Académique Documents
Professionnel Documents
Culture Documents
&ŽƌKĸĐŝĂůhƐĞKŶůLJ
Dr. A. J. Kachhