuestionario de evaluación general ................................... 93
Anexo 3. Entrenamiento ............................................................ 99
Bibliografía...........................................................................111
PRÓLOGO

Este libro que tiene en sus manos nace de la experiencia directa de los au-
tores en diversos proyectos empresariales e institucionales para la evaluación y
el desarrollo de competencias. Su amplia trayectoria como profesionales en el
campo de la psicología avala todos los diferentes temas de este manual, el cual
se presenta ahora en su segunda edición, revisada, corregida y diseñada nueva-
mente tras el éxito de la primera publicación para que el lector saque el mayor
EHQHÀFLR GH ORV FRQWHQLGRV 6L ELHQ HVWH OLEUR HVWi GLULJLGR HVSHFLDOPHQWH D
DTXHOORVTXHTXLHUHQDPSOLDURPHMRUDUVXVDSWLWXGHVGHFDUDDOPXQGRODERUDO
en realidad se presenta como una guía práctica para toda persona que desee
HQULTXHFHUVXVFDSDFLGDGHVSHUVRQDOHV\VRFLDOHVDVtFRPRODHÀFDFLDQHFHVDULD
SDUDORJUDUVXVREMHWLYRVHQODYLGD

&XDQGRXQDSHUVRQDÀQDOL]DVXVHVWXGLRVVHJXUDPHQWHGRPLQDUiXQFRQMXQ-
WRGHKDELOLGDGHVWpFQLFDVTXHOHSHUPLWLUiQUHDOL]DUFRUUHFWDPHQWHVXWUDEDMR
sin embargo, el desempeño excelente del mismo no va a depender sólo de su
habilidad técnica. Además, debe tener muy en cuenta otra serie de aptitudes
orientadas fundamentalmente a la gestión de los propios recursos y de las re-
laciones con los demás. Éstas y otras son el tipo de competencias que en los
manuales de la serie Programa de entrenamiento le ofrecemos al lector para
TXHODVSUDFWLTXH\ODVOOHJXHDGHVHPSHxDUHÀFLHQWHPHQWHHQVXYLGDGLDULD

Los contenidos expuestos en AutogestiónFRQVWLWX\HQVLQGXGDXQFRQMXQWR


de habilidades imprescindibles para el desarrollo personal, y tienen un gran
potencial para todo tipo de ámbitos laborales o sociales. Estos contenidos abar-
FDQXQDPSOLR\YDULDGRSDQRUDPDGHDFWLWXGHVFRPRVRQODFRQÀDQ]DHQODV
propias capacidades, afrontar los fracasos de forma constructiva, ser asertivo,
FRQWURODUODVHPRFLRQHVGHPDQHUDTXHQRLQWHUÀHUDQHQQXHVWUDVDFWXDFLRQHV
desarrollar una actitud abierta para relacionarnos con los demás, ser capaz de
10 AUTOGESTIÓN

adaptarse al cambio, gestionar el tiempo de manera correcta y dominar estra-


tegias de solución de problemas.

5HÀULpQGRVHDHVWDVKDELOLGDGHVHQOD2UJDQL]DFLyQ0XQGLDOGHOD6D-
OXG 206 GHÀQLyGLH]GHVWUH]DVSVLFRVRFLDOHVDODVTXHGHQRPLQy©+DELOLGDGHV
SDUDODYLGDªFRQHOSURSyVLWRGHDERUGDUXQDHGXFDFLyQLQWHJUDOSDUDORVMy-
YHQHVTXHOHVSHUPLWLHUDDIURQWDUORVUHWRVFRQXQDPD\RUSUHSDUDFLyQ+R\HQ
día estas habilidades gozan de un importante reconocimiento, ya que se asume
su papel de relevancia en la promoción de la salud.

Una característica fundamental es el especial énfasis que hemos proyecta-


do en la puesta en práctica de las habilidades expuestas. En esta aproximación
VXE\DFHXQDLGHDLPSUHVFLQGLEOH©ORTXHQRVHSUDFWLFDQRVHDSUHQGHª%DMR
esta premisa, para cada una de las diferentes destrezas tratadas se proponen
una serie concreta de ayudas, así como pautas de comportamientos clave y
UHFRPHQGDFLRQHVQHFHVDULDV+HPRVLQFOXLGRWDPELpQÀFKDVGHSODQLÀFDFLyQ\
FRQWUROTXHYDQDSHUPLWLUDOOHFWRUOOHYDUDODSUiFWLFDGHPDQHUDHÀFLHQWHODV
estrategias mostradas en Autogestión.

0HUHFHHVSHFLDODWHQFLyQHOKHFKRGHTXHHVWHOLEURQRHVVyORUHÁHMRGHXQ
esfuerzo teórico, sino que tiene detrás la amplia experiencia de los autores en
este campo de las habilidades no técnicas, por su dedicación en el Instituto de
Ingeniería del Conocimiento (IIC). El IIC es un centro de I+D+i (Investigación +
Desarrollo + Innovación) ubicado en la Universidad Autónoma de Madrid (UAM),
que crea soluciones informatizadas on demand (se pueden consultar en nuestra
página web: www.iic.uam.es). Estas soluciones están orientadas para la gestión
del talento en personas, equipos y organizaciones. Uno de los proyectos a re-
saltar es el «Programa de desarrollo de competencias» para alumnos de último
FXUVRGHFDUUHUDGHOD8QLYHUVLGDG$XWyQRPDGH0DGULGHODERUDGRFRQHOREMH-
WLYRGHPHMRUDUODVH[SHFWDWLYDVGHLQVHUFLyQODERUDO

/DH[SHULHQFLDDFXPXODGDGHORVDXWRUHVHQHVWHFDPSRMXQWRFRQODYDOtD
el rigor y el interés para el lector de las propuestas reseñadas, me llevan a reco-
mendarle vivamente este libro. Albergo la plena conciencia de que le va a servir
de útil herramienta ante los retos del mundo profesional, tanto a los que han
de enfrentarse a él en un futuro reciente como para las personas ya insertas en
el ámbito laboral, y que igualmente le va a acompañar como libro de consulta,
referencia y apoyo ante los escollos o problemas a los que habrá de enfrentarse
en su entorno personal.

En sus manos está.

José Miguel Mata


Director General, IIC
PRESENTACIÓN

Autogestión es mucho más que un libro de consulta. Se trata de una com-


SOHWDJXtDSDUDHODSUHQGL]DMHDWUDYpVGHODSUiFWLFDGHRFKRKDELOLGDGHVTXH
OHYDQDD\XGDUDDGPLQLVWUDUVXVUHFXUVRVHÀFD]PHQWH&XDQGRKDEODPRVGH
habilidades de autogestiónQRVUHIHULPRVDXQFRQMXQWRGHFXDOLGDGHVJHQpULFDV
que nos permiten hacer frente de manera efectiva a las exigencias que están
presentes en una gran variedad de situaciones personales, sociales y profesio-
QDOHV$OJXQRV HMHPSORV VRQ OD FDSDFLGDG SDUD VXSHUDU HO IUDFDVR GH IRUPD
constructiva, la habilidad para hacer una crítica sin herir emocionalmente a la
otra persona o la disposición para acomodarse a los cambios.

Aquí va a encontrar la información y el material de apoyo esencial para


que aplique, en situaciones cotidianas, las habilidades que le exponemos, y
consiga alcanzar el dominio de las mismas con la ayuda de unas determinadas
pautas de acción. Ya que se trata de un programa de entrenamiento autónomo,
el aprovechamiento del material incluido dependerá del grado de desarrollo
o de perfeccionamiento que desee alcanzar cada persona con respecto a las
habilidades propuestas.

La estructura del libro está pensada para facilitar un rápido acceso a la


información necesaria de forma relativamente independiente. Siendo ocho las
habilidades de autogestión, como decimos, la estructura se adecua de manera
que cada capítulo se centra en una de dichas habilidades que componen el pro-
grama de entrenamiento.

La introducción incluye una descripción de las habilidades de autogestión.


8QDYH]VHxDODGDVQRVFHQWUDPRVHQORVREMHWLYRVTXHVHSUHWHQGHQDOFDQ]DU
tras la lectura del libro y la práctica de las estrategias recomendadas.
12 AUTOGESTIÓN

(QHOSULPHUFDStWXORVHDERUGDXQiUHDIXQGDPHQWDOFRPRHVODFRQÀDQ-
]DHQQRVRWURVPLVPRV ©$XWRFRQÀDQ]Dª 7UDEDMDUHPRVDTXtVREUHGLIHUHQWHV
estrategias que le permitirán tener un conocimiento preciso de sus cualidades
personales y de sus propias limitaciones, así como de la forma en la que puede
UHDÀUPDUODVSULPHUDV\UHGXFLUHOLPSDFWRGHODVVHJXQGDV

En el segundo capítulo se estudia cómo «Afrontar el fracaso» y aprender


constructivamente de las situaciones difíciles.

En el tercer capítulo se presenta un sistema de habilidades para dominar el


SHQVDPLHQWR\ODVHPRFLRQHVFRQREMHWLYLGDGDFRUGHDODVLWXDFLyQ ©$XWRFRQ-
trol»). Le enseñaremos cómo gestionar una respuesta negativa y cómo contro-
ODUODDQVLHGDG(QHVWHFDStWXORVHH[SRQHWDPELpQHOPRGRHÀFD]GHHYLWDUOD
comunicación agresiva.

El capítulo cuarto pone la atención sobre una de las más importantes habili-
dades sociales, la «Asertividad». Ésta consiste en expresar claramente nuestras
ideas, nuestro punto de vista y nuestros sentimientos sin herir a los demás. La
DVHUWLYLGDGJHQHUDELHQHVWDUHPRFLRQDO\IDYRUHFHODFRQÀDQ]DHQODFDSDFLGDG
expresiva.

El capítulo cinco trata sobre la «Empatía», esto es, la capacidad de poder


LGHQWLÀFDUVHFRQRWUDSHUVRQDGHFRPSUHQGHUVXSHQVDPLHQWR\GHFRPSDUWLU
sus sentimientos.

El sexto capítulo, «Adaptación al cambio», estudia cómo podemos asumir


y acomodarnos a situaciones diferentes a las que estamos acostumbrados. La
adaptabilidad será una de las principales estrategias para practicar.

(QHOFDStWXORVLHWHYHUHPRVODVSDXWDVSDUDFRQVHJXLUXQDHÀFD]©*HVWLyQ
del tiempo» y aprovechar los recursos y la productividad de las tareas. Para ello
HVQHFHVDULRVDEHUSODQLÀFDUODVDFWLYLGDGHVWRPDUODVGHFLVLRQHVFRUUHFWDVGH
forma ágil y controlar aquello que supone una distracción.

El octavo y último capítulo analiza los pasos idóneos para lograr una ade-
cuada «Solución de problemas», y, por consiguiente, favorecer las consecuen-
cias positivas por encima de las negativas con un plan de acción en los ámbitos
personal, profesional y social.

&RPSOHWDQÀQDOPHQWHHOOLEURYDULRVDQH[RVHQORVTXHVHIDFLOLWDPDWHULDO
adicional para llevar a cabo la práctica de las ocho habilidades. Consisten, bá-
VLFDPHQWHHQPRGHORVSDUDSODQLÀFDU\UHJLVWUDUORVUHVXOWDGRVGHULYDGRVGHO
entrenamiento.
INTRODUCCIÓN

Antes de comenzar el primer capítulo de este libro es recomendable que


GHÀQDPRVTXpVRQODVKDELOLGDGHVGHDXWRJHVWLyQ\HVERFHPRVGHTXpPDQHUD
LQÁX\HQHQQXHVWURGHVDUUROORSHUVRQDOHQHOHIHFWRGHQXHVWUDVDFFLRQHV\HQ
nuestra interacción con los demás.

Las habilidades de autogestión son un repertorio de conocimientos, actitu-


des, comportamientos y destrezas que nos ayudan a potenciar al máximo los
UHFXUVRVSHUVRQDOHVSHUPLWLpQGRQRVREWHQHUORVPHMRUHVUHVXOWDGRVHQVLWXD-
FLRQHV FRWLGLDQDV /D DXWRJHVWLyQ HV OD FDSDFLGDG SDUD DGPLQLVWUDU HÀFLHQWH-
mente nuestros propios recursos. Es sinónimo de autonomía para procesar la
información que proviene del entorno, tomar decisiones inteligentes y hacer
frente a las exigencias del medio.

En general, estas habilidades están interrelacionadas entre sí y, por tanto, el


GHVDUUROOR\ODPHMRUDGHFXDOTXLHUDGHHOODVLQFLGHSRVLWLYDPHQWHHQHOUHVWR

(QUHÀULpQGRVHDHVWHFRQMXQWRGHKDELOLGDGHVOD2UJDQL]DFLyQ0XQ-
GLDOGHOD6DOXG 206 GHÀQLyGLH]GHVWUH]DVSVLFRVRFLDOHVDODVTXHGHQRPLQy
©+DELOLGDGHV SDUD OD YLGDª (VWDV GLH] KDELOLGDGHV VRQ FRQRFLPLHQWR GH XQR
PLVPR FRPXQLFDFLyQ HIHFWLYD R DVHUWLYD WRPD GH GHFLVLRQHV SHQVDPLHQWR
FUHDWLYRPDQHMRGHHPRFLRQHV\VHQWLPLHQWRVHPSDWtDUHODFLRQHVLQWHUSHU-
VRQDOHV VROXFLyQ GH SUREOHPDV \ FRQÁLFWRV SHQVDPLHQWR FUtWLFR PDQHMR GH
tensiones y estrés. En la actualidad estas destrezas o habilidades son notable-
PHQWH DSUHFLDGDV \D TXH VH DVXPH FRQ FODULGDG TXH MXHJDQ XQ LPSRUWDQWH
papel en la promoción de la salud personal, social y laboral. Paralelamente a
HVRHVHYLGHQWHTXHODHGXFDFLyQDFDGpPLFDQRHVVXÀFLHQWHSDUDJDUDQWL]DU
la efectiva gestión de las relaciones con los demás, con uno mismo, e incluso
con el entorno, de manera que podamos ser efectivos en nuestra interacción
14 AUTOGESTIÓN

FRQHOPXQGR(QGHÀQLWLYDHOHQWUHQDPLHQWRHQHVWHFRQMXQWRGHGHVWUH]DV
se convierte en un importante valor añadido para que las personas aprendan a
FRQGXFLUVHHÀFD]PHQWHHQXQDJUDQYDULHGDGGHVLWXDFLRQHVTXHYDQGHVGHODV
relacionadas con nuestro entorno más personal hasta las implicadas en nuestro
desempeño profesional.

Al hablar de habilidades de autogestión, o de habilidades para la vida, se


hace referencia a tres grandes áreas: gestión de las emociones, interacción con
ORVGHPiV\VROXFLyQGHFRQÁLFWRV'HOFRQMXQWRGHODVGHVWUH]DVUHODFLRQDGDV
con dichas áreas hemos seleccionado las más representativas para tratarlas en
profundidad en este libro. A continuación enumeramos las ocho habilidades de
DXWRJHVWLyQMXQWRFRQHOWLSRGHSUHJXQWDVDODVTXHWUDWDQGHGDUUHVSXHVWD
&RPR REVHUYDUi HVWH DSUHQGL]DMH HV EHQHÀFLRVR SDUD FXDOTXLHUD TXH GHVHH
UHVROYHUGHIRUPDHÀFLHQWHVLWXDFLRQHVFRWLGLDQDVFRPRODVTXHDTXtVHFLWDQ

 $XWRFRQÀDQ]D¢&yPRPHMRUDUODFRQÀDQ]D\ODVHJXULGDGHQPtPLVPR"

 $IURQWDUHOIUDFDVR¢&yPRSXHGRVXSHUDUHOIUDFDVR\DSUHQGHUGHHO"
¢4XpKDFHUFXDQGRODVFRVDVVDOHQPDO"

 $XWRFRQWURO¢&yPRSXHGRFRQWURODUODDJUHVLYLGDG\ODLPSXOVLYLGDG"

 $VHUWLYLGDG¢&yPRGHFLU©QRªSDUDKDFHUUHVSHWDUPLVGHUHFKRV"

 (PSDWtD¢&yPRSXHGRDFHUFDUPHDODSRVWXUDRDFWLWXGGHRWURV"

 $GDSWDFLyQDOFDPELR¢3RUTXpHVWDQGLItFLOFDPELDUFXDQGRODVFRVDV
SDUHFHQLUELHQ"

 *HVWLyQ GHO WLHPSR ¢3RU TXp VXUJH OD DFXPXODFLyQ GH WUDEDMR HO
GHVRUGHQORVHUURUHVHWF"

 6ROXFLyQ GH SUREOHPDV ¢3RU TXp PH DEUXPDQ ORV SUREOHPDV SRU
SHTXHxRVTXHVHDQ"¢&yPRKDFHUOHVIUHQWH"
1

AUTOCONFIANZA
1. AUTOCONFIANZA

1.1. Descripción de la habilidad

/DDXWRFRQÀDQ]DHVODFDSDFLGDGGHXQDSHUVRQDSDUDFUHHUTXHHVFDSD]
de lograr aquello que se propone porque dispone de las cualidades necesarias.
Por tanto, es un sentimiento estrechamente relacionado con el reconocimiento
de las cualidades y limitaciones que nos caracterizan (lo que se denomina au-
toconcepto).

+D\FLHUWRFRQVHQVRHQSHQVDUTXHHODXWRFRQFHSWRVHIRUPDDWUDYpVGHO
WLHPSR FRPR UHVXOWDGR GH XQ FRQMXQWR GH IDFWRUHV TXH VRQ UHVSRQVDEOHV HQ
mayor o menor medida, de la imagen creada. Estos factores son, fundamental-
mente, cuatro:

‡ Lo que uno mismo piensa o cree que es.


‡ Lo que desearía ser.
‡ Lo que cree que debe ser.
‡ Lo que otros piensan que es.

/DLPDJHQGHQRVRWURVPLVPRVODKHPRVLGRFRQÀJXUDQGRDWUDYpVGHQXHV-
tra propia experiencia y determinará, en gran medida, nuestras actuaciones
futuras. Es decir, si una persona se reconoce a sí misma como experta en una
determinada tarea es porque la ha realizado en anteriores ocasiones y le ha
18 AUTOGESTIÓN

SURSRUFLRQDGREXHQRVUHVXOWDGRV3RUWDQWRHVWHDSUHQGL]DMHKDUiTXHODSHU-
sona aborde con seguridad dicha actividad u otras similares en futuras ocasio-
nes y le ayudará a resolverlas con el mismo éxito.

Si las experiencias del pasado van formando la percepción de uno mismo,


ODSUiFWLFDHVHOPpWRGRPiVHÀFD]SDUDUHDÀUPDUHVWDVFXDOLGDGHVYHQFHUODV
SRVLEOHVOLPLWDFLRQHV\HQFRQVHFXHQFLDSDUDPHMRUDUHOFRQFHSWRTXHWHQH-
mos de nosotros mismos.

3LHQVHTXHODVDFFLRQHVFRKHUHQWHV\FRUUHFWDVWHQGHUiQDUHDÀUPDUHOFRQ-
cepto positivo que tiene de usted mismo, mientras que las que evidencian sus
limitaciones reforzarán la imagen negativa sobre sí mismo. El resultado de sus
acciones consolidará la hipótesis que mantiene acerca de usted en ambos sen-
tidos: «Estaba en lo cierto, sé y puedo hacerlo bien» o «No sé y no soy capaz
de hacerlo bien». Por tanto, en el futuro tenderá a afrontar con seguridad las
primeras y a evitar las segundas por temor a poner a prueba sus limitaciones.
Esta experiencia hará que se mantenga —o incluso que refuerce— su autocon-
FHSWR/RPiVHÀFD]UHVXOWDUtDromper este círculo progresivamente a través
de la práctica.

(QUHVXPHQHOHVTXHPDSDUDWUDEDMDUVHHVWDEOHFHHQGRVGLUHFFLRQHVUH-
DÀUPDUHODXWRFRQFHSWRSRVLWLYR\PHMRUDUHODXWRFRQFHSWRQHJDWLYR

‡ 5HDÀUPDU HO DXWRFRQFHSWR SRVLWLYR LQWHQWDU VXSHUDUVH UHDOL]DQGR


aquellas tareas sobre las que se ha formado un autoconcepto positivo e
LQWHQWDUJHQHUDOL]DUORDRWUDVVLWXDFLRQHVPiVFRPSOHMDV
‡ 0HMRUDUHODXWRFRQFHSWRQHJDWLYRDIURQWDUFRQVWUXFWLYDPHQWHWDUHDV
GLItFLOHVLGHQWLÀFDQGRORTXHVHSXHGHKDFHUSDUDYHQFHUODVOLPLWDFLR-
nes.

3RGHPRVGHFLUSXHVTXHODDXWRFRQÀDQ]DHVQXHVWUDFDSDFLGDGSDUDFUHHU
que somos capaces de lograr aquello que nos proponemos porque disponemos
de las cualidades necesarias.

1.2. Ayudas para la práctica

,GHQWLÀFDUVXVFXDOLGDGHVSRVLWLYDV\VXVOLPLWDFLRQHV

(OKHFKRGHTXHXQDSHUVRQDSXHGDLGHQWLÀFDUODVFXDOLGDGHVSRVLWLYDVTXH
ODGHÀQHQSRUVXPDQHUDGHDFWXDU\GHFRPSRUWDUVHJHQHUDQHQpVWDODFRQ-
ÀDQ]DVXÀFLHQWHSDUDDIURQWDUWDUHDVGLItFLOHV\TXHVXSRQHQXQUHWRFRQOD
seguridad de poder abordarlas con éxito.
PROGRAMA DE ENTRENAMIENTO 19

Para ello es importante escoger el contexto de actuación en el que exami-


QDUiVXVFXDOLGDGHV3UHJ~QWHVH©9R\DLGHQWLÀFDUPLVFXDOLGDGHVROLPLWDFLR-
nes para una tarea determinada». Así puede centrarse en situaciones propia-
mente personales, profesionales o de carácter social.

8Q PpWRGR TXH OH D\XGDUi D LGHQWLÀFDU VXV FXDOLGDGHV \ VXV OLPLWDFLRQHV
es el análisis de incidentes críticos. Esta técnica consiste en la recopilación de
información sobre incidentes ocurridos durante un periodo de tiempo determi-
nado en un ámbito concreto (personal, social o profesional). El análisis de los
éxitos y los fracasos de dichas experiencias pasadas permite hacer atribucio-
QHVSHUVRQDOHVHLGHQWLÀFDUFXDOLGDGHV\OLPLWDFLRQHVFRQFUHWDV3RUHMHPSOR
GtJDVH©¢4XpKL]RTXHDOJRVDOLHUDELHQ"ª(OÀQ~OWLPRGHHVWHDQiOLVLVWLHQH
TXHVHUHODSUHQGL]DMHSDUDHYHQWRVVLPLODUHVIXWXURV3DUDOOHYDUORDFDERVLJD
estos cinco pasos:

1. Piense en la última situación que le ha reportado un éxito.


 3RUHMHPSORODIHOLFLWDFLyQSRUXQRGHVXVWUDEDMRV

 ,GHQWLÀTXHFRQKHFKRVREMHWLYRVSRUTXpKDVLGRXQp[LWR
Pregúntese en qué se ha basado su éxito, en qué logros concretos se
traduce.
 3RUHMHPSOR©/RVFOLHQWHVKDQIHOLFLWDGRDOGHSDUWDPHQWRªR©+HPRV
ÀQDOL]DGRHOSUR\HFWRDQWHVGHWLHPSRª

3. Relacione ahora lo conseguido con su propia actuación.


 3UHJ~QWHVH ©¢$ TXp VH GHEH GLFKR p[LWR"ª H LQWHQWH UHVSRQGHU FRQ
REMHWLYLGDG
 3RU HMHPSOR ©$ PL SHUVHYHUDQFLD HQ ORJUDU TXH ORV FOLHQWHV«ª ©$
mi capacidad para escuchar al cliente y atender a sus demandas»
(escucha, receptividad) o «A mi experiencia en el campo de las ventas»
(experiencia).

+DVWDDTXt\DKDFRPSUHQGLGRDOJXQDVKDELOLGDGHVTXHOHUHSRUWDQp[LWR
3HURYD\DXQSRFRPiVOHMRV7UDWHGHVDFDUPiVLQIRUPDFLyQGHORVXFHGLGR

 5HÁH[LRQHSDUDPHMRUDU
 7UDWHGHFRQWHVWDUDODSUHJXQWDGH©¢4XpFRVDVSRGUtDQKDEHUVDOLGR
PHMRU"ª
 3RU HMHPSOR ©1R WRGRV ORV PLHPEURV GHO HTXLSR KDQ WUDEDMDGR SRU
igual».

5. Resuma la información.
 3UHJ~QWHVHSRUHMHPSOR©¢4XpOLPLWDFLRQHVHVWiQUHODFLRQDGDVFRQORV
DVSHFWRVDQWHULRUHV"ªR©¢4XpPHKXELHUDKHFKRIDOWDSDUDPHMRUDUPL
20 AUTOGESTIÓN

DFWXDFLyQHQORVSXQWRVDQWHULRUHVKDELOLGDGHVGHWUDEDMRHQHTXLSR
SODQLÀFDFLyQDMXVWDGDDOSUR\HFWR«"ª

5HDÀUPDUODVFXDOLGDGHVSRVLWLYDV\PHMRUDUODVOLPLWDFLRQHVSHUVRQDOHV
a través de la práctica

5HFXHUGHTXHODVDFFLRQHVFRKHUHQWHVFRQVXVFXDOLGDGHVWHQGHUiQDUHDÀU-
mar su autoconcepto positivo, mientras que las que evidencian sus limitaciones
reforzarán la imagen negativa sobre sí mismo. La práctica es la herramienta
TXHOHSHUPLWLUiPHMRUDUVXVSXQWRVGpELOHV\IRUWDOHFHUVXVFXDOLGDGHV3DUD
ello, es importante tener en cuenta las siguientes consideraciones antes, du-
rante y después de ponerse en una situación determinada.

A. ANTES. Prepárese.

‡ 5HÁH[LRQHVREUHVtPLVPR([DPLQHODVFXDOLGDGHVTXHOHGHÀQHQ\TXH
se pondrán a prueba.
‡ 5HFXHUGH DFWXDFLRQHV GH p[LWR (VWH HMHUFLFLR D\XGD D HVWLPXODU HO
concepto positivo de usted mismo, lo cual motiva y da fuerzas para
iniciar nuevos retos.
‡ 3UHYHDGHVDMXVWHVHQWUHVXFRPSHWHQFLD\ODVKDELOLGDGHVTXHUHTXLHUH
la nueva tarea. Trate de compensar las diferencias mediante el
DSUHQGL]DMHRFRQDFFLRQHVHTXLSDUDEOHVTXH\DGRPLQD
‡ Créaselo. Esté preparado y confíe en sus capacidades.

B. DURANTE. Anímese.

‡ Anticipe consecuencias positivas. Recuerde a dónde desea llegar y por


qué. Le dará ánimos.
 'tJDVHSRUHMHPSOR©7RGRLUiELHQODFDOLGDGVHUiH[FHOHQWHJDQDUHPRV
SUHVWLJLR\FRQVHJXLUHPRVORVREMHWLYRVª

‡ Verbalice cualquier progreso o éxito. Deténgase ante pequeños logros


que supongan pasos en la dirección correcta y atribúyase el éxito.
 3RUHMHPSOR©+HPRVORJUDGRGHÀQLUXQSODQUHDOPHQWHDWUDFWLYRª
‡ Trate de darse instrucciones positivas. No se desanime ante las
GLÀFXOWDGHVSLHQVHHQODDOWHUQDWLYDRVROXFLyQPiVSRVLWLYD
 3RUHMHPSOR©1RKD\PRWLYRSDUDSUHRFXSDUVHWHQGUpTXHUHWRFDU\
UHDMXVWDUODSODQLÀFDFLyQLQLFLDODQWHORVSUREOHPDVVXUJLGRVª
PROGRAMA DE ENTRENAMIENTO 21

C. DESPUÉS. Prémiese y aprenda.

‡ 3UpPLHVHORVORJURV5HFRQR]FDVXVORJURV\UHDÀUPHDELHUWDPHQWHODV
cualidades personales que lo han hecho posible.

 3RUHMHPSOR©(VWR\PX\VDWLVIHFKRDGHOSURJUHVRGHPLVFRODERUDGRUHV
VDEtDTXHSRGtDFRQÀDUHQPLFRQVWDQFLD\FDSDFLGDGGHSHUVXDVLyQª

‡ Aplique y practique sus habilidades en otras áreas. No se conforme


con el éxito en aquello que ya domina, piense en distintas áreas u
REMHWLYRVGHGLÀFXOWDGFUHFLHQWHGRQGHSXHGDVHQWLUVHFDSD]GHDSOLFDU
FRQHÀFDFLDVXVKDELOLGDGHV

‡ *HVWLRQHHOIUDFDVR1RVHODPHQWHGHORVHUURUHV([DPLQHREMHWLYDPHQWH
HQTXpKDIDOODGR3ODQWpHVHPHWDVGHPHMRUD\QRJHQHUDOLFHRSUR\HFWH
el sentimiento de fracaso a todas sus actuaciones.

 &RQFUHWHVXVREMHWLYRVGHPHMRUDUHVSRQGLHQGRDHVWDSUHJXQWD©¢4Xp
YR\DKDFHUH[DFWDPHQWHSDUDPHMRUDU"ª
22 AUTOGESTIÓN

1.3. Resumen

5HFXHUGHODVDFFLRQHVTXHOHSHUPLWHQUHDÀUPDUVXDXWRFRQÀDQ]D

 $17(63UHSiUHVHUHÁH[LRQHDFHUFDGHVXVFDSDFLGDGHV\OLPLWDFLRQHV
Deténgase a pensar en actuaciones similares.

DURANTE. Trate de darse ánimos y verbalice sus progresos. Anticipe


consecuencias positivas.

DESPUÉS. Felicítese por los logros, practique sus habilidades en otras


iUHDV\HQORVFDVRGHHUURUDQDOLFHODVLWXDFLyQSDUDPHMRUDU

Las estrategias para emprender estas acciones con éxito son:

Estudiar la imagen que tiene de sí mismo. Examinar qué cualidades


y limitaciones piensa que le caracterizan por su forma de pensar y
GH DFWXDU (Q FRQFUHWR KiJDOR UHVSHFWR D XQD WDUHD HVSHFtÀFD TXp
habilidades posee que le permitirán afrontar con éxito la situación.

La práctica es su fuente de aprendizaje. La experiencia, los resultados


GHVXVDFFLRQHVOHYDQDSHUPLWLUUHDÀUPDUVXVFXDOLGDGHVSRVLWLYDV\
aprender de sus limitaciones.

.
2

AFRONTAR EL FRACASO
2. AFRONTAR EL FRACASO

2.1. Descripción de la habilidad

Afrontar los errores y fracasos de manera constructiva supone interpretar


ODUHDOLGDGGHIRUPDREMHWLYD\SUiFWLFDVREUHWRGRFXDQGRVHWUDWDGHYDORUDU
ORVHUURUHVFRPHWLGRV$WUDYpVGHHVWDYLVLyQREMHWLYDUHDÀUPDPRVODDXWRFRQ-
ÀDQ]DHQODVSURSLDVFDSDFLGDGHV\GHWHFWDPRViUHDVSHUVRQDOHVGHPHMRUD

El fracaso, entendido como la no consecución de los resultados deseados,


suele generar sentimientos negativos de frustración o de culpa cuando se atri-
buye a factores personales. En este sentido, puede incapacitarnos frente al
FDPELRGHMiQGRQRVLQGHIHQVRV\HMHUFLHQGRXQSDSHOGHVWUXFWLYRVREUHQXHVWUR
autoconcepto. Sin embargo, el fracaso también tiene una función adaptativa,
\DTXHGLULJHQXHVWURFRPSRUWDPLHQWRDODSUHQGL]DMHVREUHORVUHVXOWDGRVIDOOL-
dos de nuestros actos.

/DKDELOLGDGSDUDDQDOL]DUHOIUDFDVRGHIRUPDREMHWLYD\FRQVWUXFWLYDFRQV-
WLWX\H XQD YDOLRVD KHUUDPLHQWD GH DXWRDSUHQGL]DMH$QDOL]DU ORV IDFWRUHV TXH
han intervenido en el fracaso nos protege del sentimiento de indefensión —que
se desencadena cuando atribuimos el error a causas internas, estables e inamo-
vibles— o, por el contrario, a causas externas —que escapan a nuestro control—.
(OKHFKRGHYDORUDU\UHÁH[LRQDUREMHWLYDPHQWHVREUHHOHUURU\VREUHHOSUR-
FHVRTXHORKDSURYRFDGRSRVLELOLWDHOFDPELR\HODSUHQGL]DMHDGHPiVGHTXH
nos ayuda a superar aquello que no ha funcionado.
26 AUTOGESTIÓN

/D YDORUDFLyQ REMHWLYD GH ORV KHFKRV HV HO LQVWUXPHQWR PiV YDOLRVR SDUD
protegernos de los sentimientos negativos de culpabilidad que pueden llegar
a incapacitarnos. Esta estrategia implica analizar y atribuir un error a hechos
FRQFUHWRV \ FDPELDEOHV PRGLÀFDEOHV HQ HO IXWXUR  KX\HQGR GH YDORUDFLRQHV
desproporcionadas del tipo «Soy un desastre», «No valgo para esto».

/DYDORUDFLyQKDGHVHJXLUHVWRVSDVRVHYDO~HGHPDQHUDREMHWLYDODUHDOL-
dad, analice constructivamente los errores, atribúyase la responsabilidad que
le corresponda e interprete el fracaso.

$(YDOXDUGHPDQHUDREMHWLYDODUHDOLGDG

Generalmente, ante una situación desfavorable, lo primero que se hace


es observar y evaluar el hecho concreto. Esta valoración puede ser subjetiva
y desproporcionada SRU HMHPSOR ©(V KRUULEOH FDWDVWUyÀFR QR Vp FyPR PH
puede suceder esto a mí». O puede ser objetiva y realistaSRUHMHPSOR©1R
han aceptado mi proyecto, el proyecto que entregué no vale para este re-
querimiento/esta propuesta». En este segundo caso la valoración resulta más
positiva pues nos predispone hacia el examen de la situación, y por tanto hacia
el cambio.

B. Analizar constructivamente los errores

Este paso supone encontrar la causa que ha desencadenado el error. La


ÀQDOLGDGHVORFDOL]DUODUDt]GHOIUDFDVRHVGHFLUORTXHH[DFWDPHQWHKDKHFKR
que los resultados no sean los esperados. Este punto es crucial para llegar al
origen mismo de las circunstancias, para prevenir situaciones similares en el
IXWXUR \ SDUD DGRSWDU ODV PHGLGDV FRUUHFWRUDV PiV HÀFDFHV (Q HVWD IDVH ODV
estrategias de exploración se van a caracterizar por indagar el mayor número y
tipo de causas posibles.

C. Atribuir e interpretar el fracaso

(VLPSRUWDQWHTXHQRVDWULEX\DPRV\DFHSWHPRVREMHWLYDPHQWHODSDUWHGHO
fracaso que nos corresponde. Esta atribución puede ser PDJQLÀFDGD e inamo-
vibleHVGHFLUVLQSRVLELOLGDGGHVROXFLyQRFDPELRHQHOIXWXUR ©+HYXHOWRD
meter la pata, he fracasado»), o bien puede ser realista y cambiable («No he
sabido actuar de manera correcta, no he conseguido que el proyecto saliera
DGHODQWHª /DVDWULEXFLRQHVFDWDVWURÀVWDVQRVKDFHQPiVYXOQHUDEOHV\VHQWLU
indefensión ante la situación presente y futura («No valgo nada» o «Siempre lo
haré igual de mal»). Por el contrario las atribuciones realistas nos predisponen
para actuar de forma constructiva ante el error y ello repercutirá en una valo-
ración más positiva sobre nosotros mismos.
PROGRAMA DE ENTRENAMIENTO 27

En resumen, es importante subrayar la importancia de la capacidad para


aprender de los fracasos de forma constructiva. Para ello hay que estudiar ob-
MHWLYDPHQWHODVLWXDFLyQFRQHOÀQGHPHMRUDUHQIXWXUDVDFWXDFLRQHV

2.2. Ayudas para la práctica

9DORUDUORVHUURUHVGHPDQHUDREMHWLYD

La primera estrategia que ha de seguir para afrontar el fracaso es hacer


una observación de la situación o del hecho concreto de forma descriptiva y sin
realizar ninguna atribución causal. Simplemente, consiste en hacer una valora-
ción realista de la equivocación. Esto le va a permitir convertir un error en una
forma de aprender.

/DYDORUDFLyQSXHGHVHUREMHWLYDRVXEMHWLYD

/D YDORUDFLyQ REMHWLYD HV UHDOLVWD \ VH FHQWUD HQ ORV DVSHFWRV UHDOPHQWH
relevantes de la situación, es decir, en describir exactamente lo que ha pasado.

 3RUHMHPSOR©1RKDQDFHSWDGRPLSUR\HFWRª©(OSUR\HFWRTXHHQWUHJXp
QRVHDMXVWDDODVQHFHVLGDGHVGHOFOLHQWHª

3DUDGHÀQLUODVLWXDFLyQGHSDUWLGDUHVSRQGDDODVVLJXLHQWHVSUHJXQWDVHQ
función de los interrogantes qué, quién, dónde, cuándo y por qué:

‡ ¢4XpKDVXFHGLGRH[DFWDPHQWH"¢4XpWLSRGHHUURUHV"¢4XpFRQVHFXHQFLDV
KDWHQLGR"

‡ ¢4XLpQHVWiLPSOLFDGR"¢$TXLpQHVDIHFWD"
‡ ¢'yQGHKDDSDUHFLGRHOHUURU"¢'yQGHQRVKHPRVHTXLYRFDGR"
‡ ¢&XiQGRKDVXFHGLGRHQTXpSXQWR"¢'HVGHFXiQGRYLHQHREVHUYiQGRVH"
‡ ¢3RUTXpVHWUDWDGHXQHUURURIUDFDVR"(VGHFLU¢TXpVHHVSHUDEDTXH
RFXUULHUD"

/DYDORUDFLyQVXEMHWLYDVLQHPEDUJRVXHOHVHUGHVSURSRUFLRQDGD\QRUH-
ÁHMDORVHOHPHQWRVUHOHYDQWHVGHODVLWXDFLyQ

3RUHMHPSOR©(VKRUULEOHFDWDVWUyÀFRQRVpFyPRPHSXHGHVXFHGHU
esto a mí».
28 AUTOGESTIÓN

$GHPiVHOKHFKRGHGHVFULELUXQIDOORFRQREMHWLYLGDGOHSHUPLWHFDWHJR-
rizarlo dentro de una tipología de errores comunes y conocidos por nosotros
mismos. Por tanto, ante una situación futura de características similares, va a
SRGHULGHQWLÀFDUHVWHWLSRGHGLÀFXOWDG\UHFRQRFHUODIiFLOPHQWHDSRUWDQGROD
VROXFLyQTXHKD\DUHVXOWDGRPiVHÀFD]

,GHQWLÀFDUODVFDXVDV

Una vez que haya valorado la situación, el siguiente paso es encontrar las
causas que la han impulsado. Con ello, empezará a estimar sus propias respon-
sabilidades sobre la situación y a estimar el grado de control que tiene sobre
la misma.

,JXDOPHQWHODDWULEXFLyQSXHGHUHDOL]DUVHGHPDQHUDVXEMHWLYDXREMHWLYD

El grado en que el fracaso se utilice de forma constructiva, como una opor-


WXQLGDGGHDSUHQGL]DMHYDDGHSHQGHUGHODIRUPDHQTXHpVWHVHDQDOLFH(VWR
es, entendemos que el fracaso es un problema —puesto que se trata de una
discrepancia entre lo esperado y lo conseguido— y como tal hay que analizar las
causas que lo han provocado para hallar la solución operativa.

Para analizar la causa del fracaso siga los siguientes pasos:

 'HÀQDTXpHVSHUDED\TXpKDREWHQLGRSDUDHQWHQGHUHQTXpVHWUDGXFH
el error y cómo quedaría resuelto.

2. Realice una tormenta o lluvia de ideas y elabore un listado con el mayor


número de causas posibles que hayan contribuido a generar el error,
preguntándose por qué ha sucedido.

3. Después, agrupe las causas en categorías, y analícelas por separado para


WUDWDUGHLGHQWLÀFDUHORULJHQFRQFUHWRGHOIUDFDVR8QDIRUPDFRP~Q
de agrupamiento es la 4M, que hace alusión a las cuatro categorías
de factores que intervienen en la obtención de resultados: máquinas,
PDQRGHREUD SHUVRQDVLPSOLFDGDVHQODUHDOL]DFLyQGHOWUDEDMR\GH
habilidades requeridas), método y materiales.

4. Elabore un plan de acción para solventar el error presente y prevenir


RWURVIXWXURV$WHQGLHQGRDODFDXVDUHVSRQVDEOHTXHKDLGHQWLÀFDGRHQ
el paso anterior, pregúntese cómo se debería haber hecho, qué debería
KDEHURFXUULGRSDUDTXHQRVHSURGXMHUDHOHUURU
PROGRAMA DE ENTRENAMIENTO 29

2.2.3. Evitar las atribuciones internas y estables

Del análisis anterior se deriva la interpretación que la persona hace del fra-
caso, es decir, la atribución de responsabilidad sobre el mismo. Las atribuciones
SXHGHQVHUREMHWLYDVRVXEMHWLYDV

La atribución objetiva y constructiva tiende a indagar en los aspectos reso-


lubles y cambiables de cara al futuro. Este tipo de atribuciones le van a otorgar
mayor control sobre la situación, y, lo más importante, suelen hacer referen-
FLDDDVSHFWRVLQWHUQRVFRQFUHWRVHLQHVWDEOHV3RUHMHPSORHQODDWULEXFLyQ
©1RKHSODQLÀFDGRDGHFXDGDPHQWHHOSUR\HFWR\SRUHVRQRKHPRVÀQDOL]DGR
a tiempo», se hace alusión a un aspecto concreto de la habilidad para llevar a
cabo la tarea.

La atribución subjetiva, sin embargo, se caracteriza porque tiende a ser


inamovible o sin posibilidad de solución en el futuro. En este caso la explicación
GHOIHQyPHQRVXHOHEXVFDUVHHQDVSHFWRVH[WHUQRVJHQHUDOHVRQRHVSHFtÀFRVH
inestables, esto es, que perduran en el tiempo —como achacarlo a la suerte, o
DODGLÀFXOWDGGHODWDUHD³3RUHMHPSORHQODDWULEXFLyQ©+HYXHOWRDIUDFD-
sar» no se alude a algo concreto sobre lo que se puede actuar sino a un aspecto
JHQHUDOQRHVSHFtÀFR\GXUDGHUR

(O SHQVDPLHQWR VXEMHWLYR HVWi FDUDFWHUL]DGR SRU DOJXQD GH ODV VLJXLHQWHV
visiones:

‡ Visión de túnel sin salida: «Todo me sale mal, siempre».

‡ Etiquetación de uno mismo: «Soy un desastre».

‡ 3HQVDPLHQWRH[WUHPLVWD©6LJRHQHVWHWUDEDMRSRUTXHOHVFXHVWDGHVSHGLUPHª

‡ Sobregeneralización: «Nunca hago nada bien en mi vida», o «Todo me


sale mal».

Todas ellas tienen algo en común: imposibilitan el cambio. No dan cabida a


ODSRVLELOLGDGGHPHMRUDUHQHOIXWXUR

(OSHQVDPLHQWRREMHWLYRQRREVWDQWHSHUPLWHHOFDPELR\ODPHMRUD1R
se trata de intentar actuar o pensar de manera positiva, sino que se evalúe,
DWULEX\D\SLHQVHGHODIRUPDPiVREMHWLYDSRVLEOH

3RUHMHPSOR©1RPHKHSODQLÀFDGRELHQª©+HGHPHMRUDUHVWHDVSHFWRª
30 AUTOGESTIÓN

2.3. Resumen

Analice e interprete la realidad de forma realista. Busque en los errores


SRVLELOLGDGHVGHDSUHQGL]DMH\PHMRUD

Evalúe la situación.6XVWLWX\DORVMXLFLRVGHVSURSRUFLRQDGRVGHOWLSR©(V
una catástrofe» por otros más realistas y centrados en el hecho concreto
como «Estamos desorientados en cuanto a nuestras funciones».

Analice las causas del fracaso de manera objetiva.

Haga una valoración sobre sí mismo +X\D GH IDFWRUHV LQDPRYLEOHV \


reemplácelos por otros resolubles con posibilidad de cambio. Evite
la visión de túnel, la etiquetación, el pensamiento extremista y la
VREUHJHQHUDOL]DFLyQ&pQWUHVHHQDVSHFWRVPRGLÀFDEOHVTXHOHOOHYHQD
la acción.

(QVXPDYDORUHREMHWLYDPHQWHORVHUURUHV\WUiWHORVFRPRIXHQWHVGHFDP-
ELRPHMRUD\SURJUHVRSHUVRQDO
3

AUTOCONTROL
3. AUTOCONTROL

3.1. Descripción de la habilidad

Sentir ansiedad ante una situación desconocida o emitir una respuesta des-
controlada son reacciones habituales sobre las que es necesario actuar para
LPSHGLUTXHLQWHUÀHUDQHQODFRQVHFXFLyQGHQXHVWURVREMHWLYRV

El autocontrol es la capacidad para dominar las emociones y evitar que nos


lleven a reaccionar de manera impulsiva o agresiva. Implica, por tanto, la ca-
SDFLGDGSDUDUHJXODUODVHPRFLRQHVVLQGHMDUTXHpVWDVHFOLSVHQHOSHQVDPLHQWR
UDFLRQDO\SRUWDQWRLQWHUÀHUDQHQQXHVWUDVDFFLRQHV

Se considera que una persona es capaz de controlar sus emociones cuando


consigue que no se interpongan en su comportamiento, de tal forma que éstas
QRFRQVWLWX\DQXQLPSHGLPHQWRSDUDHOORJURGHVXVREMHWLYRV

Las personas manifestamos las emociones y los estados de ánimo a través de


WUHVVLVWHPDVGHUHVSXHVWDFRJQLWLYRÀVLROyJLFR\PRWRU

‡ El sistema cognitivo: responsable de la elaboración de los pensamientos.


 3RUHMHPSORSHQVDUTXHDQWHXQDGHWHUPLQDGDVLWXDFLyQLQHYLWD-
blemente vamos a perder el control.
34 AUTOGESTIÓN

‡ (O VLVWHPD ÀVLROyJLFR UHVSRQVDEOH GH ODV VHQVDFLRQHV \ UHDFFLRQHV


corporales del organismo.
 3RUHMHPSORODDOWHUDFLyQGHOULWPRFDUGLDFRRODVXGRUDFLyQH[FH-
siva son respuestas propias de un nivel de activación elevado.

‡ El sistema motor: responsable de los comportamientos directamente


observables.
 3RUHMHPSORHYLWDUXQDGLÀFXOWDGKXLUDQWHXQDVLWXDFLyQGHDQ-
siedad, o expresar críticas destructivas hacia otras personas.

Los tres sistemas anteriores no actúan de manera independiente sino que


HVWiQ LQWHUUHODFLRQDGDV \ KDFHQ TXH XQ VLVWHPD HMHU]D LQÁXHQFLD VREUH ORV
RWURV\DVHDHQVHQWLGRSRVLWLYRRQHJDWLYR3RUHMHPSORVLSLHQVR UHVSXHVWD
cognitiva) que voy a perder el control en una situación que me genera ansiedad,
aumentará mi frecuencia cardiaca, se alterará mi ritmo de respiración, sufriré
PDUHRV UHVSXHVWDÀVLROyJLFD \SUREDEOHPHQWHHYLWDUpDIURQWDUODVLWXDFLyQR
huiré de la misma (respuesta motora).

En consecuencia, el dominio de una de las anteriores respuestas incidirá en


HOPLVPRVHQWLGRVREUHHOUHVWR3RUHMHPSORVLHOLPLQDPRVRPLQLPL]DPRVORV
SHQVDPLHQWRVQHJDWLYRVQRVVHQWLUHPRVPHMRU\DFWXDUHPRVFRQPD\RUVHJXUL-
GDG\VHUHQLGDGORTXHQRVSURSRUFLRQDUiPHMRUHVUHVXOWDGRV

3RUWDQWRHODXWRFRQWUROVXSRQHODSXHVWDHQSUiFWLFDGHXQFRQMXQWRGH
estrategias que permiten gestionar cualquier tipo de respuesta negativa (pen-
samientos, sensaciones o acciones) que puedan incidir sobre la propia persona
RVREUHRWURVGHIRUPDGHVWUXFWLYD(ODXWRFRQWUROQRVSHUPLWHSHQVDUFRQREMH-
tividad, y separar en lo posible la razón de las emociones, por lo que nos ayuda
DDIURQWDUHÀFD]PHQWHFXDOTXLHUVLWXDFLyQ

Para ello es importante evitar reacciones impulsivas ante una situación que
produce ansiedad. Debe detenerse a pensar qué está sucediendo y por qué. De
esta forma logrará controlar sus reacciones y no dañar a otros.

3.2. Ayudas para la práctica

3.2.1. Mantener el control emocional

Utilice alguna técnica de autocontrol emocional para evitar reaccionar de


IRUPDDXWRPiWLFDRDJUHVLYD(OREMHWLYRGHHVWDVWpFQLFDVHVFUHDUXQDGLVWDQ-
cia entre las emociones hostiles provocadas por otra persona o por las conse-
cuencias desfavorables de una acción y la reacción impulsiva o contraataque
PROGRAMA DE ENTRENAMIENTO 35

TXHVHJXUDPHQWHUHVXOWDQRFLYDSDUDODUHODFLyQ\SDUDHOORJURGHHVRVREMH-
WLYRV3DUDHOOREDVWDFRQUHDOL]DUVHQFLOORVHMHUFLFLRVTXHOHSHUPLWDQDOHMDUVH
del enfado y de la ira y le faciliten pensar con claridad. La técnica escogida
dependerá del nivel de hostilidad o enfado generado por la situación. Podemos
emplear las siguientes: pausa y silencio, desviar la atención, parafrasear lo
~OWLPRTXHGLMRVXLQWHUORFXWRU\WRPDUVHXQGHVFDQVR

A. Pausa y silencio

Evite reaccionar de forma automática a cualquier comentario hostil, ataque


o amenaza. Tómese un tiempo y no canalice sus sentimientos hacia la acción.

‡ Pruebe a contar hasta diez y mantenga la mente en blanco.

‡ 5HVSLUHSURIXQGDPHQWH\DGRSWHXQDSRVWXUDUHODMDGD
‡ 5HWRPH GH QXHYR OD FRQYHUVDFLyQ \ PDQLÀHVWH XQD DFWLWXG SRVLWLYD
hacia su interlocutor.
 8WLOLFHH[SUHVLRQHVFRPR©%LHQFRQWLQXHPRV«ªHWF

B. Desviar la atención

En los casos en que se sienta dispuesto a reaccionar impulsivamente ante


ataques, amenazas, o situaciones que se interponen en la consecución de su
REMHWLYR UHDOLFH DFWLYLGDGHV TXH OH GLVWUDLJDQ \ TXH OH SHUPLWDQ GLVLSDU ODV
emociones negativas. De este modo logrará pensar con claridad. Simule que
busca algún papel en la cartera, levántese a abrir la ventana o haga que coloca
sus papeles si está conversando con otra persona.

Dos cosas son fundamentales:

‡ 1RPXHVWUHDODRWUDSHUVRQDVXPDOHVWDU'HVYtHODPLUDGDLQWHQWHQR
hacer visible su incomodidad.
 8WLOLFHH[SUHVLRQHVFRPR©3HUPtWDPHXQPRPHQWR«ª©&RQWLQ~H
VyOREXVFRǻ

‡ Retome la conversación amigablemente.


 'LJDSRUHMHPSOR©3HUGyQSRGHPRVFRQWLQXDUª

C. Repetir y parafrasear

&XDQGRVLHQWDTXHVXVHPRFLRQHVVRQORVXÀFLHQWHPHQWHLQWHQVDVFRPRSDUD
no poder controlarlas con una pausa o una distracción, mantenga durante unos
momentos su mente ocupada con otros pensamientos.
36 AUTOGESTIÓN

‡ No dé indicios de que se siente incómodo o irritado.

‡ Repita las últimas frases que ha dicho la otra persona con sus propias
palabras.
3RUHMHPSOR©6LQROHKHHQWHQGLGRPDOORTXHXVWHGTXLHUHGHFLU
HVǻ

‡ 'LULMDODFRQYHUVDFLyQKDFLDODE~VTXHGDGHXQDVROXFLyQ
 3RUHMHPSOR©7DOYH]SRGUtD«ª©6HUtDFRQYHQLHQWH«ª

D. Tomarse un descanso

Cuando se encuentre realmente furioso como consecuencia de los comenta-


rios hostiles o las continuas negativas de su oponente, y tema que puede llegar
a perder el control y actuar de forma irracional, contraatacando, o cediendo
impulsivamente a la postura de otra persona, tómese un descanso. Siga estos
FRQVHMRV

‡ 1R Gp LQGLFLRV GH GHELOLGDG EXVTXH XQ SUHWH[WR SDUD LQWHUUXPSLU OD
conversación.
 'LJDSRUHMHPSOR©6LQROHLPSRUWDPHJXVWDUtDWRPDUPHXQPR-
mento para refrescarme.»

‡ Solicite una pausa.


 3RUHMHPSORSXHGHGHFLU©/OHYDPRVKDEODQGRGHHVWHWHPDEDV-
WDQWHWLHPSR¢TXpOHSDUHFHVLKDFHPRVXQDSDXVDPLHQWUDVWRPD-
PRVXQFDIp"ª©6XDSRUWDFLyQHVUHDOPHQWHLQWHUHVDQWHQHFHVLWR
deliberar unos minutos, enseguida vuelvo».

‡ Cambie de tema. Intente variar el curso de la conversación con otro


asunto, contando una anécdota o un suceso irrelevante.

‡ (QHVWHGHVFDQVRDGPLQtVWUHVHPHQVDMHVGHiQLPRHLQVWUXFFLRQHVSR-
sitivas.
 3RUHMHPSOR©+HGHWUDQTXLOL]DUPHVLPHPDQWHQJRVHUHQRSRGUp
SHQVDUFRQFODULGDGǻ

3.2.2. Analizar los hechos separando la razón y la emoción

$QDOLFHODVLWXDFLyQSDUDGHVFULELUORRFXUULGRFRQREMHWLYLGDG3URFXUHTXH
VXVHPRFLRQHVQRLQWHUÀHUDQHQODYLVLyQGHODUHDOLGDG3DUDHOORVHKDGHLU
PROGRAMA DE ENTRENAMIENTO 37

SDVRDSDVRGHVFULEDORVKHFKRVLGHQWLÀTXHODVFDXVDV\SRU~OWLPRUHFRQR]FD
sus emociones y sustituya el pensamiento irracional.

A. Describir los hechos

3UHJ~QWHVH©¢4XpKDSDVDGRH[DFWDPHQWHHQODVLWXDFLyQSUREOHPiWLFD"ª

5HFXUUDDODREVHUYDFLyQGHOIHQyPHQRHQFXHVWLyQ©+DVXFHGLGRHVWRª<
descríbalo en términos de «hechos» no en términos de «emociones». Es impor-
tante que lo «describa», no que lo valore, ni que piense en por qué ha sucedido.
Lo primero es lo primero: describa los hechos.

%,GHQWLÀFDUODVFDXVDV

Piense por qué ha sucedido lo ocurrido: cuáles o cuál ha sido la causa prin-
cipal que lo ha generado.

Tenga mucho cuidado de no realizar atribuciones personales y estables


FRPRpVWDV©+DVXFHGLGRSRUTXHPHWLHQHPDQtDª©+DSDVDGRSRUTXHVR\PX\
torpe».

Profundice en la cuestión y trate de ver cuáles son las causas más plausibles:
©+DVXFHGLGRSRUTXHODRWUDSHUVRQDKDSUHSDUDGRPHMRUTXH\RODUHXQLyQª

(OHMHPSORVLJXLHQWHOHSXHGHD\XGDUDHQWHQGHUORTXHTXHUHPRVGHFLU

Suponga que va en coche a un hospital ubicado en una zona céntrica


de una gran ciudad en la que es difícil aparcar. Va a ver a un familiar
suyo que ha sido operado recientemente y se encuentra convaleciente,
pero en un estado general bueno y con un pronóstico favorable. Ve un
VLWLROLEUHSDUDGHMDUDKtVXFRFKH6HxDOL]DGHELGDPHQWH\VHGLVSRQH
a aparcar. Sin embargo, sin saber cómo, otro coche ha maniobrado muy
rápido y le ha «quitado» el sitio. Puede ver que en ese coche hay un
KRPEUHFRQGXFLHQGR\XQDPXMHUHPEDUD]DGDDVXODGR

 (QHVWDVLWXDFLyQSRGHPRVLGHQWLÀFDUGRVFDXVDVGHORVXFHGLGRD HO
conductor del otro vehículo es un maleducado y no respeta las normas
PiV HOHPHQWDOHV GH XUEDQLGDG E  HO FRQGXFWRU GHO RWUR FRFKH WHQtD
XQD UD]yQ SDUD KDFHU OR TXH KL]R VX PXMHU HVWi GH SDUWR \ QHFHVLWD
llegar lo antes posible al hospital.

C. Reconocer las emociones y sustituir el pensamiento irracional

Cuando algo no sale como esperábamos es normal y aceptable experimentar


un determinado grado de malestar. Sin embargo, muchas veces este sentimien-
to resulta desproporcionado si interpretamos lo sucedido con ideas irraciona-
38 AUTOGESTIÓN

OHVLGHDVTXHSRURWURODGRWRGDVODVSHUVRQDVPDQHMDPRV3RUHMHPSORXQD
persona que cree que no puede equivocarse nunca (idea irracional) ante un
error sentirá una desazón mayor que una persona que piensa que cualquiera
puede equivocarse.

Si somos conscientes de que estamos interpretando un hecho con una idea


LUUDFLRQDOSRGHPRVYDORUDUORRFXUULGRFRQPD\RUREMHWLYLGDG\PHQRUPDOHVWDU
además de que así estamos dando la posibilidad de un cambio positivo.

Sin embargo, las ideas irracionales están fuertemente arraigadas en nuestra


forma de pensar. Por eso no es fácil saber que las estamos utilizando y, mucho
menos, sustituirlas por un pensamiento racional y constructivo.

Las ideas irracionales pueden categorizarse dentro de siete tipos:

 3HQVDPLHQWRÀOWUDQWH6HWRPDQH[FOXVLYDPHQWHORVGHWDOOHVQHJDWLYRV\
VHPDJQLÀFDQVLQWHQHUHQFXHQWDORVDVSHFWRVSRVLWLYRVGHODVLWXDFLyQ

2. Pensamiento polarizado. Las cosas son blancas o negras. La persona ha


de ser perfecta, si no, es una persona fracasada. No hay término medio.

3. Sobregeneralización del pensamiento. Se extrae una conclusión general


de un incidente. Si ocurre algo malo en una ocasión, se esperará que
ocurra lo mismo una y otra vez.

4. Interpretación del pensamiento. Creemos saber qué sienten los otros y


por qué se comportan como lo hacen. Nos vemos capaces de adivinar lo
que sienten los demás acerca de nosotros.

 9LVLyQFDWDVWURÀVWD6HYDWLFLQDVHHVSHUD\VHWHPHLUUDFLRQDOPHQWH
el desastre. Suele ocurrir que una persona tiene conocimiento de un
SUREOHPD\HPSLH]DDGHFLUVH©¢<VLRFXUUHTXH"ª©¢<VLPHVXFHGH
DPt"ª

6. Personalización. Creemos que todo lo que la gente hace o dice es una


forma de reacción hacia nosotros. Nos comparamos con los demás,
intentando determinar quién es más elegante, quién es más brillante,
quién tiene un aspecto más saludable, etc.

7. Culpabilidad. A veces pensamos que los demás son responsables de


nuestro sufrimiento. También puede ser que adoptemos el punto de
vista opuesto y nos culpemos a nosotros mismos de los problemas
DMHQRV

/RVVLJXLHQWHVSDVRVOHD\XGDUiQDSRQHUHQPDUFKDXQSURFHGLPLHQWRHÀFD]
para el control de estas ideas irracionales.
PROGRAMA DE ENTRENAMIENTO 39

1. Céntrese en una situación que le haya generado emociones negativas o


HVWUHVDQWHV\GHVFUtEDODGHPDQHUDREMHWLYD ©TXpSDVyª 

 (VFULEDHQVXSURSLROHQJXDMHVXLQWHUSUHWDFLyQGHORVXFHGLGR ©SRU


qué sucedió así» $QRWHVXVMXLFLRVFyPRFUHHTXHIXHURQORVKHFKRV
\ VXV SURQyVWLFRV 'HVSXpV LGHQWLÀTXH DTXHOORV SHQVDPLHQWRV TXH VH
DVHPHMDQDDOJXQDVGHODVLGHDVLUUDFLRQDOHVGHVFULWDVDQWHULRUPHQWH

3. Exponga por escrito su respuesta emocional, y póngale una etiqueta


SRUHMHPSOR©FXOSDELOLGDGª 

 5HÁH[LRQHDFHUFDGHVXMXLFLR\WUDWHGHEXVFDUHYLGHQFLDVTXHGHPXHV-
tren que sus ideas irracionales no constituyen verdades absolutas.

5. Sustituya el pensamiento irracional por otro, ahora que lo ha examinado


\ FRPSDUDGR FRQ IRUPDV PiV UDFLRQDOHV GH SHQVDU 3RU HMHPSOR HV
PHMRUDIURQWDUHOSUREOHPDTXHKXLUGHpODXQTXHVHDGRORURVR

6. Compruebe cómo el acto de racionalizar lo ocurrido le hace sentirse


PHMRU\HPSUHQGHUXQDDFFLyQFRQVWUXFWLYD

8WLOL]DUXQOHQJXDMHQRDJUHVLYR

Por exceso, o por defecto, podemos resultar agresivos o pasivos cuando nos
comunicamos con los demás y ello tendrá una consecuencia en nuestros interlo-
cutores. La comunicación no agresiva se caracteriza porque se tienen en cuenta
los dos puntos de vista: el propio y el de los demás.

En la comunicación no agresiva expresamos con claridad aquello que pen-


samos o sentimos, pero sin caer en el error de creer que es la verdad absoluta
y que no existe otro punto de vista. La premisa de este tipo de comunicación
es: «Lo que yo pienso importa, y lo que tú piensas también me importa», o «Yo
expreso lo que pienso y te pido a ti que hagas lo mismo». Para aplicar este tipo
GHFRPXQLFDFLyQSXHGHXWLOL]DUHVWHFRQMXQWRGHVXJHUHQFLDV

‡ &UHDU ORV PHQVDMHV VLHPSUH HQ SULPHUD SHUVRQD \D TXH OD VHJXQGD
persona da impresión de agresividad.
Es preferible decir «No me ha gustado la forma que has tenido de
comportarte», que «No te has comportado bien».

‡ Utilice verbos como «creo» o «pienso».


Es preferible decir «Creo que debes redactar de nuevo el informe
ya que, en mi opinión, carece del rigor necesario», que «Este in-
forme está mal hecho. No tiene rigor. No vale».
40 AUTOGESTIÓN

‡ +DEOHGHOIXWXUR\QRGHOSDVDGRDQRVHUTXHGHEDGDUH[SOLFDFLRQHV
de algo ya ocurrido.
 (VSUHIHULEOHODIRUPDDVHUWLYD©/DSUy[LPDYH]HVPHMRUTXH«ªD
GHFLU©+DVFRPHWLGRHOPLVPRWLSRGHHUURUTXHODRWUDYH]ª

‡ +DEOHGHFRVDVFRQFUHWDV\QRJHQHUDOLFH
 (VSUHIHULEOHGHFLU©+DVROYLGDGROODPDUDO6U%Oi]TXH]ªTXHJH-
neralizar de esta manera: «Eres un desastre. Te olvidas de todo
siempre».

Las siguientes fórmulas son características de la comunicación agresiva, por


tanto, evite:

 +DFHU FUtWLFDV SHUVRQDOHV R JHQHUDOHV TXH QR VH UHÀHUDQ D DVSHFWRV


FRQFUHWRV3RUHMHPSOR©(UHVXQFKDSX]Dª©(VWHWUDEDMRQRHVWiELHQ
porque no».

 +DEODUHQWpUPLQRVDEVROXWRV©Siempre llegas tarde», «Nunca entregas


las cosas a tiempo», «Nada ha resultado como queríamos».

- No ofrecer alternativas adecuadas. Sólo criticar de forma negativa, no


constructiva.

- Emplear un tono de voz agresivo, postura rígida y expresión de enfado.

- Realizar amenazas contra la integridad y competencia de la otra persona.


PROGRAMA DE ENTRENAMIENTO 41

3.3. Resumen

No permita que sus emociones le hagan reaccionar de manera impulsiva y/o


destructiva. Recuerde las siguientes claves para el desarrollo del autocontrol:

‡ Utilice las técnicas de autocontrol emocional para evitar reaccionar


impulsivamente. Recuerde: pausa y silencio, desviar la atención,
repetir y parafrasear o incluso solicitar una demora.

‡ $QDOLFH OD VLWXDFLyQ GH IRUPD REMHWLYD \ QR VH GHMH OOHYDU SRU ODV
HPRFLRQHV R SRU SHQVDPLHQWRV LUUDFLRQDOHV 3UHJ~QWHVH ©¢4Xp KD
VXFHGLGR H[DFWDPHQWH HQ OD VLWXDFLyQ SUREOHPiWLFD"ª 5HFXUUD D OD
REVHUYDFLyQGHOIHQyPHQRHQFXHVWLyQ©+DVXFHGLGRHVWRª

‡ Evite la comunicación agresiva. Tenga en cuenta su punto de vista y el


de los demás. Exprese con claridad aquello que piensa y siente, pero
sin caer en el error de estimar que es la verdad absoluta y que no existe
otra perspectiva.

En suma, antes de actuar controle sus emociones para comportarse como


desea y alcanzar aquello que se propone.
4

ASERTIVIDAD
4. ASERTIVIDAD

4.1. Descripción de la habilidad

La asertividad es aquel estilo de comunicación que permite a una persona


FRQVHJXLUHOREMHWLYRGHODFRPXQLFDFLyQGHPDQHUDHIHFWLYDHVGHFLUVLQKD-
cer daño a otros ni a sí mismo. Está por ello considerada como una habilidad
de comunicación interpersonal o interacción social de gran importancia. Ser
DVHUWLYRVLJQLÀFDGHFLUORTXHVHSLHQVDVLQGDxDUORVVHQWLPLHQWRVRSLQLRQHV\
creencias de los demás, sin ofenderlos. El estilo asertivo, a diferencia del pasi-
YRRHODJUHVLYRFRQVLJXHVXÀQDOLGDGDOPLVPRWLHPSRTXHSUHVHUYDODUHODFLyQ
con el interlocutor.

En la práctica, la asertividad se asocia a la expresión de críticas construc-


tivas, al derecho a decir «no» ante demandas a las que no queremos acceder y
a la habilidad para hacer peticiones. La asertividad hace a una persona social-
mente competente, pues le permite transmitir con habilidad opiniones, inten-
ciones, posturas, creencias y sentimientos.

Para lograr ser asertivo hay que llevar a cabo una serie de estrategias de
comunicación, verbales y no verbales. Estas estrategias sirven para alcanzar los
VLJXLHQWHVFXDWURREMHWLYRVFDUDFWHUtVWLFRVGHODFRPXQLFDFLyQDVHUWLYD

 (ÀFDFLDHVWRHVFRQVHJXLUDWUDYpVGHODFRPXQLFDFLyQDTXHOORTXHXQR
se propone.
46 AUTOGESTIÓN

 6HJXULGDG\FRQÀDQ]DHQXQRPLVPR3RUHMHPSORQRVHQWLUVHLQFyPR-
do al hacer una petición o al decir que «no» cuando nos solicitan algo
que no consideramos razonable.

 3UHVHUYDU OD UHODFLyQ FRQ HO RWUR &XDQGR VH SRQH GH PDQLÀHVWR XQ
FRQÁLFWRGHLQWHUHVHVODFRPXQLFDFLyQDVHUWLYDORJUDRFDVLRQDUODVPt-
nimas consecuencias negativas para uno mismo, para el otro y para la
mutua relación en el futuro.

4. Establecer relaciones positivas con los demás, en casos de aceptación


asertiva, es decir, de admisión de elogios y cumplidos.

Podemos distinguir dos grupos de habilidades:

‡ +DELOLGDGHVGHaceptación asertiva. Desarrollan la capacidad para ofre-


cer y recibir reconocimientos. En este sentido, la habilidad facilita que
se repita el comportamiento elogiado en el futuro.

‡ +DELOLGDGHVGHoposiciónDVHUWLYD6RQDTXHOODVTXHPDQHMDQFRPSRU-
tamientos poco razonables de los demás. Por tanto, el efecto buscado
es que el otro desista de mantener su conducta, o bien la disminución
de su frecuencia. Es en este segundo grupo de habilidades sobre el que
nos centraremos más adelante.

6LKDEODPRVGHDVHUWLYLGDGFRPRHVWLORHÀFLHQWHGHFRPXQLFDFLyQWHQHPRV
TXHFLWDUORVRWURVSRVLEOHV HODJUHVLYR\HOSDVLYR TXHUHVXOWDQLQHÀFDFHVHQ
FXDQWRDGRVYDULDEOHVODFRQVHFXFLyQRQRGHOREMHWLYRGHODFRPXQLFDFLyQ\
la relación con la otra persona.

El estilo agresivo prepondera el punto de vista de uno mismo sobre el de


ODRWUDSHUVRQD3RUWDQWRORJUDVXREMHWLYRSHURQRFRQVLJXHVDOYDJXDUGDUOD
relación con el interlocutor.

El estilo pasivo hace prevalecer siempre la postura de los demás sobre la de


uno mismo. Entonces, y por el contrario, mantiene la relación con el otro, pero
a costa de que prevalezca el punto de vista de nuestro interlocutor.

6yORFXDQGRVHFXPSOHQORVGRVFULWHULRV FRQVHJXLUHOREMHWLYR\PDQWHQHU
o fortalecer la relación) se habla de asertividad en la comunicación.

(QODWDEODTXHYLHQHDFRQWLQXDFLyQVHSHUÀODQORVWUHVHVWLORVGHFRPXQL-
cación en relación con las dos variables comentadas.
PROGRAMA DE ENTRENAMIENTO 47

/2*5$5(/ 0$17(1(5/$
2%-(7,92 5(/$&,Ð1

3$6,92 12 6Ì

$*5(6,92 6Ì 12

$6(57,92 6Ì 6Ì

Estilos de comunicación

6LVHWLHQGHDVHUDJUHVLYRVHFRPXQLFDUiQORVPHQVDMHVSHUVHYHUDQGRHQXQ
enfoque, el propio, y subordinando todo lo demás a éste: «Lo que yo pienso es
lo que es».

El estilo agresivo no tiene en cuenta ni las opiniones, ni los sentimientos de


los demás. Es una negativa a la experiencia de los otros y a su punto de vista.
La consecuencia de ello es que puede surgir una relación de dominio sobre los
GHPiV\QRXQDFRPXQLFDFLyQÁXLGD

En el estilo pasivo, que sólo tiene en consideración la perspectiva de los de-


más, toda percepción propia queda supeditada a la lógica de: «Lo que yo opino
no importa» o «Lo verdaderamente importante es lo que los demás piensen».
El resultado es que se obtiene una relación de sumisión a los demás, y no una
relación equilibrada. En éste, la comunicación pasiva no permite aportar valor a
la comunicación ya que no se produce un verdadero intercambio de posiciones.

(OHVWLORDVHUWLYRHVHOPiVDGHFXDGRSDUDWUDQVPLWLUXQPHQVDMH\WDPELpQ
para que los receptores comprendan qué es exactamente lo que queremos decir.
$GHPiVIDYRUHFHTXHQXHVWURLQWHUORFXWRUPDQLÀHVWHLJXDOPHQWHVXRSLQLyQ

La asertividad se caracteriza porque en ella se tienen en cuenta los dos pun-


tos de vista: el propio y el de los demás. De este modo, somos capaces de ex-
presar con claridad aquello que pensamos o sentimos, pero sin caer en el error
de estimar que es la verdad absoluta y que no existe otro punto de vista: «Lo
que yo pienso importa y lo que tú piensas también me importa» o «Yo expreso
lo que pienso y te pido a ti que hagas lo mismo». La consecuencia inmediata de
este tipo de comunicación es que enriquece a ambos interlocutores.

En la próxima tabla se resumen las principales características de la comu-


nicación verbal y no verbal para los tres estilos, así como los efectos sobre la
persona y los demás.
48 AUTOGESTIÓN

PASIVO ASERTIVO AGRESIVO

INFORMACIÓN: INFORMACIÓN: INFORMACIÓN:


Demasiado poca, demasia- /DVXÀFLHQWHHQHOPRPHQ- Demasiada, demasiado
do tarde o nunca. to correcto. pronto, demasiado tarde.

CONDUCTA NO VERBAL: CONDUCTA NO VERBAL: CONDUCTA NO VERBAL:


2MRVKDFLDDEDMRYDFLOD- Contacto ocular directo, 0LUDGDÀMDHQIUHQWDPLHQ-
ciones, postura hundida, registro de habla conversa- to, gestos de amenaza,
movimiento excesivo de FLRQDOJHVWRVÀUPHVSRV- postura intimidatoria, men-
manos, risas nerviosas. WXUDHUHFWDKDEODÁXLGD VDMHVLPSHUVRQDOHV9R]
tono de voz adecuado. DOWDKDEODÁXLGDUiSLGD

CONDUCTA VERBAL: CONDUCTA VERBAL: CONDUCTA VERBAL:


©4XL]iVª©6XSRQJRª©0H ©3LHQVRª©6LHQWRª©4XLH- ©+DUtDVPHMRUHQ«ª
pregunto si...», «Te impor- URª©+DJDPRVª©&yPR «haz», «ten cuidado»,
WDUtDPXFKRVL«ª©5HDO- podemos resolver esto», «debes estar bromeando»,
mente no es importante», ©4XpSLHQVDVª©4XpWH «si no lo haces», «no sa-
«No te molestes». parece». bes», «deberías», «mal».

EFECTOS: EFECTOS: EFECTOS:


&RQÁLFWRVLQWHUSHUVRQDOHV Resuelve los problemas, &RQÁLFWRVLQWHUSHUVRQDOHV
desamparo, imagen pobre se siente a gusto consigo hace daño a los demás,
de sí mismo, pérdida de mismo y con los demás. pérdida de control, ten-
oportunidades, tensión. 6DWLVIHFKRUHODMDGR sión, soledad.

Características de los estilos de comunicación

4.2. Ayudas para la práctica

4.2.1. Evitar decir «sí» cuando se quiere decir «no»

En determinadas situaciones alguien puede intentar transgredir sus dere-


FKRVSHUVRQDOHVSRUHMHPSORHOGHUHFKRDGLVSRQHUOLEUHPHQWHGHVXWLHPSR
libre, o el derecho a su intimidad. Alguien puede pedirle algo que a usted
le consta que tendría que decir «no», y, a pesar de ello, accede, sintiéndose
después culpable por haberlo hecho. En estos casos se dice que esta persona
intenta «manipularle».
PROGRAMA DE ENTRENAMIENTO 49

(OSULPHUSDVRSDUDSRGHUGHFLU©QRªHVLGHQWLÀFDUHQODFRQGXFWDGHORWUR
ODVWiFWLFDVTXHXWLOL]DSDUDFRQVHJXLUTXHDFFHGDDVXSHWLFLyQ+DELWXDOPHQWH
cuando una persona trata de manipular a otra efectúa estos comportamientos:

‡ +DFHUFDVRRPLVRFXDQGRXVWHGVHQLHJDDDFFHGHUDVXSHWLFLyQ
‡ Debatir y cuestionar las razones que se esconden tras su negativa para
WUDWDUDVtGHFRPEDWLUODPHMRU

‡ +DFHUOHFKDQWDMHHPRFLRQDOH[FODPDQGRH[SUHVLRQHVFRPR©2KDFHV
HVWRRHUHVǻ

‡ Realizar una valoración negativa de la persona a quien intenta manipular.

Cuando perciba alguna de estas situaciones, evite ser manipulado, evite de-
FLU©VtªFXDQGRGHEDGHFLU©QRª3DUDHOORSXHGHSRQHUHQMXHJRODVVLJXLHQWHV
tácticas de asertividad:

 (VWpDOHUWD+DJDXQHVIXHU]RSRUVDEHUVLVXLQWHUORFXWRUHVWiXWLOL]DQGR
las tácticas anteriores.

 6HD ÀUPH \ UHLWHUH OD QHJDWLYD 6X LQWHUORFXWRU GHEH HQWHQGHU TXH
por mucho que insista, su posición es inamovible. Atrévase a decir que
«no» tantas veces como sea necesario. No se sienta incómodo, entienda
que la otra persona está también en su derecho de ser insistente. Pero
recuerde que usted sabe que también tiene el derecho de decir «no».

3. Desarme a su interlocutor. Trate de que su interlocutor se quede


sin recursos haciéndole ver el intento de manipulación que está
HPSOHDQGR([SUpVHOHORTXHHVWiSDVDQGR+iJDOHHQWHQGHUTXHVDEH
que su demanda es importante para él pero que usted ya ha decidido y
la respuesta es «no».

 0DQWHQJD OD DFWLWXG GH SXQWR \ ÀQDO 6L WRGR OR DQWHULRU QR KD GDGR
UHVXOWDGR LQWHQWH XQD VROXFLyQ ÀQDO ©<D HVWi ELHQª ©1R TXLHUR
seguir hablando de este asunto», «Mi posición es no». Puede resultar
H[DJHUDGDPHQWHÀUPHSHURHVPX\HIHFWLYD7DQWRPiVHIHFWLYDHVOD
estrategia cuanto menos agresiva es la forma en la que transmitimos el
PHQVDMH$VtHYLWDUHPRVTXHQXHVWURLQWHUORFXWRUSLHQVHTXHGHFLPRV
«no» porque estamos enfadados, cuando en realidad decimos «no»
convencidos de que es «no».
50 AUTOGESTIÓN

4.2.2. Demandar sin atacar

Todos necesitamos cosas de los demás. Demandar no ha de suponer atacar


al otro. Nuestro interlocutor tiene que entender perfectamente que nuestra
petición no es una exigencia agresiva. Los pasos siguientes pueden ayudar para
realizar una petición de forma asertiva:

1. Llamar al interlocutor por su nombre.


2. Expresar lo de que demanda claramente.
3. Explicar las razones que le llevan a realizar su petición.
4. Invitar a hacer comentarios.
5. Preguntar si necesita algo para cumplir la petición.
6. Acordar los detalles de cuándo o cómo se llevará a cabo, o cuándo
necesitará lo que ha solicitado.
 3RUHMHPSOR  $QD  QHFHVLWRTXHPHKDJDVXQLQIRUPHGHYHQWDV
del 2004. (3) Me lo ha solicitado la dirección para la reunión de mañana
\\RHVWDUpIXHUDWRGRHOGtD  ¢4XHWHSDUHFH"  $YtVDPHVLQHFHVLWDV
ayuda o alguna información. (6) Por favor, envíamelo por correo antes
de las diez.

Recuerde que para hacer peticiones de manera asertiva y conseguir lo que


TXHUHPRVVLQGDxDUODUHODFLyQFRQRWUDSHUVRQDHOOHQJXDMHXWLOL]DGRFXPSOH
una función vital: la de no parecer agresivo. Por ello tenga en cuenta que
debe expresar sus deseos o necesidades con fórmulas similares a «Me gustaría
que...», «Te necesito para...». Igualmente debe evitar disculparse con expre-
siones como «Siento tener que pedirte esto, pero...», «Si no te importase de-
masiado, me harías un favor si...». Tenga claro que usted está en su derecho de
realizar la petición.

4.2.3. Realizar críticas constructivas

Realizar críticas a otras personas acerca de su comportamiento es una for-


PDGHHQVHxDUOHVDPHMRUDUVXDFWXDFLyQGHFDUDDOIXWXUR(VXQHMHUFLFLRTXH
hacemos habitualmente y, sin embargo, en la mayoría de las ocasiones la per-
VRQDTXHUHFLEHODFUtWLFDVHVLHQWHPDOSRUTXHQRH[SUHVDPRVQXHVWURMXLFLRGH
manera constructiva.

3DUDTXHXQDSHUVRQDVHDUHFHSWLYDDVXPHQVDMH RIUH]FDfeedback o «re-


troalimentación») y tenga en cuenta su opinión, es necesario que formule su
PROGRAMA DE ENTRENAMIENTO 51

PHQVDMHFRQVLGHUDQGRORVVLJXLHQWHVDVSHFWRVFRQFUHFLyQFRQVHFXHQFLDVDO-
ternativas y coherencia.

1. Concreción. En su valoración de la otra persona céntrese en hechos


FRQFUHWRV1RHPLWDXQMXLFLRGHLGHQWLGDGJHQHUDOSDUDHOORH[FOX\D
el uso del verbo «ser» en oraciones como «Eres un desordenado» y
evite expresiones del tipo «No haces bien nada». Precise, dígales lo
que han hecho («Los apartados del informe que has redactado no están
correctamente ordenados»). Recuerde: céntrese en hechos concretos,
\DTXHHVORTXHVHSXHGHPRGLÀFDU

2. Consecuencias. Ofrezca a su interlocutor un panorama de las conse-


cuencias de su conducta. Es decir, explique lo que ha conseguido con su
actuación. De manera tal que a la otra persona le quede claro cuáles
han sido las consecuencias de su conducta («El texto del informe no se
puede comprender, y entonces la directiva no aceptará el proyecto»).

3. Alternativas. Ofrezca ayuda a su interlocutor a través de las alternati-


YDVGHPHMRUD'LJDFRQH[DFWLWXGFyPRFUHHTXHVHSXHGHFRPSRUWDU
su interlocutor en el futuro para lograr unas consecuencias positivas
(«Puedes seguir el esquema o las pautas que concluimos en la reunión,
\DQWHVGHYROYHUDUHGDFWDUORPHSXHGHVSHGLUFRQVHMRª 

 &RKHUHQFLD6HDFRKHUHQWHHQVXDFWLWXG\TXHVXPHQVDMHQRYHUEDO
no contradiga al oral. Comunique lo mismo con las palabras que con su
mirada, su postura, etcétera. De nada vale comentarle a alguien que
estamos muy interesados en ayudarle si no le miramos a la cara para
decírselo, o si se lo decimos al mismo tiempo que estamos haciendo
otra actividad diferente. Recuerde el comportamiento no verbal carac-
terístico de la comunicación asertiva descrito en la tabla de estilos de
comunicación.
52 AUTOGESTIÓN

4.3. Resumen

$GRSWHXQHVWLORGHFRPXQLFDFLyQDVHUWLYRSDUDHODERUDUVXVPHQVDMHVWDQ-
to para oponerse como para aceptar el comportamiento de otros.

Recuerde que las expresiones asertivas se caracterizan porque tienen en


cuenta los dos puntos de vista de toda comunicación: el propio y el de los de-
PiV(VGHFLUSHUVLJDFRQÀUPH]DVXREMHWLYRSHURPDQWHQLHQGRRIRUWDOHFLHQ-
do una relación positiva con su interlocutor.

'HÀHQGDVLHPSUHVXVGHUHFKRVSHURSUHVHUYHDODYH]ORVGHVXLQWHUORFXWRU

1. Decir «no». Diga «no» a peticiones no razonables sin sentirse culpable


por ello.
 +DFHUSHWLFLRQHV6ROLFLWHORTXHQHFHVLWDGHPDQHUDHIHFWLYDVLQUHVXO-
tar agresivo.
3. Realizar críticas. Exponga aquello con lo que no esté conforme acerca de
la conducta de otros, hágalo de forma constructiva aunque expresando
ÀUPHPHQWHVXRSRVLFLyQ
$SOLTXHHQVXVPHQVDMHVODVFXDWURIyUPXODVDVHUWLYDV

 8VDU OD SULPHUD SHUVRQD ([SUHVH VXV PHQVDMHV VLHPSUH HQ SULPHUD
persona de modo que transmitan implicación por su parte: «Opino», «A
mi entender».
 +DEODUGHVGHODRSLQLyQSHUVRQDO(PSOHHQHFHVDULDPHQWHYHUERVFRPR
«creo» o «pienso: «Creo que debes redactar de nuevo el informe ya
que, en mi opinión, carece del rigor necesario».
 +DEODUGHDOWHUQDWLYDVSDUDHOIXWXUR3RUHMHPSOR©/DSUy[LPDYH]HV
PHMRUTXHǻ
 6HU FRQFUHWR UHÀpUDVH D FRVDV \ KHFKRV HVSHFtÀFRV SDUD TXH HO
LQWHUORFXWRUVHSDFXiOHVH[DFWDPHQWHHOSUREOHPD3RUHMHPSOR©+DV
olvidado llamar al Sr. Blázquez».
5

EMPATÍA
5. EMPATÍA

5.1. Descripción de la habilidad

/DSDODEUD©HPSDWtDªSURYLHQHGHOJULHJR\VLJQLÀFD¶VLPSDWL]DU·¶VHQWLUHQ
FRP~Q·6HGHVFULEHFRPRODFDSDFLGDGGHXQDSHUVRQDSDUDLGHQWLÀFDUVHFRQOR
TXHRWUDVLHQWHORFXDOOOHYDDXQDPHMRUFRPSUHQVLyQGHVXFRPSRUWDPLHQWRR
de su manera de tomar decisiones.

En ocasiones se confunde la empatía con tener que estar de acuerdo con lo


que piensa, siente o dice la otra persona. Esto no es exactamente así. La em-
patía se relaciona con entender cómo se siente el otro y hacérselo ver, sin que
HOORVLJQLÀTXHWHQHUTXHGHPRVWUDUDFXHUGR

No es necesario pasar por las mismas experiencias que los demás para poder
HQWHQGHUORV/RLPSRUWDQWHHVVHUFDSDFHVGHFDSWDUWDQWRORVPHQVDMHVYHUED-
les como los no verbales que alguien nos quiere transmitir. Al mismo tiempo, es
también relevante que nuestro interlocutor se sienta comprendido de manera
única y especial. En este sentido, la empatía se demuestra activamente a tra-
YpVGHODVH[SUHVLRQHVYHUEDOHVSRUHMHPSOR©(QWLHQGRFyPRWHVLHQWHVª©0H
SRQJRHQWXOXJDUª<WDPELpQDWUDYpVGHVHxDOHVQRYHUEDOHVFRPRSRUHMHP-
plo la mirada, el contacto, la sonrisa o sencillamente asintiendo con la cabeza.
No basta con entender a la otra persona sino que hay que demostrárselo con
nuestros gestos y nuestra actitud.
56 AUTOGESTIÓN

La empatía es una habilidad de autogestión muy valiosa para el desarrollo


de las relaciones personales y, por tanto, sirve de apoyo social. Las personas
que se comportan con empatía se muestran abiertas a los sentimientos y preo-
FXSDFLRQHVGHORVGHPiV(VWROHVKDFHVHUÁ
GHORVGHPiV(VWROHVKDFHVHUÁH[LEOHV\UHFHSWLYDVDODFRPXQLFD-
H[LEOHV\UHFHSWLYDVDODFRPXQLFD
ción, por lo que obtienen de los demás su apoyo y ayuda.

En suma, supone una herramienta esencial de comunicación, ya que a todos


nos gusta sentir que se nos escucha con atención y se nos comprende, pues esto
SURSRUFLRQDFRQÀDQ]DHQXQRPLVPR\VHJXULGDGSDUDDFWXDU

Es importante que reconozca las barreras más frecuentes que suelen impe-
dir este acercamiento entre las personas. Se trata básicamente de errores de
percepción:

‡ La tendencia a restar importancia a lo que preocupa al otro y a


«subestimar» sus sentimientos.

‡ 3UHVWDU DWHQFLyQ FRQ MXLFLRV SUHFRQFHELGRV \ SHUPLWLU TXH QXHVWUDV


LGHDVSUHYLDV\QXHVWUDVFUHHQFLDVLQÁX\DQDODKRUDGHLQWHUSUHWDUOR
que les ocurre a los demás.

‡ Juzgar a la otra persona e invalidar su capacidad para reaccionar. Res-


ponderle con frases así: «Lo que has hecho está mal», «De esta forma
no vas a conseguir nada».

‡ Animar sin más, sin verdadera compasión, con expresiones como «No te
preocupes, el tiempo lo cura todo».

‡ Atribuirse cierta superioridad por haber pasado por las mismas expe-
riencias y haber superado el acontecimiento: «Mira, lo mío fue peor y
conseguí superarlo».

Estas barreras resultan destructivas, ya que bloquean la comunicación con


la otra persona. La clave está en salirse de uno mismo y comprender el contexto
del otro, adentrarse en su situación («ponerse en su piel») para observar cómo
se ven las cosas desde otro punto de vista.

Por tanto, el primer paso para desarrollar la empatía es adoptar una actitud
abierta, predispuesta al entendimiento.

La empatía se expresa a través de tres comportamientos clave:

1. Escuchar activamente.
Consiste en demostrar a la otra persona que le estamos atendiendo y
comprendiendo, que estamos interesados en lo que nos está contando.
La atención se demuestra a través de señales verbales y no verbales. En
PROGRAMA DE ENTRENAMIENTO 57

ODFRPXQLFDFLyQYHUEDOSRUHMHPSORVHSLGHQGHWDOOHVRDFODUDFLRQHV
se asiente de vez en cuando. Complementariamente, las señales no
YHUEDOHVSXHGHQVHUSRUHMHPSORHOFRQWDFWRRFXODU\ODRULHQWDFLyQGHO
cuerpo hacia el interlocutor.

2. Explorar mediante preguntas el punto de vista del otro.


La empatía implica ir más allá de lo evidente e indagar los motivos,
los intereses, las necesidades, etc., que hacen a una persona actuar o
pensar de una manera determinada. A través de esas preguntas vamos
a obtener información relevante, al tiempo que facilitamos la comuni-
cación abierta y sincera con nuestro interlocutor.

3. Motivar hacia el cambio.


Para motivar un cambio ha de ayudar a la otra persona a reconocer
sus cualidades haciéndole ver sus logros anteriores. La empatía consis-
WHWDPELpQHQGHPRVWUDUDORWURTXHFRQÀDPRVHQVXFDSDFLGDGSDUD
afrontar una situación desfavorable. De esta forma le ayudamos a abor-
GDU HO SUREOHPD GHVGH QXHVWUD REMHWLYLGDG VLUYLpQGROH GH JXtD HQ HO
SURFHVRGHSODQLÀFDFLyQGHODDFFLyQ&RQHVWRSRWHQFLDPRVVXPRWLYD-
FLyQ\ODFRQÀDQ]DHQVtPLVPR

Resumiendo, las demás personas tienen puntos de vista y reacciones diferen-


tes a las nuestras. Es esencial, pues, tener una buena predisposición para aceptar
la diversidad humana: VHUWROHUDQWHV\ÁH[LEOHV con los que nos rodean. Es ésta
la actitud más segura para entender lo que subyace en la conducta de los demás,
más allá de los hechos evidentes y observables. Las estrategias para desarrollar
la empatía están relacionadas con la capacidad para entender a los demás, para
comprender los intereses, sentimientos y pensamientos que están detrás del com-
portamiento manifestado por la otra persona.

5.2. Ayudas para la práctica

5.2.1. Demostrar interés y atención

/DHVFXFKDDFWLYDHVHOSURFHVRPHGLDQWHHOFXDOHOUHFHSWRUGHOPHQVDMH
atiende y comprende al interlocutor y además se lo demuestra, ya sea median-
te señales verbales o no verbales.

La persona que escucha activamente le dice al emisor lo que éste ha ex-


SUHVDGR GHVWDFDQGR HO VHQWLPLHQWR TXH FRQWHQtD HO PHQVDMH (V LPSRUWDQWH
58 AUTOGESTIÓN

subrayar que hemos entendido no únicamente lo que nos ha dicho nuestro in-
terlocutor sino también lo que siente. Aunque comprendamos las emociones
GHODRWUDSHUVRQDHVWRQRVLJQLÀFDTXHWHQJDPRVTXHHVWDUGHDFXHUGRFRQOR
que dice o piensa. En la escucha activa se puede hablar, es más, constituye un
elemento clave, pero no se debe interrumpir y no se le ha de restar a la otra
persona el «protagonismo» de la historia.

En la escucha activa se han de utilizar comportamientos verbales y no verbales:

A. Comportamientos verbales

‡ Aportar comentarios sobre el tema tratado.

‡ Formular preguntas aclaratorias.


 3RUHMHPSOR©¢$TXpWHUHÀHUHVH[DFWDPHQWHFRQ"ª©¢3XHGHV
SRQHUPHXQHMHPSORFRQFUHWRGH"ª

‡ 3DUDIUDVHDU +DFHU SHTXHxRV UHV~PHQHV R VtQWHVLV FRQ ODV SDODEUDV


HPSOHDGDV SRU HO RWUR PRVWUDQGR LQWHUpV \ GHVHR GH YHULÀFDU TXH VH
está entendiendo.
3RUHMHPSOR©6LWHKHFRPSUHQGLGRELHQORTXHTXLHUHVGHFLUHVª

‡ Asentir. Puede asentir con monosílabos y expresiones como «Ya... »,


«Entiendo...».

‡ Decir frases que hagan ver que es capaz de ponerse en su situación.


 3RUHMHPSOR©,PDJLQRFyPRWHVLHQWHVª©0HSRQJRHQWXOXJDUª
«Me hago cargo», etc.

‡ Emplear expresiones para favorecer la comunicación abierta.


3RUHMHPSOR©7HHVFXFKRª©¢<HQWRQFHV"ª©3URVLJXHSRUIDYRUª

B. Comportamientos no verbales

‡ 0LUDUDORVRMRVGHOLQWHUORFXWRU
‡ Orientar la postura hacia el que habla y evidenciar una actitud de
DFHUFDPLHQWRUHODMDGD\DELHUWDDODFRPXQLFDFLyQ
‡ Crear un clima agradable. Utilice la sonrisa para invitar a la comunicación
y suavizar tensiones.
‡ $VHQWLUFRQODFDEH]D\FRQH[SUHVLRQHVFRPR©$Mi«ª©<D«ª
‡ 0RVWUDUXQDH[SUHVLyQFRQJUXHQWHFRQHOFRQWHQLGRGHOPHQVDMHGHVX
interlocutor: sorpresa, tristeza, alegría, etc.
PROGRAMA DE ENTRENAMIENTO 59

 $OJXQDVUHJODVEiVLFDVSDUDPHMRUDUODHVFXFKDDFWLYDVRQ

‡ Tomarse el tiempo necesario para escuchar al otro.


‡ /LEHUDUVH GH WRGR MXLFLR LQLFLDO $FHSWDU DO RWUR WDO \ FRPR HV VLQ
LQWHQWDU©MX]JDUORª
‡ Concentrarse en prestar atención, evitar distracciones que perturben la
FRPXQLFDFLyQ SRUHMHPSORHOWHOpIRQR 
‡ No interrumpir al interlocutor.
‡ No anticipar conclusiones.
‡ Preguntar, pedir detalles, aclaraciones y resumir el contenido esencial.

5.2.2. Tener predisposición para comprender

En toda comunicación es muy importante que mostremos predisposición a


HQWHQGHUHOSXQWRGHYLVWDGHQXHVWURLQWHUORFXWRU+D\TXHH[DPLQDU\FRP-
SUHQGHUXQFRQMXQWRGHHPRFLRQHVVHQWLPLHQWRV\SHQVDPLHQWRVTXHKD\WUDV
el comportamiento observable de la otra persona. Indagando podremos pro-
fundizar en otros pormenores de la situación. Además, hacer preguntas sobre
lo que se está hablando es una buena estrategia para demostrar que se está
escuchando y que se tiene interés. Es una forma de obtener más información o
aclarar dudas y también ayuda a quien habla, y a nosotros, a concretar el tema.

(QGHÀQLWLYDLQWHUYHQLU VLQLQWHUUXPSLU HQODFRQYHUVDFLyQFRQXQDSUH-


gunta es lo más indicado para hacer ver que estamos interesados en lo que
nuestro interlocutor expresa.

Para ello, en primer lugar, haga evidente su capacidad de comprensión y, en


segundo lugar, focalice la postura del otro.

Para demostrar que entiende cómo se siente el otro emita expresiones


FRPR©<DYHRTXH«ª©6HWHYHSUHRFXSDGRSRU«ª©,PDJLQRTXHWHVLHQWHV«ª
©(QWLHQGRTXH«ª

Para centrarse en el punto de vista de su interlocutor pregúntele, vaya des-


GHORPiVJHQHUDODORPiVFRQFUHWR$OJXQRVHMHPSORVVRQ

‡ Preguntas abiertas, para iniciar una conversación.


 3RU HMHPSOR ©¢&yPR RFXUULy"ª ©¢4Xp RFXUULyVXFHGLy"ª ©¢4Xp
WDOIXH«"ª
60 AUTOGESTIÓN

‡ 3UHJXQWDVFHUUDGDVSDUDLUGHORJHQHUDODORHVSHFtÀFR\SUHFLVDUOD
información.
 3RUHMHPSOR©¢4XpTXLHUHVGHFLUH[DFWDPHQWHFRQ«"ª
‡ 3UHJXQWDVGHÀQDODELHUWRSDUDDQLPDUDFRQWLQXDUODFRQYHUVDFLyQ
 3RUHMHPSOR©¢4XpSDVyDFRQWLQXDFLyQ"ª
‡ Preguntas aclaratorias.
 3RUHMHPSOR©¢&yPRFUHHVTXHHVWRD\XGDUtDD"ª
‡ 3UHJXQWDVTXHVXVFLWDQUHÁH[LyQ
 3RUHMHPSOR©¢&XiOHVFUHHVTXHVRQODVFDXVDVGH"ª
‡ Preguntas que fomentan la generación de ideas.
 3RUHMHPSOR©¢&XiOHVVRQODVYHQWDMDV\GHVYHQWDMDVGH"ª
‡ Preguntas que devuelven el protagonismo al receptor.
 3RUHMHPSOR©¢&XiOHVWXSURSLDRSLQLyQ"ª
‡ Preguntas que incitan a la acción.
 3RUHMHPSOR©¢&yPRSRGUtDPRVPHMRUDUORVUHVXOWDGRVGH"ª

Le proponemos a continuación estas recomendaciones para lograr preguntas


útiles:

1. Utilice las preguntas abiertas para facilitar la comunicación, pero no


convierta la conversación en un interrogatorio, ni fuerce al interlocutor
DGDUXQDUHVSXHVWD&HGDXQWLHPSRSDUDODUHÁH[LyQ
 5HDOLFH SUHJXQWDV EUHYHV FODUDV \ FRQFUHWDV +DJD ODV FXHVWLRQHV GH
una en una, y nunca varias a la vez. Asegúrese de que la otra persona
ha entendido sus preguntas.
3. Formule preguntas con un claro sentido. Toda interrogación que haga
GHEH WHQHU XQ SURSyVLWR ELHQ GHÀQLGR SRU HMHPSOR SURPRYHU OD
comunicación, pedir detalles, o hacer que el interlocutor tome una
posición determinada respecto a un hecho.
4. Pregunte receptivamente. Debe aceptar la respuesta de su interlocutor,
sea cual sea. No trate de dirigir la respuesta hacia lo que usted piensa
o siente. Trate de ser imparcial.
5. Vuelva a preguntar si se requiere. Realice de nuevo la pregunta o
reformule ésta si considera que no ha obtenido información relevante.
6. Finalmente, emplee las preguntas sólo para obtener información
necesaria acerca del otro.
PROGRAMA DE ENTRENAMIENTO 61

$\XGDUDORWURDFRQÀDUHQVtPLVPRSDUDLQLFLDUHOFDPELR

Empatizar implica compartir un problema con otra persona y contribuir a


VXSHUDUORGHVGHODREMHWLYLGDG4XLHQORJUDSRQHUVHHQHOOXJDUGHORWURGHPXHV-
tra que está interesado, no sólo en comprenderle, sino también en ayudarle a
analizar y a superar el problema. La empatía, pues, tiene un claro componente
GHPRWLYDFLyQKDFLDODDFFLyQDWUDYpVGHODH[SUHVLyQGHFRQÀDQ]DHQHORWUR

Colabore con la persona a quien usted desea ayudar. Es conveniente que


HVD SHUVRQD VLJDXQ SURFHVRGH DFWXDFLyQ TXH D FRQWLQXDFLyQ HMHPSOLÀFDPRV
HQVHLVSDXWDVUHÁH[LyQLGHQWLÀFDFLyQLQIRUPDFLyQSODQLÀFDFLyQSXHVWDHQ
práctica y evaluación.

 5HÁH[LyQ
 3UHJ~QWHOH ©¢4Xp FDPELRV WH JXVWDUtD YHU KHFKRV UHDOLGDG"ª
©¢4XpFUHHVTXHVHSXHGHKDFHU"ª

 ,GHQWLÀFDFLyQ
 3UHJ~QWHOH©¢4XpFXDOLGDGHVWHD\XGDUiQDFRQVHJXLUOR"ª©3LHQVD
HQDTXHOODRFDVLyQTXHª©¢4XpKL]RTXHVDOLHUDELHQ"ª©¢4Xp
FUHHVTXHSRGUtDVKDEHUKHFKRPHMRU"ª

3. Información.
Adviértale: «Prepárate, busca información que te ayude a conse-
JXLU WXV PHWDVª ¢'LVSRQHV GH LQIRUPDFLyQ DFHUFD GH"ª ©¢4Xp
H[SHULHQFLDVVLPLODUHVGHOSDVDGRKDQKHFKRSRVLEOH"ª

 3ODQLÀFDFLyQ
 3UHJ~QWHOH©¢4XpHVORSULPHURTXHWHJXVWDUtDFRQVHJXLU"¢FXiQ-
GR"ª©¢4XpFDPELRVHVSHUDV"ª©¢&yPRVDEUiVTXHORKDVORJUDGR"ª

5. Puesta en práctica.
$QtPHOH ©$KRUD £SRQWH HQ PDUFKDª ©¢&XiQGR YDV D HPSH]DU"
¢SRUGyQGH"¢FyPR"ª©¢(QTXpSXHGRD\XGDUWH"ª©¢4XpQHFHVLWDV"ª

6. Evaluación.
 3UHJ~QWHOH©¢&yPRYDVDPHGLUWXSURJUHVR"ª
62 AUTOGESTIÓN

5.3. Resumen

0XpVWUHVH DELHUWR \ ÁH[LEOH DQWH ORV GHPiV 'HPXHVWUH TXH HV FDSD] GH
sentirse como lo hacen otros, incluso cuando no comparte sus vivencias ni su
forma de pensar.

La empatía implica ponerse en el lugar del otro, entender cómo se siente y


D\XGDUOHDFRQÀDUHQVtPLVPR

Establezca comunicación empática a través de los siguientes comporta-


mientos:

1. Escuche activamente a través de signos verbales (pedir detalles) y no


YHUEDOHV PLUDGDSRVWXUDH[SUHVLyQ« 

2. Explore los sentimientos, emociones y actitudes de la otra persona


SUHJ~QWHOH©¢$TXpWHUHÀHUHV"ª©¢4XpSDVyH[DFWDPHQWH"ª 

3. Motive a la otra persona para el cambio y hágale ver que es capaz


de conseguir lo que se propone. Facilítele las claves para la acción:
UHÁH[LyQLGHQWLÀFDFLyQLQIRUPDFLyQSODQLÀFDFLyQSXHVWDHQSUiFWLFD
y evaluación.

Demuestre interés por la forma de pensar, sentir y comportarse de otros,


incluso cuando no coincida con la suya. Respete las diferencias y libérese de
WRGRMXLFLRLQLFLDODFHUFDGHORTXHR\HRYHHQORVGHPiV
6

ADAPTACIÓN AL CAMBIO
6. ADAPTACIÓN AL CAMBIO

6.1. Descripción de la habilidad

La adaptación al cambio implica la capacidad para asumir y acomodarse


DVLWXDFLRQHVGLIHUHQWHVTXHVHSURGXFHQHQVXHQWRUQRSRUHMHPSORDIURQWDU
QXHYDV WDUHDV R YDULDFLRQHV HQ ORV SURFHGLPLHQWRV GH WUDEDMR KDELWXDOHV /D
persona que se adapta convenientemente a los imprevistos y a nuevas situacio-
nes entiende que éstos son una forma de acumular experiencia y conocimientos
\SRUHOORHVFDSD]GHPRGLÀFDUFRQUHODWLYDIDFLOLGDGVXPRGRGHKDFHUODV
cosas.

4XLHQSRVHHHVWDFDSDFLGDGSURPXHYH\H[SORUDDVXDOUHGHGRURSRUWXQLGD-
GHVGHp[LWR\GHPHMRUDDWUDYpVGHORVFDPELRV

Sin embargo, sabemos que el ser humano se resiste generalmente a los


cambios pues resulta más seguro seguir haciendo las cosas como de costumbre,
es decir, existe lo que se llama «temor a lo desconocido».

Cuando nos encontramos ante una situación diferente tendemos a resolver-


la apoyándonos en ciertos automatismos que facilitan la toma de decisiones.
Estos mecanismos están fuertemente arraigados en las personas, y son los si-
guientes:
66 AUTOGESTIÓN

‡ La experiencia previa.
Recurrimos a ella para evaluar las nuevas situaciones, ya que actúa de
VRSRUWH VREUH HO TXH HQFDMDU ODV SHUVSHFWLYDV GH OD QXHYD VLWXDFLyQ
Solemos regir nuestra conducta por lo que ha funcionado o no ha
funcionado en otras ocasiones.

‡ Los estereotipos.
Especialmente los estereotipos sociales hacen que se atribuyan
las mismas características a cualquier persona que pertenezca a un
GHWHUPLQDGRJUXSR3RUHMHPSOR©/RVLQJHQLHURVVRQHVWXGLDQWHVPX\
listos» o «La informática es difícil de aprender».

‡ Los esquemas mentales.


Son guiones o formas de pensar basadas en nuestra experiencia previa
que sirven para tomar decisiones sobre el comportamiento a desarrollar
DQWH XQD QXHYD VLWXDFLyQ 3RU HMHPSOR 7RGRV WHQHPRV HQ QXHVWUD
cabeza el «esquema» de cómo se comporta uno en la ópera y de lo
que es posible hacer ahí. Por ello, a pesar de ser la primera vez que
vayamos a una ópera y de que veamos acercarse a un soldado con cara
de pocos amigos y un gran cuchillo en la mano no sentiremos ningún
miedo ni huiremos despavoridamente. Ello se debe a que la escena está
dentro de nuestro «esquema» de qué es una ópera.
‡ Los hábitos.
Nos ahorran el esfuerzo de estar creando respuestas. Una vez que
VH LGHQWLÀFD XQD VLWXDFLyQ FRQRFLGD VH UHFXUUH DO SDWUyQ GH DFFLyQ
elaborado para cada caso.

Estos patrones facilitan la toma de decisiones y proporcionan seguridad


en cuanto a las consecuencias de una acción («Si hago esto ya sé lo que va a
ocurrir»). No obstante, los automatismos constituyen unas barreras difíciles de
romper ya que impiden que nos planteemos nuevas alternativas. Esto puede di-
ÀFXOWDUODHYROXFLyQ\HOSURJUHVRGHXQDSHUVRQDSXHVWRTXHHOFDPELRHVDOJR
natural y necesario para poder evolucionar.

Por eso, la adaptabilidadHVXQDFRPSHWHQFLDHVHQFLDOGHDXWRJHVWLyQ+R\


más que nunca, el mundo se mueve en un entorno de cambios vertiginosos. Sólo
aquellas personas que sepan adaptarse a estos cambios con rapidez, y aprendan
DDSURYHFKDUODVRSRUWXQLGDGHVTXHRIUHFHQSRGUiQGHVDUUROODUVXWUDEDMRFRQ
éxito. La adaptación es una gran fuente de enriquecimiento para la persona, y,
en un sentido más amplio, también lo es para la organización o el ámbito donde
se genera el cambio.
PROGRAMA DE ENTRENAMIENTO 67

Finalmente, queremos resaltar que la capacidad para adaptarse a los cam-


ELRVQRVyORVHUHÀHUHDUHDFFLRQDUDQWHHOORV\VHUFDSD]GHDFRPRGDUVHIiFLO
y rápidamente, sino que además implica anticiparse a las variaciones, poder
GHWHFWDURSRUWXQLGDGHVGHPHMRUD\DSURYHFKDUODVFRQp[LWR

(QGHÀQLWLYDODDGDSWDFLyQDOFDPELRLPSOLFDODFDSDFLGDGSDUDDFHSWDU\
DFRPRGDUVHIiFLOPHQWHDODVQXHYDVVLWXDFLRQHVPRGLÀFDQGRODIRUPDKDELWXDO
de hacer las cosas. La facilidad con que una persona se acomoda a las posibles
eventualidades está muy relacionada con la forma en que interpreta las situa-
FLRQHVFDPELDQWHVHLPSUHYLVWDV\VHUiWDQWRPiVÁH[LEOH\HÀFD]VLPDQWLHQH
una actitud abierta.

6.2. Ayudas para la práctica

6.2.1. Mostrarse abierto y positivo

3LHQVHTXHODSUHGLVSRVLFLyQSRVLWLYDHVODPHMRUIRUPDGHVDFDUSURYHFKR
de una situación nueva. Mantenga una actitud abierta y constructiva ante lo
nuevo, anticípese y aproveche cada oportunidad que se le presente. Siga estos
FRQVHMRV

‡ Detecte el cambio.
Aproveche las señales o indicios de que se está produciendo un cambio
e intente predecir las consecuencias de éste en su entorno.

‡ Busque activamente el cambio.


Muestre interés por lo diferente y pregúntese en qué puede variar y
cómo.

‡ Actúe y no espere a que las cosas sucedan.


Evalúe los efectos que tendrá cada cambio y prepárese para adecuarse
DpOFRQSURYHFKR3ODQLÀTXHDFFLRQHVTXHOHSHUPLWDQVDFDUEHQHÀFLR
de las consecuencias positivas y evitar las negativas.

‡ No se aferre al pasado.
Evite pensamientos como «Siempre lo hemos hecho así y nos ha ido
bien».
68 AUTOGESTIÓN

6.2.2. Informarse

$FXGDDIXHQWHVÀDEOHVSDUDUHFRSLODULQIRUPDFLyQDFHUFDGHHQTXpFRQ-
siste el cambio y de las implicaciones que tendrá. De esta manera reducirá la
incertidumbre respecto a la situación y le será más fácil acomodarse. Tenga en
FXHQWDTXHSDUDWHQHUXQDRSLQLyQÀDEOHODLQIRUPDFLyQTXHUH~QDKDGHVHU
sencilla, comprensible, completa, coherente y estructurada.

,GHQWLÀTXH OD IXHQWH GH FDPELR SDUD YDORUDU VXV FDUDFWHUtVWLFDV \ VX LP-
pacto. Generalmente, las transformaciones suelen generarse en las siguientes
áreas:

‡ (VWUDWHJLDVGHRUJDQL]DFLyQÀQHVPHWDVREMHWLYRVHWF
‡ Estructura: relaciones formales o informales dentro de la organización,
organigrama, etc.

‡ Procesos: procedimientos o modelos de funcionamiento, etc.

‡ Tecnología: equipamientos, medios de comunicación, etc.

‡ Personas: recursos, gestión, etc.

‡ Entorno: competencia, sociedad, etc.

6.2.3. Analizar

,QWHQWHWUDEDMDUVREUHODQXHYDVLWXDFLyQ

‡ Transforme las características del cambio en ventajasREHQHÀFLRVSHU-


VRQDOHV\SURIHVLRQDOHV,GHQWLÀTXHFXiOVHUiVXUHFRPSHQVD

‡ Aproveche las oportunidades. Prevea aspectos de los cuales pueda sa-


FDU SURYHFKR \ DQWLFtSHVH DO IXWXUR WRPH OD LQLFLDWLYD GH HPSUHQGHU
acciones para adaptarse a la nueva situación.

‡ Prepárese SDUD KDFHU IUHQWH D ODV GLÀFXOWDGHV ([DPLQH VXV SURSLDV


habilidades y sus limitaciones respecto al cambio (utilice sus habilidades
para adaptarse con seguridad y sea consciente de sus carencias para
que no le supongan un obstáculo).

‡ Consiga los instrumentos\UHFXUVRVQHFHVDULRVSDUDTXHODVPRGLÀFDFLR-


nes le reporten éxito.
PROGRAMA DE ENTRENAMIENTO 69

6.3. Resumen

Los cambios se suceden en nuestras vidas de forma natural y constituyen


IXHQWHV GH PHMRUD \ SURJUHVR 3RU HOOR OD DGDSWDFLyQ DO FDPELR HV XQD JUDQ
fuente de enriquecimiento.

Esta habilidad se puede potenciar a través de los siguientes comportamientos:

‡ Muéstrese abierto y receptivo ante el cambio. Anticípese y aproveche


cada oportunidad que se le presente. Mantenga despierta la atención.

‡ Recopile información (sencilla, comprensible, completa, coherente y


estructurada) de las características de la nueva situación que le ayude
a reducir su incertidumbre y que facilite su adaptación.

‡ Prepárese de forma positiva. Anticípese a los acontecimientos, piense


HQODVGLÀFXOWDGHVTXHSXHGHHQFRQWUDUVH\DSy\HVHHQVXVKDELOLGDGHV
para sacar provecho del cambio.
7

GESTIÓN DEL TIEMPO


7. GESTIÓN DEL TIEMPO

7.1. Descripción de la habilidad

/D JHVWLyQ HÀFD] GHO WLHPSR HV XQR GH ORV UHFXUVRV SULQFLSDOHV SDUD HO
desempeño óptimo de cualquier tarea. Se trata de sacar el máximo provecho
de cada actividad invirtiendo en ella el tiempo adecuado.

Son muchos los autores que han escrito sobre este tema. La mayoría suele
coincidir en señalar que la incorrecta gestión del tiempo se debe a factores
como los citados a continuación:

‡ /DFDUHQFLDGHREMHWLYRVFRQFUHWRV\SUHYLDPHQWHGHÀQLGRV
‡ /D GLÀFXOWDG SDUD GLVWLQJXLU HQWUH OR TXH HV LPSRUWDQWH \ OR TXH HV
urgente.

‡ /DLQFRUUHFWDRUJDQL]DFLyQGHODSURSLDDJHQGDGHWUDEDMR
‡ La inadecuada delegación de tareas.

‡ El exceso de información para analizar y la información desordenada,


imprecisa o tardía.

‡ /DIDOWDGHORVUHFXUVRVQHFHVDULRVSDUDHMHFXWDUXQDDFFLyQ
74 AUTOGESTIÓN

La correcta administración del tiempo está estrechamente relacionada con


la realización de tres pautas:

‡ 3ODQLÀFDUODVDFWLYLGDGHV
‡ Tomar decisiones ante las distintas tareas a realizar.

‡ Controlar las distracciones o los denominados «ladrones de tiempo».

(QFXDQWRDOSULPHUSXQWRODSODQLÀFDFLyQKD\TXHVHxDODUTXHHOKHFKRGH
disponer de una visión general de cuáles son las tareas que tiene que realizar
le ayudará a guiar la distribución del tiempo. Es importante emplear el tiempo
MXVWRHQFDGDXQDGHHOODV\VDEHUFXiQGRHVHOPRPHQWRPiVRSRUWXQRSDUD
OOHYDUODVDFDER6LXVWHGGHGLFDHOWLHPSRQHFHVDULRSDUDSODQLÀFDUVXDFWLYLGDG
DXPHQWDUiODFDOLGDG\ODHÀFDFLDGHVXWUDEDMRHYLWDQGRGLÀFXOWDGHV\UHWUDVRV
innecesarios.

/DSODQLÀFDFLyQOHVHUYLUiHQHOIXWXURSDUDHYDOXDUHQTXpPHGLGDKDFRQ-
VHJXLGRDOFDQ]DUORVREMHWLYRVTXHVHKDEtDSURSXHVWRWDQWRDFRUWRFRPRD
medio y largo plazo.

/DVPHWDVTXHVHPDUTXHHQVXFDOHQGDULRGHEHQVHUDOFDQ]DEOHV\ÁH[LEOHV

6LORVREMHWLYRVVRQDOFDQ]DEOHV QLH[DJHUDGRVQLFRUWRVHQVXHVIXHU]R OD


SODQLÀFDFLyQSRGUiOOHYDUVHDFDERGHXQPRGRUHDOLVWD

6L ORV REMHWLYRV VRQ ÁH[LEOHV SRGUi UHDOL]DU ORV DMXVWHV QHFHVDULRV GHSHQ-
diendo de sus necesidades personales.

3RURWUDSDUWHWDQWRDODKRUDGHSODQLÀFDUXQDWDUHDFRPRGHDIURQWDUXQ
imprevisto, debe decidir qué hacer, y ello en función de las características de
la tarea. Tenga en cuenta que no todas son igual de importantes ni urgentes
UHVSHFWRDODFRQVHFXFLyQGHVXVREMHWLYRV

Por último, pero no menos relevante, otro factor que incide de forma direc-
WD\QHJDWLYDSDUDORJUDUVXVREMHWLYRVVRQODVGLVWUDFFLRQHVRLQWHUUXSFLRQHV
también denominadas «ladrones de tiempo». Estas interrupciones en las activi-
GDGHVSURJUDPDGDVSXHGHQSURYRFDUHUURUHVHQVXWUDEDMR\SRUWDQWRUHSHU-
cutir en la calidad del mismo. Por ello, también debe incluir las distracciones,
GHPDQHUDRUJDQL]DGDHQVXSODQLÀFDFLyQSHUVRQDO

/DFRUUHFWDSODQLÀFDFLyQ\DGPLQLVWUDFLyQGHOWLHPSRUHYLHUWHGLUHFWDPHQWH
HQHOORJURGHVXVREMHWLYRV\HQODFDOLGDGGHVXWUDEDMR
PROGRAMA DE ENTRENAMIENTO 75

7.2. Ayudas para la práctica

3ODQLÀFDUGHPDQHUDHÀFD]

3ODQLÀFDUQRHVRWUDFRVDTXHGLVWULEXLUHOWLHPSRGLVSRQLEOHHQWUHHOFRQ-
MXQWRGHDFWLYLGDGHVSHQGLHQWHVGHUHDOL]DUGHDFXHUGRDODVH[LJHQFLDVGHpV-
WDV3XHGHRUJDQL]DUXQDSODQLÀFDFLyQHQIXQFLyQGHFXDWURQLYHOHVWHPSRUDOHV
anual, mensual, semanal y diario.

0HGLDQWHODSODQLÀFDFLyQDQXDOVRPRVFDSDFHVGHGHWHFWDUSXQWRVFRQÁLFWL-
vos en nuestra actividad y recordar fechas clave.

0HGLDQWH OD SODQLÀFDFLyQ PHQVXDO YDPRV GHWDOODQGR DOJR PiV ODV WDUHDV
H[SOLFLWDGDVHQODSODQLÀFDFLyQDQXDO

Teniendo en cuenta la «semana a la vista», debemos anotar actividades y


citas concretas.

)LQDOPHQWH HQ OD SODQLÀFDFLyQ GLDULD KD GH HVWDEOHFHU XQD RUJDQL]DFLyQ
clara de lo que realizará y la forma en que se ha de llevar a cabo.

8QFRQVHMRPX\LPSRUWDQWHSDUDODSODQLÀFDFLyQOHVHUiPiVIiFLOVLHPSOHD
una agenda.

Le ofrecemos ahora una tabla donde puede observar determinadas sugeren-


cias para la realización de su calendario de actividades:

PLANIFICACÍÓN UTILIDADES

ANUAL Detectar aglomeraciones y recordar fechas


importantes.

MENSUAL Detallar y anticipar las actividades indica-


GDVHQODSODQLÀFDFLyQDQXDO

SEMANAL Anotar las actividades y citas concretas.

2UJDQL]DUHOWUDEDMRGLDULRODIRUPDGH
DIARIA llevarlo a cabo, y controlar factores que
distraen.
76 AUTOGESTIÓN

$3ODQLÀFDFLyQDQXDO

5HÁHMDQGR HQ XQ FDOHQGDULR DQXDO ORV DFRQWHFLPLHQWRV SUR\HFWRV FLWDV


o reuniones que usted pueda prever con ese tiempo de antelación, obtendrá
XQD SULPHUD SODQLÀFDFLyQ GH ORV REMHWLYRV TXH GHEH FXEULU \ FyPR RUJDQL]DU
su tiempo al respecto. De esta forma puede conocer con antelación cuáles se-
UiQORVPHVHVFRQPiVWUDEDMR\FXiOHVORVPiVUHODMDGRV(QIXQFLyQGHHVWDV
DSUHFLDFLRQHVSRGUiDVLJQDUWDUHDVHQODVSODQLÀFDFLRQHVSDUFLDOHVTXHUHDOLFH
posteriormente.

/RVHYHQWRVPiVKDELWXDOHVTXHVHGHEHQDQRWDUHQODSODQLÀFDFLyQDQXDOVRQ

‡ Proyectos en los que se prevea que va a estar involucrado a lo largo del


año.

‡ Reuniones periódicas que usted conoce anticipadamente cuándo se


celebrarán.

‡ Acontecimientos especiales como la preparación de un congreso, la


asistencia a cursos formativos, etc.

‡ $FRQWHFLPLHQWRVSHULyGLFRVFRPRDXGLWRUtDVYLDMHVHWF
‡ Vacaciones.

%3ODQLÀFDFLyQPHQVXDO
(OREMHWLYRSULPRUGLDOHVHYLWDULPSUHYLVWRVSUHSDUDUWUDEDMRVRHYHQWRVGH
ODSODQLÀFDFLyQDQXDOFRQVXÀFLHQWHDQWHODFLyQDVtFRPRGHWDOODUODLQIRUPD-
ción contenida en la anual.

/DVDFWLYLGDGHVSURSLDVTXHGHEHQFRQWHPSODUVHHQODSODQLÀFDFLyQDPHGLR
plazo son:

‡ Reuniones previstas.

‡ Citas acordadas.

‡ Fechas de vencimiento de plazos.

‡ Tareas concretas relacionadas con los proyectos en los que participa.

‡ Actividades que es preciso realizar como condición previa para la con-


secución de otras.

‡ Periodos completos dedicados a una actividad.


PROGRAMA DE ENTRENAMIENTO 77

&3ODQLÀFDFLyQVHPDQDO

/DVWDUHDVVHPXHVWUDQGHIRUPDPiVGHWDOODGD'HEHUHÁHMDUGtDDGtDFXi-
OHVVRQODVDFWLYLGDGHVDUHDOL]DUVLQHVSHFLÀFDUORVPRPHQWRVQLODGXUDFLyQGH
las mismas, de tal manera que se vea una agrupación de tareas por día.

$OJXQDVLQGLFDFLRQHVSDUDXQDFRUUHFWDSODQLÀFDFLyQVHPDQDOVRQ

‡ 5HDOLFH OD SODQLÀFDFLyQ DO LQLFLR GH FDGD VHPDQD (VWR OH SHUPLWH
DSURYHFKDUPHMRUVXWLHPSR\REWHQHUUHVXOWDGRVGHFDOLGDG

‡ Procure que todos los días estén equilibrados en cuanto a carga de


WUDEDMR

‡ 1RROYLGHGHGLFDUXQWLHPSRDLPSUHYLVWRV\DDFWLYLGDGHVJUDWLÀFDQWHV

'3ODQLÀFDFLyQGLDULD
A partir del calendario semanal se programan de forma detallada las se-
VLRQHVGLDULDVGHWUDEDMR6HGHEHFRQFUHWDUDTXtFDGDDFWLYLGDGLQFOXVRSDU-
WHV GH OD PLVPD \ SURFHGLPLHQWRV SDUD VX HMHFXFLyQ 6H DVLJQD XQD GXUDFLyQ
GHGLFDFLyQ SUHYLVWD  OR PiV H[DFWD SRVLEOH GHQWUR GHO KRUDULR GH OD MRUQDGD
ODERUDO(VWDSODQLÀFDFLyQJXLDUiVXWUDEDMR\OHSHUPLWLUiDSURYHFKDUHOWLHPSR
HÀFLHQWHPHQWH

$QRWHHQVXSODQLÀFDFLyQGLDULDSRUHMHPSOR

‡ Reuniones: fecha, asistentes, asunto.

‡ Llamadas importantes.

‡ $FWLYLGDGHVGHGHVFDQVRFRPLGDVSHTXHxDVSDXVDVSDUDUHODMDUVH
‡ $FWLYLGDGHVGHULYDGDVGHODSODQLÀFDFLyQVHPDQDO

7.2.2. Decidir las tareas y el momento

3DUD OD SODQLÀFDFLyQ KD GH GHFLGLU VL HV QHFHVDULR OOHYDU D FDER XQD DFWL-
vidad, cuándo y quién debe realizarla. Para tomar este tipo de decisiones de
PDQHUDHÀFD]WHQJDHQFXHQWDGRVDVSHFWRVEiVLFRVGHXQDWDUHD

‡ La importancia: el grado en que su realización repercutirá en el logro


GHVXVREMHWLYRV
78 AUTOGESTIÓN

‡ La urgencia: el plazo de tiempo en que habrá de ser realizada.

 5HÁH[LRQH VREUH OD LPSRUWDQFLD \ OD XUJHQFLD R QR GH FDGD WDUHD
(Q OD ÀJXUD TXH SUHVHQWDPRV D FRQWLQXDFLyQ VH LQGLFD OD GHFLVLyQ
UHFRPHQGDGDHQIXQFLyQGHHVWDFODVLÀFDFLyQ

'HFLGLUODDGHFXDGDJHVWLyQGHOWLHPSR

12

$3/$=$5 (/,0,1$5

85*(17(

+$&(5 '(/(*$5

6Ì
6Ì 12
,03257$17(

 /DV WDUHDV TXH FODVLÀTXH FRPR 12 ,03257$17(6 \ 12 85*(17(6


elimínelasGHVXSODQLÀFDFLyQ

 /DV WDUHDV TXH FODVLÀTXH FRPR ,03257$17(6 \ 85*(17(6 realícelas


cuanto antes.

 /DV WDUHDV TXH FODVLÀTXH FRPR ,03257$17(6 SHUR 12 85*(17(6


aplácelas para otro momento.

 /DV WDUHDV TXH FODVLÀTXH FRPR 12 ,03257$17(6 SHUR 6Ì 85*(17(6
deléguelas, es decir, compruebe si alguien las puede realizar en su
OXJDUFRQODPLVPDHÀFDFLDTXHXVWHG
PROGRAMA DE ENTRENAMIENTO 79

7.2.3. Controlar los «ladrones de tiempo»

/RV ©ODGURQHV GH WLHPSRª VRQ WRGDV DTXHOODV DFFLRQHV TXH QRV DOHMDQ GH
QXHVWURVREMHWLYRVDOWHUDQODSODQLÀFDFLyQ\SRUWDQWRLPSLGHQRUHWUDVDQOD
REWHQFLyQGHQXHVWURVREMHWLYRV6LQGXGDXQDD\XGDPX\HÀFD]SDUDJHVWLRQDU
adecuadamente su tiempo consiste en mantener a raya estas interrupciones,
como las llamadas telefónicas, las visitas inesperadas, las entradas de correo
electrónico, etc.
*HQHUDOPHQWHODVLQWHUUXSFLRQHVVHSURGXFHQSRUXQDSODQLÀFDFLyQGHÀFLWD-
ria, por las demandas de otros y por nuestra falta de disciplina.

‡ 3ODQLÀFDFLyQGHÀFLWDULD/DSODQLÀFDFLyQSHUVRQDOGHÀFLWDULDRLQH[LV-
tente nos puede llevar a ocuparnos a menudo de lo que no es importan-
te, dedicando excesiva atención a los imprevistos antes que a las tareas
LPSRUWDQWHVSUHYLDPHQWHSODQLÀFDGDV
‡ 'HPDQGDV DMHQDV (Q PXFKDV RFDVLRQHV OD IDOWD GH SODQLÀFDFLyQ GH
otros, su falta de disciplina, etc., nos hacen caer en la trampa de sen-
tirnos obligados a atender a sus demandas.
‡ Falta de disciplina. Nuestra ausencia de método y rigor en los procedi-
PLHQWRVGHWUDEDMRHVXQDIXHQWHKDELWXDOGHVLWXDFLRQHVLQHVSHUDGDV
que requieran nuestro tiempo.

Para suavizar el impacto de los ladrones de tiempo puede utilizar las si-
guientes medidas:

1. Agrupar las distracciones.


 /DV GLVWUDFFLRQHV VH GHEHQ RUJDQL]DU HQ XQ PRPHQWR GH OD MRUQDGD
$Vt UHFLELU \ UHDOL]DU OODPDGDV RFXSDUVH GH ORV PHQVDMHV R UHVROYHU
consultas, deberán estar contempladas en un grupo de actividades pla-
QLÀFDGDV'HHVWHPRGRODVLQWHUUXSFLRQHVVHFRQFHQWUDQHQXQ~QLFR
momento del día durante el que dedicará su atención a ellas.

2. Separar el tiempo público del privado.


 &RPXQtTXHOHVDVXVFRPSDxHURV\FRODERUDGRUHVODSODQLÀFDFLyQGHVX
tiempo. Explique en qué momento podrá atender sus demandas. Por
HMHPSORVLXQFRODERUDGRUVX\RVDEHTXHOHSUHVWDUiWRGDVXDWHQFLyQ
DOÀQDOGHODPDxDQDQROHLQWHUUXPSLUiHQRWURPRPHQWR

3. Limitar el tiempo dedicado para cada distracción.


Intente no extenderse con algunas interrupciones a no ser que sea real-
mente necesario. Muchas veces se dedica un tiempo desproporcionado
DSHTXHxDVWDUHDVTXHFRPRFRQVHFXHQFLDOOHYDQDOWUDVWHODSODQLÀ-
cación realizada.
80 AUTOGESTIÓN

7.3. Resumen

/D JHVWLyQ HÀFD] GHO WLHPSR HVWi UHODFLRQDGD FRQ OD KDELOLGDG SDUD DG-
PLQLVWUDUORVSURSLRVUHFXUVRVHPSOHDQGRHQFDGDWDUHDODGHGLFDFLyQMXVWD\
necesaria.

Del correcto aprovechamiento del tiempo depende la consecución de nues-


WURVREMHWLYRVODFDOLGDGGHQXHVWURWUDEDMR\ODVDWLVIDFFLyQSHUVRQDOSRUHO
logro de las metas.

Teniendo en cuenta que el tiempo pasa rápido, y es irrecuperable, trate de


aprovecharlo al máximo a través de:

‡ /DSODQLÀFDFLyQ$VLJQHDFDGDWDUHDHOWLHPSRDGHFXDGR\HVWDEOH]FD
XQDIHFKD\KRUDSDUDUHDOL]DUOD2UJDQLFHVXDJHQGDVHJ~QODSODQLÀFD-
ción anual, mensual, semanal y diaria.

‡ Tomar decisiones. Realice un análisis previo de la importancia y la


XUJHQFLD GH ODV WDUHDV SUHYLVWDV 1R GHMH GH KDFHU OR LPSRUWDQWH \
urgente, delegue lo urgente y no importante y aplace lo no urgente
pero sí importante.

‡ (OFRQWUROGHODVLQWHUUXSFLRQHV*HVWLRQHODVDFFLRQHVTXHOHDOHMDQGH
VXVREMHWLYRV\OHREOLJDQDDOWHUDUODSODQLÀFDFLyQ$JUXSHORVODGURQHV
de tiempo por categorías y aplíqueles la dedicación que requieran.
8

SOLUCIÓN DE PROBLEMAS
8. SOLUCIÓN DE PROBLEMAS

8.1. Descripción de la habilidad

Decimos que existe un problema cuando la situación presente discrepa de


la situación deseada. Por tanto, solucionar un problema es hallar la respuesta
PiVDGHFXDGDSDUDFRQVHJXLUHVHHVWDGRÀQDO

(OSURFHVRGHUHVROXFLyQGHXQSUREOHPDLPSOLFDDQDOL]DUREMHWLYDPHQWHOD
VLWXDFLyQGHSDUWLGDEXVFDUODPHMRUDOWHUQDWLYD\ÀQDOPHQWHOOHYDUDFDERHO
plan de acción que se deriva de la decisión adoptada.

6HHQWLHQGHSRUVROXFLyQHÀFD]DTXHOODTXHFRQVLJXHDOFDQ]DUHOREMHWLYR
6LDGHPiVHVWDVROXFLyQPD[LPL]DRWUDVFRQVHFXHQFLDVSRVLWLYDV EHQHÀFLRV 
\PLQLPL]DODVFRQVHFXHQFLDVQHJDWLYDV FRVWHV KDEODPRVGHXQDVROXFLyQHÀ-
ciente. Aunque esta última es más completa, no siempre es necesario perseguir
ODVROXFLyQSHUIHFWDHQRFDVLRQHVVHUiVXÀFLHQWHDSOLFDUXQDVROXFLyQHÀFD]

El proceso de resolución de un problema pasa necesariamente por dos fases:

1. Análisis del problema. Consiste en elegir, entre las posibles alternativas


de solución, la que se considera más adecuada.

2. Puesta en práctica de la solución. Es el momento de aplicar la solución


escogida y comprobar si se ha logrado reducir la distancia entre la si-
tuación actual y la deseada.
84 AUTOGESTIÓN

Para llevar a cabo con éxito las dos fases mencionadas es de gran utilidad
PDQHMDUODVKDELOLGDGHVSHUVRQDOHVTXHH[SRQHPRVDFRQWLQXDFLyQFRQVFLHQ-
FLDREMHWLYLGDGFRQRFLPLHQWRFUHDWLYLGDGVHOHFFLyQGHDOWHUQDWLYDVSHWLFLyQ
de sugerencias y actitud positiva.

‡ Consciencia. Reconocer que existe un problema es el primer paso para


solucionarlo.

‡ 2EMHWLYLGDG $QDOL]DU FODUDPHQWH OD VLWXDFLyQ HV LPSUHVFLQGLEOH SDUD


descubrir la raíz de la misma.

‡ Conocimiento. Explorar el problema y ampliar los conocimientos acerca


GHOPLVPRD\XGDDLGHQWLÀFDUHOFRQMXQWRGHYDULDEOHVTXHLQÁX\HQHQ
él.

‡ Creatividad. No siempre resulta evidente cuál es la solución. Por ello,


conviene abordar el problema desde distintos puntos de vista, yendo
más allá del camino más obvio.

‡ 6HOHFFLyQGHDOWHUQDWLYDV([DPLQDUHOFRQMXQWRGHVROXFLRQHVSRVLEOHV
sin invalidar ninguna de antemano, nos ayuda a decidir cuál es la más
adecuada.

‡ Petición de sugerencias. Indagar otros puntos de vista enriquece nuestra


visión del problema y contribuye a tomar una decisión acertada.

‡ Actitud positiva. Abordar el asunto de manera constructiva, entendién-


GRORFRPRXQDRSRUWXQLGDGGHPHMRUDGHWHUPLQDHQJUDQPHGLGDHO
éxito en su resultado.

(QVtQWHVLVODUHVROXFLyQHÀFD]GHSUREOHPDVHVODFDSDFLGDGSDUDDERUGDU
situaciones problemáticas de forma constructiva, analizando minuciosamente
la situación inicial y llegando hasta la aplicación efectiva de la decisión adop-
tada.

8.2. Ayudas para la práctica

8.2.1. Emplear el método IDEAR

(VWHPpWRGRHVXQSURFHGLPLHQWRVLVWHPiWLFR\REMHWLYRSDUDUHVROYHUXQ
problema. La realización de las cinco fases sucesivas que se proponen garanti-
za, en gran medida, el éxito en la aplicación de una solución.
PROGRAMA DE ENTRENAMIENTO 85

En cada una de estas fases se ha dar respuesta a una serie de cuestiones


encaminadas a encontrar la situación deseada de forma progresiva. Cada letra
del método IDEAR se corresponde con una acción, por eso es fácil de recordar:
,GHQWLÀFDU'HÀQLU([SORUDU$FWXDU5HSDVDU

‡ ,GHQWLÀFDU HO SUREOHPD VXSRQH UHFRQRFHU VX H[LVWHQFLD \ FODVLÀFDU HO


tipo de obstáculo al que nos enfrentamos.

‡ 'HÀQLU HO SUREOHPD HV GHVFULELU H[DFWDPHQWH HQ TXp FRQVLVWH D TXp
y a quiénes afecta y analizar sus causas. Intente contestar a las cinco
preguntas siguientes: quién, qué, dónde, cuándo y por qué.

‡ ([SORUDU VROXFLRQHV VLJQLÀFD GHFLGLU GH HQWUH WRGDV ODV SRVLEOHV


alternativas, o formas de solucionar el problema, la que resuelve de
PDQHUDPiVHÀFD]\YLDEOHODVLWXDFLyQSODQWHDGD

‡ Actuar y aplicar. Una vez tomada la decisión, elabore un plan de acción


para establecer exactamente qué se hará, cuándo, de qué modo y
quién. De esta manera se puede valorar con antelación si la solución
del problema se puede llevar a cabo. Incluso es posible aplicar una
versión preliminar de la solución (un prototipo) para comprobar que se
está siguiendo la dirección adecuada.

‡ Repasar. Finalmente, revise el proceso completo para cubrir posibles


lagunas y compruebe que la solución elegida es realmente la adecuada.

8.2.2. Utilizar técnicas creativas

La idea de utilizar técnicas creativas surge de la necesidad de encontrar


soluciones diferentes a las que se usan habitualmente cuando éstas ya no re-
sultan útiles. Las sugerencias que le presentamos a continuación le sirven para
encontrar soluciones no evidentes ante un problema: búsqueda de alternativas,
UHYLVLyQGHVXSXHVWRVUHSUHVHQWDFLyQJUiÀFD\IUDFFLRQDPLHQWR

‡ %~VTXHGDGHDOWHUQDWLYDV(OREMHWLYRHVH[SORUDU\SURGXFLUHOPD\RU
Q~PHURGHHQIRTXHVDXQSUREOHPD+D\TXHUHRUJDQL]DUODLQIRUPDFLyQ
de partida para analizar posteriormente las más satisfactorias. La
conocida técnica de la «lluvia de ideas» puede ser un buen recurso.

‡ Revisión de supuestos. Los modelos mentales lógicos que se aceptan


como válidos para describir los hechos bloquean a menudo la imaginación
y, en ocasiones, impiden llegar a una solución. La otra opción es
SUHVFLQGLUGHODYDOLGH]GHGLFKRVVXSXHVWRV(VGHFLUSUHJ~QWHVH©¢3RU
86 AUTOGESTIÓN

TXpQRKDFHUORGHHVWHRWURPRGR"ª/DFXHVWLyQLQYLWDDSRQHUHQGXGD
lo establecido y a explorar otras posibilidades.

‡ 5HSUHVHQWDFLyQJUiÀFD(VWDWpFQLFDRIUHFHVROXFLRQHVFUHDWLYDVFXDQGR
HOÀQHVWUDHUDODUHDOLGDGXQDLPDJHQPHQWDO(OGLEXMRUHÁHMDODYLVLyQ
que distintas personas tienen de un mismo problema. De ello resultan
soluciones sugerentes a partir de la comparación de las diferentes
LQWHUSUHWDFLRQHV$OUHSUHVHQWDUJUiÀFDPHQWHHOSODQWHDPLHQWRGHXQ
problema, la alternativa visual ayuda a su solución.

‡ Fraccionamiento. A partir del fraccionamiento del problema en partes


QR HYLGHQWHV VH FRQVLJXH XQD UHRUJDQL]DFLyQ GH OD LQIRUPDFLyQ HVWR
SXHGH DPSOLDU QXHVWUR SXQWR GH YLVWD 3RU HMHPSOR FODVLÀFDU D ORV
empleados de una empresa por el tipo de actividad que realizan y no
por el cargo que desempeñan.

8.2.3. Plan de acción

Consiste en una programación detallada de actividades y recursos necesa-


rios que permiten realizar la decisión adoptada. El plan de acción ha de incluir:

‡ 4XpWDUHDVVRQQHFHVDULDV
‡ &XiQGRKD\TXHUHDOL]DUFDGDDFWLYLGDG(VSHFLÀFDUFODUDPHQWHTXpVH
espera obtener y en qué periodo de tiempo.

‡ 4XLpQYDDUHVSRQVDELOL]DUVHGHODHMHFXFLyQGHFDGDXQDGHHOODV
‡ 4XpUHFXUVRV\PHGLRVVHYDQDQHFHVLWDU
‡ 4XpSURFHGLPLHQWRVVHKDQGHVHJXLU
A la hora de llevar a cabo estas acciones programadas no olvide tener en
cuenta los siguientes cuatro puntos:

1. Proporcionar los recursos según el plan de acción.

 (VWDEOHFHU ORV SDUiPHWURV GH PHGLGD REMHWLYRV 3DUD HVWLPDU KDVWD
qué punto se están alcanzado los resultados esperados hay que decidir
SUHYLDPHQWH TXp PHGLGD REMHWLYD VH YD D HPSOHDU FRPR EDUHPR R
HVWiQGDU 3RU HMHPSOR VL OD VROXFLyQ HVFRJLGD HVWi HQFDPLQDGD D
DXPHQWDUODSXQWXDOLGDGGHXQDFRPSDxtDDpUHDXQDPHGLGDREMHWLYD
sería la diferencia en minutos entre la hora de salida estimada y el
despegue.
PROGRAMA DE ENTRENAMIENTO 87

 5HDOL]DU XQ VHJXLPLHQWR GHO SODQ GH DFFLyQ +D\ TXH UHYLVDU VL ORV
procedimientos que se están llevando a cabo proporcionan los resultados
previstos, y, en caso contrario, valorar y corregir las discrepancias.
(VWDYDORUDFLyQSHUPLWHDVXYH]RSWLPL]DUODVDFWXDFLRQHVHÀFDFHV\
PRGLÀFDUODVHUUyQHDV

 0RWLYDUDORVLPSOLFDGRV(Op[LWRÀQDOGHODUHVROXFLyQGHXQSUREOHPD
depende en gran medida de la participación e interés de las partes
implicadas. Para ello, cada persona ha de ser formada e informada de
WRGRDTXHOORTXHVHYDDUHDOL]DUFyPR\FRQTXpÀQDOLGDG
88 AUTOGESTIÓN

8.3. Resumen

La habilidad para solucionar problemas permite afrontar de forma compe-


tente cualquier situación personal, social y profesional. Las estrategias son:

‡ 0pWRGR,'($5,GHQWLÀFDU'HÀQLU([SORUDU$FWXDU\$SOLFDU\5HSDVDU
‡ Técnicas creativas. Sirven para explorar todas las alternativas posibles
KDVWDGDUFRQODVROXFLyQPiVHÀFD]SDUDHOSUREOHPD(VWXGLHODVLWXDFLyQ
desde otros puntos de vista menos evidentes. Las técnicas creativas
son: búsqueda de alternativas, revisión de supuestos, representación
JUiÀFD\IUDFFLRQDPLHQWRGHOSUREOHPD

‡ Plan de acción. Permite aplicar de forma viable y sistemática la so-


lución adoptada. Tenga en cuenta a todas las personas, así como los
recursos y procedimientos necesarios para detallar con exactitud qué
se va a hacer, cuándo y de qué manera.
ANEXOS
Anexo 1: Metodología

Antes de comenzar su periodo de práctica tenga presente las siguientes


sugerencias.

Conozca su nivel
$QWHVGHHPSH]DUDWUDEDMDUFRQODVKDELOLGDGHVSURSXHVWDVPHGLWH\UHD-
lice una primera estimación del grado en el que utiliza los diferentes compor-
tamientos de las destrezas de autogestión. Ello le va a permitir llevar a cabo la
OHFWXUD\HOWUDEDMRSDUDFDGDKDELOLGDGGHXQDPDQHUDGLIHUHQWHFRQRFLHQGR
VXVSXQWRVIXHUWHV\GpELOHV$VtSRGUiVHOHFFLRQDUFyPRWUDEDMDUFRQFDGDKDEL-
OLGDGFXiOUHTXHULUiPiVWLHPSR\HQGHÀQLWLYDSRGUiDERUGDUORVFRQWHQLGRV
del libro desde una perspectiva única: la suya.

En el anexo 2 dispone de todo el material para realizar esta autoevaluación


y para poder repetirla tantas veces como considere oportuno.

Practique lo aprendido
Lleve a la práctica las estrategias que le presentamos en el libro. Recuerde
que lo que no se practica no se aprende. De nada sirve que domine la teoría
92 AUTOGESTIÓN

acerca de cómo debería actuar en diferentes situaciones en que lleve a cabo


las ocho habilidades de autogestión si no consigue comportarse como dice la
teoría.

7HQJDHQFXHQWDTXHHOHQWUHQDPLHQWRHVXQSURFHVRGHDSUHQGL]DMHSURJUH-
VLYR\GXUDGHUR\HQHVWHVHQWLGRODSODQLÀFDFLyQKDGHVHUXQDKHUUDPLHQWD
abierta en donde ir incorporando sucesivas prácticas.

6HSXHGHQSODQLÀFDUWDQWDVVHPDQDVFRPRKDELOLGDGHVVHGHVHHSUDFWLFDU
1RREVWDQWHHVDFRQVHMDEOHTXHVHGHGLTXHXQDVHPDQDFRPSOHWDDOHQWUHQD-
miento de una única habilidad. Asimismo, una habilidad se puede practicar du-
rante varias semanas, lo cual dependerá del grado de dominio que se pretenda
alcanzar.

Para facilitar esta puesta en práctica hemos preparado el material necesa-


rio. En el anexo 3 («Entrenamiento») le explicamos cómo practicar las habili-
dades y cómo servirse del material diseñado para poder hacerlo sistemática-
mente.

Aprenda más
La orientación práctica del libro y el reducido espacio en el que hemos
querido presentar los contenidos no permite un desarrollo pormenorizado del
tema, si bien hemos seleccionado las técnicas y estrategias de las habilidades
de autogestión que son más útiles, sucintas y claras. Para avanzar más en el
FDPLQRTXHOHLQGLFDPRVVHUHFRPLHQGDFRQVXOWDUODELEOLRJUiÀFDVHOHFFLRQDGD
VREUHHOWHPD\TXHDSDUHFHDOÀQDOGHHVWHPDQXDO
Anexo 2: Cuestionario de evaluación general

Cómo realizar la evaluación general

Nuestro planteamiento es preferentemente práctico. Antes de comenzar


FRQHOHQWUHQDPLHQWRGHODVRFKRKDELOLGDGHVHVSHFtÀFDVOHVXJHULPRVTXHUHD-
lice una autoevaluación inicial para conocer en qué destrezas se desenvuelve
FRUUHFWDPHQWHRFXiOHVQHFHVLWDPHMRUDUUHVSHFWRGHODVKDELOLGDGHVWUDWDGDV
Mediante esta evaluación se establece un punto de partida de cara al entre-
namiento que le permitirá saber en qué medida, en la actualidad, es capaz de
aprovechar sus propios recursos para hacer frente a las exigencias del entorno
y detectar, en la práctica, determinadas aptitudes que usted podría desarrollar
GHXQPRGRHÀFLHQWH

(OFXHVWLRQDULRGHHYDOXDFLyQHVWiIRUPDGRSRUXQFRQMXQWRGHFRPSRUWD-
mientos relacionados con todas y cada una de las habilidades de autogestión
desarrolladas en el libro. En cada punto se expone un comportamiento compe-
tente, es decir, una actuación que representaría un nivel de desempeño ade-
cuado en una habilidad concreta. Para contestar al cuestionario debe indicar
el grado en el que cree que domina el comportamiento, teniendo en cuenta su
manera habitual de actuar. Se trata de evaluar, a través de sus respuestas, en
qué medida lleva a cabo en la actualidad los comportamientos referidos en el
cuestionario.
94 AUTOGESTIÓN

La escala de respuesta para contestar al cuestionario va desde 1 hasta 10.


(OVLJQLÀFDGRGHORVYDORUHVH[WUHPRVHV

1 No lo domino en absoluto. 10 Lo domino completamente.

3RUHMHPSORVLVHDSOLFDXQDUHVSXHVWDGH ©/RGRPLQRFRPSOHWDPHQ-
te») a la frase «Consigo dominar mis emociones evitando que éstas me hagan
UHDFFLRQDUGHPDQHUDLPSXOVLYDRDJUHVLYDªVLJQLÀFDTXHODSHUVRQDHYDOXDGD
realiza de modo correcto el comportamiento que se expone. Es decir, considera
TXH HQ JHQHUDO HV FDSD] GH GRPLQDU VXV HPRFLRQHV REMHWLYDPHQWH SDUD QR
responder de modo impulsivo o destructivo.

Por el contrario, una respuesta de 1 («No lo domino en absoluto») implica


TXHQRSUDFWLFDHOFRPSRUWDPLHQWRGHOHQXQFLDGRRQROROOHYDDFDERFRQHÀ-
cacia.

Para responder al cuestionario tenga presente lo siguiente:

1. Lea con máxima atención la frase y valore cómo cree que domina el
FRPSRUWDPLHQWRHVGHFLULQGLTXHVLVXHOHDFWXDUFRPRVHGHVFULEH

 0DUTXHXQDFDVLOODHQFDGDÀODLQGLFDQGRDVtVXQLYHOGHGRPLQLRGHO
comportamiento descrito. Recuerde: el valor máximo (casilla 10)
indica que aplica y domina por completo el comportamiento, y el
PtQLPR FDVLOOD   UHÁHMD OR RSXHVWR TXH QR GRPLQD HQ DEVROXWR HO
FRPSRUWDPLHQWR\SRUWDQWRWLHQHJUDQGHVGLÀFXOWDGHV

 &RQWHVWH D WRGDV ODV SUHJXQWDV \ DO ÀQDOL]DU FDOFXOH VX SXQWXDFLyQ
WRWDOVXPDQGRORVYDORUHVGHODVÀODV
PROGRAMA DE ENTRENAMIENTO 95

Cuestionario

Escala de
COMPORTAMIENTOS respuesta
1-10

1. Conozco bien tanto mis cualidades positivas como mis limitaciones,


lo cual me permite afrontar con seguridad y optimismo nuevas
tareas.

2. No me bloqueo ante el fracaso. Asumo mis propios errores y trato


de solucionarlos, y, al mismo tiempo, aprender de ellos.

3. Consigo dominar mis emociones evitando que éstas me hagan


reaccionar de manera impulsiva o agresiva.

4. Expreso mis peticiones y críticas asertivamente, es decir, sin herir


DORWURSHURORJUDQGRPLREMHWLYR

5. Me esfuerzo por entender a otras personas que tienen formas de


pensar, sentir o comportarse distintas a la mía.

6. Exploro y promuevo activamente el cambio en mi entorno pues lo


FRQVLGHURXQDIXHQWHGHPHMRUD\DSUHQGL]DMH

7. Empleo el tiempo adecuado en realizar mis actividades obteniendo


resultados de calidad.

8. Propongo diferentes soluciones válidas a un problema y analizo


FXiO SXHGH VHU OD PiV HÀFD] VLQ OLPLWDUPH D OR TXH SDUHFH PiV
evidente.

Puntuación total
96 AUTOGESTIÓN

Corrección del cuestionario

Para obtener la puntuación total del cuestionario sume las puntuaciones de


ODVRFKRÀODV\DQRWHHOUHVXOWDGRHQODFDVLOODFRUUHVSRQGLHQWHD©3XQWXDFLyQ
total». Esta cifra indicará su nivel general de destreza en las habilidades.

Para interpretar esta puntuación tenga en cuenta las siguientes recomen-


daciones:

Ítems y capítulos del libro

Utilice esta información para relacionar su puntuación en las diferentes


SUHJXQWDVFRQORVDVSHFWRVWUDEDMDGRVHQORVFDStWXORVGHOOLEUR

6LREWLHQHSXQWXDFLRQHVEDMDVHQHOtWHPHOFDStWXOR©$XWRFRQÀDQ]Dª
OHVHUiGHJUDQXWLOLGDGSDUDPHMRUDUVXQLYHOHQHVWDKDELOLGDG

6L REWLHQH SXQWXDFLRQHV EDMDV HQ OD VHJXQGD FXHVWLyQ WUDEDMH FRQ HO
capítulo «Afrontar el fracaso».

6LREWLHQHSXQWXDFLRQHVEDMDVHQHOtWHPHOFDStWXORDFHUFDGH©$XWR-
control» le será muy útil.

6LREWLHQHSXQWXDFLRQHVEDMDVHQHOtWHPWUDEDMHHOFDStWXOR©$VHUWLYL-
dad».

6LREWLHQHSXQWXDFLRQHVEDMDVHQHOtWHPHOFDStWXORVREUH©(PSDWtDª
OHSHUPLWLUiPHMRUDUVXQLYHOGHKDELOLGDG

6LREWLHQHSXQWXDFLRQHVEDMDVHQHOtWHPHOFDStWXOR©$GDSWDFLyQDO
FDPELRªOHD\XGDUiHQVXSURFHVRGHPHMRUD

6LREWLHQHSXQWXDFLRQHVEDMDVHQODFXHVWLyQQ~PHURWUDEDMHVREUHHO
capítulo «Gestión del tiempo».

6LREWLHQHSXQWXDFLRQHVEDMDVHQHOtWHPHOFDStWXORVREUH©6ROXFLyQ
GHSUREOHPDVªOHSHUPLWLUiPHMRUDUVXQLYHOGHKDELOLGDG
PROGRAMA DE ENTRENAMIENTO 97

Puntuación total

5HÁHMD HO QLYHO HQ HO TXH PDQLÀHVWD ODV KDELOLGDGHV WUDEDMDGDV HQ HO
libro. Observe esta puntuación para tener una «idea general» de su nivel en
el desarrollo de la habilidad.

+DVWD  SXQWRV QR GRPLQD FDVL OD WRWDOLGDG GH ORV FRPSRUWDPLHQWRV
UHIHULGRV3UHVHQWDQXPHURVDViUHDVGRQGHQHFHVLWDPHMRUDU&RPLHQFHWUD-
EDMDQGR VREUH ORV FRPSRUWDPLHQWRV GRQGH KD REWHQLGR XQ UHVXOWDGR PiV
EDMR7HQJDSDFLHQFLD\VHDSHUVLVWHQWH

Entre 25 y 40 puntos: ha indicado un nivel medio en los enunciados pro-


SXHVWRV0DQLÀHVWDDVtiUHDVDPHMRUDUHQVXVKDELOLGDGHVGHDXWRJHVWLyQ
&RPLHQFHDWUDEDMDUVREUHDTXHOORVFRPSRUWDPLHQWRVFRQSXQWXDFLRQHVPiV
EDMDV

Entre 41 y 64 puntos: en general, se ha valorado por encima de la media


HQPXFKDVGHODVFRQGXFWDVSUHVHQWDGDV0DQLÀHVWDXQEXHQQLYHOGHGHVD-
rrollo en las habilidades para la autogestión. No obstante, observe cuáles
VRQVXVSXQWXDFLRQHVPiVEDMDV\WUDEDMHVREUHHVRVFRPSRUWDPLHQWRV

0iVGHSXQWRVPDQLÀHVWDXQQLYHOPX\DOWR+DUHVSRQGLGRTXHGR-
PLQDELHQFDVLODWRWDOLGDGGHORVFRPSRUWDPLHQWRVHÀFDFHVHQODDXWRJHV-
WLyQ$~QDVtUHSDVHODVHVWUDWHJLDVSUHVHQWDGDVSDUDWUDEDMDUDTXHOODVTXH
podría perfeccionar.

Registro de evaluaciones
/HDFRQVHMDPRVTXHUHDOLFHHYDOXDFLRQHVJHQHUDOHVSHULyGLFDPHQWH3XHGH
usar el siguiente registro de evaluación para anotar los resultados de sucesivas
evaluaciones generales. Esto le permitirá comprobar su evolución con respecto
a las habilidades abordadas en el programa. Anote en cada columna la fecha
GHHYDOXDFLyQ\HQFDGDÀODODSXQWXDFLyQTXHVHFRUUHVSRQGHFRQVXUHVSXHVWD
DFHUFDGHOFRPSRUWDPLHQWR$QRWHHQOD~OWLPDÀODODSXQWXDFLyQWRWDOUHVXO-
tante de la suma de todas las casillas de una misma columna.
98 AUTOGESTIÓN

COMPORTAMIENTOS Fecha de evaluación

1. Conozco bien tanto mis cualidades positivas


como mis limitaciones, lo cual me permite
afrontar con seguridad y optimismo nuevas
tareas.

2. No me bloqueo ante el fracaso. Asumo mis


propios errores y trato de solucionarlos, y, al
mismo tiempo, aprender de ellos.

3. Consigo dominar mis emociones evitando


que éstas me hagan reaccionar de manera
impulsiva o agresiva.

4. Expreso mis peticiones y críticas


asertivamente, es decir, sin herir al otro
SHURORJUDQGRPLREMHWLYR

5. Me esfuerzo por entender a otras personas


que tienen formas de pensar, sentir o
comportarse distintas a la mía.

6. Exploro y promuevo activamente el cambio


en mi entorno pues lo considero una fuente
GHPHMRUD\DSUHQGL]DMH

7. Empleo el tiempo adecuado en realizar


mis actividades obteniendo resultados de
calidad.

8. Propongo diferentes soluciones válidas a un


problema y analizo cuál puede ser la más
HÀFD]VLQOLPLWDUPHDORTXHSDUHFHPiV
evidente.

Puntuación total
Anexo 3: Entrenamiento

El entrenamiento es el proceso mediante el cual ponemos en práctica aque-


OORTXHKHPRVDSUHQGLGRFRQHOREMHWLYRGHTXHODVHVWUDWHJLDVDVLPLODGDVDOR
largo de los capítulos del libro se incorporen a nuestro repertorio habitual de
FRPSRUWDPLHQWRV$VtHOHQWUHQDPLHQWRHVXQSURFHVRGHDSUHQGL]DMHSURJUH-
sivo y duradero.

+HPRVGLVHxDGRXQD©ÀFKDGHHQWUHQDPLHQWRªSDUDFDGDXQRGHORVFDStWX-
ORVWUDEDMDGRVHQHOOLEURDÀQGHTXHOOHYHDODSUiFWLFDORVFRPSRUWDPLHQWRV
TXHOHKDUiQPRVWUDUVHHÀFD]HQFDGDXQDGHODVKDELOLGDGHV&RPRYHUiPiV
adelante, le facilitamos también una plantilla para realizar una gestión integra-
da de su proceso de entrenamiento.

(QHOVLJXLHQWHHMHPSORHVWiQFRPHQWDGRVORVGLIHUHQWHVDVSHFWRVTXHFRP-
SRQHQXQDÀFKDGHHQWUHQDPLHQWR
100 AUTOGESTIÓN

Comportamientos

Me muestro abierto e interesado por lo nuevo,


&RPSRUWDPLHQWRVTXHVRQREMHWRGH 1. Evaluar. me pregunto activamente qué se puede cambiar
entrenamiento para la habilidad 2: SDUDPHMRUDU\FyPRKDFHUOR
coordinación de esfuerzos.

Analizo el fracaso constructivamente, y me


2. Analizar. centro en aquellas causas que se pueden
cambiar en el futuro.

0H DWULEX\R FRQ REMHWLYLGDG OD SDUWH GHO


3. Atribuir. fracaso que me corresponde y lo utilizo para
PHMRUDU\DSUHQGHU

Describa brevemente la situación en que le conviene entrenar los


(MHPSORGHXQDVLWXDFLyQHQODTXH
comportamientos:
una persona va a poner en práctica
los comportamientos de la habilidad. $QiOLVLVLQLFLDOSDUDODSXHVWDHQHMHFXFLyQGHOQXHYRSUR\HFWR

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
(MHPSORGHDXWRHYDOXDFLyQQLYHOGH 8 x 8 x
dominio expresado por la persona
antes y después del entrenamiento 7 7
de la habilidad. 6 6 x x
5 5
4 x 4
3 x 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

3ODQLÀFDFLyQ: anote aquí la fecha prevista para el


Periodo reservado para la entrenamiento.
puesta en práctica de la habilidad.
Semana del 12 de abril
PROGRAMA DE ENTRENAMIENTO 101

Para entrenar efectúe los siguientes pasos según el orden establecido:

/RV FRPSRUWDPLHQWRV REMHWR GH VX HQWUHQDPLHQWR UHÁHMDQ OR


presentado en la descripción de la habilidad y las estrategias
de ayuda para la práctica que se muestran en cada capítulo.
1. Estudiar los
3RUWDQWRODUHDOL]DFLyQHÀFD]GHHVWRVFRPSRUWDPLHQWRVVXSRQH
comportamientos.
también la manifestación adecuada de la habilidad. Estudie el
VLJQLÀFDGRGHORVFRPSRUWDPLHQWRV\ODVHVWUDWHJLDVTXHGHEHUi
emplear para ponerlos en práctica.

Anote, para los comportamientos propuestos, la situación o


2. Situación de
situaciones en las que va a poner en práctica las estrategias
entrenamiento.
aprendidas.

Realice la autoevaluación inicial teniendo en cuenta su grado de


3. Autoevaluación inicial. dominio de los comportamientos, así tendrá una valoración del
punto de partida.

$QRWHODIHFKDRIHFKDVHQODVTXHYDDWUDEDMDUORVFRPSRUWDPLHQWRV
HQODVVLWXDFLRQHVÀMDGDVDQWHULRUPHQWH3XHGHD\XGDUVHGHOD©KRMD
3ODQLÀFDFLyQ
de gestión integrada del entrenamiento» que le proporcionamos
más adelante.

Practique. Ponga en marcha las estrategias aprendidas en las


5. Práctica en situación VLWXDFLRQHVTXHKDGHWHUPLQDGR\HQODVIHFKDVTXHKDSODQLÀFDGR
real. Sea consciente de su práctica, es decir, haga un esfuerzo especial
para actuar según las estrategias mostradas.

8QDYH]ÀQDOL]DGRHOSHULRGRGHHQWUHQDPLHQWRYXHOYDDODÀFKD
GHUHJLVWURGHODVHYDOXDFLRQHV \FRPSOHWH VXHYDOXDFLyQ ÀQDO
7UDVODHYDOXDFLyQÀQDOGHFDGDKDELOLGDGHVWXGLHVXVUHVXOWDGRV
y decida la siguiente acción a realizar:

$XWRHYDOXDFLyQÀQDO ‡(QWUHQDU GH QXHYR OD KDELOLGDG HQ OD PLVPD VLWXDFLyQ SDUD
PHMRUDUVXDFWXDFLyQ
‡3UDFWLFDUODKDELOLGDGHQXQDVLWXDFLyQGLVWLQWDSDUDJHQHUDOL]DU
VXDSUHQGL]DMH
‡3UDFWLFDURWUDKDELOLGDGGLVWLQWDDODTXH\DGRPLQD

$QRWH WRGRV ORV GDWRV UHODWLYRV DO HQWUHQDPLHQWR HQ OD ©KRMD
7. Gestión integrada del
de gestión integrada del entrenamiento» para poder tener una
entrenamiento.
visión completa de todo su proceso.
102 AUTOGESTIÓN

+RMDGHJHVWLyQLQWHJUDGDGHOHQWUHQDPLHQWR

)(&+$ +$%,/,'$' 6,78$&,Ð1 (9$/8$&,Ð1'(/(175(1$0,(172

,1,&,$/ ),1$/
6(0$1$
&RPSRUWDPLHQWR

&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
&RPSRUWDPLHQWR

)(&+$ +$%,/,'$' 6,78$&,Ð1 (9$/8$&,Ð1'(/(175(1$0,(172

,1,&,$/ ),1$/
6(0$1$
&RPSRUWDPLHQWR

&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
&RPSRUWDPLHQWR

)(&+$ +$%,/,'$' 6,78$&,Ð1 (9$/8$&,Ð1'(/(175(1$0,(172

,1,&,$/ ),1$/
6(0$1$
&RPSRUWDPLHQWR

&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
&RPSRUWDPLHQWR

)(&+$ +$%,/,'$' 6,78$&,Ð1 (9$/8$&,Ð1'(/(175(1$0,(172

,1,&,$/ ),1$/
6(0$1$
&RPSRUWDPLHQWR

&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
&RPSRUWDPLHQWR

)(&+$ +$%,/,'$' 6,78$&,Ð1 (9$/8$&,Ð1'(/(175(1$0,(172

,1,&,$/ ),1$/
6(0$1$
&RPSRUWDPLHQWR

&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
&RPSRUWDPLHQWR

)(&+$ +$%,/,'$' 6,78$&,Ð1 (9$/8$&,Ð1'(/(175(1$0,(172

,1,&,$/ ),1$/
6(0$1$
&RPSRUWDPLHQWR

&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
&RPSRUWDPLHQWR
PROGRAMA DE ENTRENAMIENTO 103

)LFKD$XWRFRQÀDQ]D
Comportamientos

7UDWR GH GHWHFWDU \ DQDOL]DU REMHWLYDPHQWH PLV


1. Detectar y analizar. cualidades positivas y mis limitaciones para cada tarea
a la que me enfrento.

Antes de actuar me paro a pensar en actuaciones


2. Detenerse a pensar.
similares del pasado para entender de qué soy capaz.

'XUDQWH OD HMHFXFLyQ GH OD WDUHD PH GLJR PHQVDMHV


3. Darse ánimos.
positivos como «Soy capaz de hacerlo».

Después de mi actuación me felicito por los logros y


4. Analizar y
DQDOL]R HQ TXp KH IDOODGR SDUD SODQWHDUPH REMHWLYRV
recompensarse.
GHPHMRUD

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 4 1 2 3 4
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
104 AUTOGESTIÓN

Ficha 2. Afrontar el fracaso

Comportamientos

Me muestro abierto e interesado por lo nuevo, me


1. Evaluar. pregunto activamente qué se puede cambiar para
PHMRUDU\FyPRKDFHUOR

Analizo el fracaso constructivamente, y me centro en


2. Analizar.
aquellas causas que se pueden cambiar en el futuro.

0HDWULEX\RFRQREMHWLYLGDGODSDUWHGHOIUDFDVRTXH
3. Atribuir.
PHFRUUHVSRQGH\ORXWLOL]RSDUDPHMRUDU\DSUHQGHU

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
PROGRAMA DE ENTRENAMIENTO 105

Ficha 3. Autocontrol

Comportamientos

(PSOHRWpFQLFDVGHDXWRFRQWUROSRUHMHPSOR©FRQWDU
1. Detenerse a pensar. hasta diez», para impedir reaccionar de manera
impulsiva o agresiva.

2. Analizar. $QDOL]RFRQREMHWLYLGDGTXpHVWiVXFHGLHQGR\SRUTXp

3. Responder con Expreso abiertamente mi punto de vista sin resultar


asertiviad. agresivo y considerando la opinión del otro.

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
106 AUTOGESTIÓN

Ficha 4. Asertividad

Comportamientos

Ante las estrategias manipulativas de otros, me


1. Decir «no». PXHVWUR ÀUPH \ FRQVLJR GHFLU ©QRª D SHWLFLRQHV QR
razonables.

Me muestro asertivo al hacer peticiones, y logro mi


+DFHUSHWLFLRQHV
REMHWLYRVLQGDxDUODUHODFLyQFRQODRWUDSHUVRQD

3. Realizar críticas Realizo críticas constructivas procurando no molestar


asertivas. a otros.

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
PROGRAMA DE ENTRENAMIENTO 107

Ficha 5. Empatía

Comportamientos

1. Escuchar Demuestro a mi interlocutor que lo escucho activamente,


activamente. es decir, que estoy interesado en entenderle.

Utilizo las preguntas como herramienta para obtener


2. Indagar.
más información acerca del punto de vista a explorar.

3. Transmitir $\XGR D OD RWUD SHUVRQD D FRQÀDU HQ Vt PLVPD SDUD
seguridad. promover el cambio.

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
108 AUTOGESTIÓN

Ficha 6. Adaptación al cambio

Comportamientos

Me muestro abierto e interesado por lo nuevo, me


1. Estar alerta. pregunto activamente qué se puede cambiar para
PHMRUDU\FyPRKDFHUOR

Recopilo información acerca del cambio y de sus


2. Informarse.
implicaciones.

$QDOL]R GHWDOODGDPHQWH HO FDPELR \ ODV YHQWDMDV TXH


3. Analizar. éste me reportará, así como la forma de hacer frente a
ODVSRVLEOHVGLÀFXOWDGHV

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
PROGRAMA DE ENTRENAMIENTO 109

Ficha 7. Gestión del tiempo

Comportamientos

0HDMXVWRDXQDSODQLÀFDFLyQDFRUWRPHGLR\ODUJRSOD]R
3ODQLÀFDUWDUHDV asignando a cada actividad el tiempo de dedicación
requerido.

Estudio la importancia y la urgencia de mis tareas para


2. Tomar decisiones. WRPDU GHFLVLRQHV HÀFDFHV TXp KDFHU R QR GHOHJDU R
posponer).

3. Controlar &RQWUROR HÀFD]PHQWH ODV LQWHUUXSFLRQHV SDUD TXH QR


distractores. LPSLGDQRUHWUDVHQODFRQVHFXFLyQGHPLVREMHWLYRV

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
110 AUTOGESTIÓN

Ficha 8. Solución del problemas

Comportamientos

'HÀQR H[DFWDPHQWH FXiO HV HO SUREOHPD D TXLpQHV


'HÀQLUHOSUREOHPD
afecta y cómo quedaría resuelto.

([SORUR \ DGRSWR OD VROXFLyQ TXH PiV HÀFD]PHQWH


2. Explorar soluciones. resuelve el problema de entre todas las alternativas
posibles.

3. Establecer la Elaboro un plan de acción (qué, quién y cómo) para


solución. hacer operativa la solución y llevarla a la práctica.

Situación

Autoevaluación INICIAL Autoevaluación FINAL


10 10
9 9
8 8
7 7
6 6
5 5
4 4
3 3
2 2
1 1
1 2 3 1 2 3
Comportamientos Comportamientos

PlaniÀcación fecha
3ODQLÀFDFLyQ fechaprevista
prevista
BIBLIOGRAFÍA

ACOSTA VERA, José María, 8VRHÀFD]GHOWLHPSR&yPRDOFDQ]DUHOp[LWRVLQ


estrés, Barcelona: Gestión, 2001.

ALONSO MONREAL, Carlos, ¿Qué es la creatividad?, Madrid: Biblioteca Nueva,


2000.

BALLESTER ARNAL, Rafael, Habilidades sociales: evaluación y tratamiento,


Madrid: Síntesis, 2002.

BEAUDOT, Alain, La creatividad, Barcelona: Nancea, Serie Educación hoy:


estudios, 1980.

BEAUREGARD, Louise-Ann, Autoestima: para quererse más y relacionarse


mejor, Madrid: Narcea, 2005.

BOUILLERCE, Brigitte, &yPR PRWLYDUVH HQ OD YLGD SHUVRQDO \ SURIHVLRQDO,


Barcelona: Larousse, 2004.

BRANDEN, Nathaniel, Los seis pilares de la autoestima, Barcelona: Paidós


Ibérica, 2005.

BUENDÍA VIDAL, José y RAMOS, Francisco (coords.), Empleo, estrés y salud,


Madrid: Pirámide, 2001.

CABALLO, Vicente, Teoría, evaluación y entrenamiento de las habilidades


sociales, Valencia: Promolibro, 1987.

CASTANYER, Olga y ORTEGA, Estela, ¿Por qué no logro ser asertivo?, Bilbao:
Desclée de Brouwer, 2001.

CASTANYER, Olga: /DDVHUWLYLGDGH[SUHVLyQGHXQDVDQDDXWRHVWLPD, Bilbao:


Desclée de Brouwer, 2004.
112 AUTOGESTIÓN

CRABTREE, Tom, /D FRQÀDQ]D HQ XQR PLVPR \ OD SURSLD HVWLPDFLyQ, Bilbao:
Deusto, 1992.

'$9,60DUWKD0F.$<0DWWKHZ\(6+(/0$1(OL]DEHWK Técnicas de autocontrol


emocional, Barcelona: Martínez Roca, 2006.

FERNÁNDEZ PELLITERO, Manuel, El estrés humano. Un problema individual con


solución8QLYHUVLGDG3RQWLÀFLDGH6DODPDQFD

FERNÁNDEZ ROMERO, Andrés, &UHDWLYLGDG H ,QQRYDFLyQ HQ HPSUHVDV \


organizaciones: técnicas para la resolución de problemas, Madrid: Díaz de
Santos, 2005.

GARRATT, Sally, Organice su tiempo, Barcelona: Gestión 2000.

GERVILLA CASTILLO, Ángeles (ed.), &UHDWLYLGDG DVSHFWRV SVLFROyJLFRV


educativos y sociales, Madrid: Dykinson, 2005.

*(59,//$ &$67,//2 ÉQJHOHV \ 48(52 *(59,//$ -RVp 0DUtD &UHDWLYLGDG


e inteligencia emocional: dimensiones básicas del mundo empresarial,
Madrid: Dykinson, 2006.

GIL RODRÍGUEZ, Francisco y LEÓN RUBIO, José María (eds.), Habilidades


sociales: teoría, investigación e intervención, Madrid: Síntesis, 1998.

*/((6621.HUU\(OSURJUDPDGHHÀFDFLDSHUVRQDOFyPRFRQVHJXLURUJDQL]DU
su trabajo para hacer más en menos tiempo, Madrid: Gestión 2001.

GOLEMAN, Daniel,,QWHOLJHQFLDHPRFLRQDO%DUFHORQD.DULyV

*2/(0$1 'DQLHO .$8)0$1 3DXO \ 5$< 0LFKDHO El espíritu creativo,


Barcelona: Javier Vergara Editor, 2000.

+$(866/(5 ,VDEHO 0 \ 0,/,&,& 1HYD &RQÀDU HQ XQR PLVPR SURJUDPD GH
autoestima, Madrid: CEPE (Ciencias de la Educación Preescolar y Especial),
1996.

+$5(%HYHUOH\6HDDVHUWLYRODPDQHUDSRVLWLYDGHFRPXQLFDUVHFRQHÀFDFLD,
Barcelona: Gestión, 2003.

+(:6721(0LOHVet altri,,QWURGXFFLyQDODSVLFRORJtDVRFLDO, Barcelona: Ariel,


1991.

-2+16216SHQFHU ¿Quién se ha llevado mi queso?: una manera sorprendente


de afrontar el cambio en el trabajo y en la vida privada, Barcelona: Empresa
Activa, 2007.
PROGRAMA DE ENTRENAMIENTO 113

.(//<-HIIUH\$Entrenamiento de las habilidades sociales: guía práctica para


intervenciones, Bilbao: Desclée de Brouwer, 1994.

LAMATA COTANDA, Rafael, La actitud creativa: ejercicios para trabajar en


grupo la creatividad0DGULG1DUFHD&RQVHMHUtDGH(GXFDFLyQ

LARSEN, Tony, (OSRGHUGHODFRQÀDQ]DHQXQRPLVPRSDUDYLYLUPHMRU, Madrid:


Deusto, 1992.

/Ð3(= )58726 -0 52'5Ì*8(= 021(2 0 \ +8(57$6 -$ ,QYHVWLJDFLyQ


y práctica en motivación y emoción, Boadilla del Monte (Madrid): Antonio
Machado Libros, 2005.

0F.$<0DWWKHZ'$9,60DUWKD\)$11,1*3DWULFNTécnicas cognitivas para el


tratamiento del estrés, Barcelona: Martínez Roca, 1998.

025$ 0DULVRO \ 5$,&+ 5RVD 0DUtD Autoestima: evaluación y tratamiento,


Madrid: Síntesis, 2005.

MUÑOZ ADÁNEZ, Alfredo, Métodos creativos para organizaciones, Madrid:


Pirámide, 2006.

1(,'+$5'7(-RVHSK:(,167(,10DOFRP\&215<5REHUWSeis programas
para prevenir y controlar el estrés, Madrid: Deusto, 1989.

OLIVARES RODRÍGUEZ, José y MÉNDEZ CARRILLO, Francisco Xavier, Técnicas de


PRGLÀFDFLyQGHFRQGXFWD Madrid: Biblioteca Nueva, 2005.

ORTEGA PORRAS, Manuel, Estrés y satisfacción del rendimiento del ejecutivo,


Madrid: Universidad Complutense, Facultad de Psicología (tesis), 1982.

5(&,2 6É1&+(= +LODULR &UHDWLYLGDG HQ OD VROXFLyQ GH SUREOHPDV, Alcalá de
Guadaira (Sevilla): MAD, 2005.

REDORTA, Josep, (PRFLyQ \ FRQÁLFWR DSUHQGD D PDQHMDU ODV HPRFLRQHV,


Barcelona: Paidós, 2006.

6+(/721 1HOGD \ %85721 6KDQRQ Asertividad. Haga oír su voz sin gritar,
Madrid: Fundación Confemetal, 2004.

72:( /HH &UHDWLYLGDG ¢3RU TXp QR VH PH RFXUULy", Madrid: Fundación
Confemetal, 2004.

ZACCAGNINI, José Luis, Qué es inteligencia emocional: la relación entre


pensamientos y sentimientos en la vida cotidiana, Madrid: Biblioteca Nueva,
2004.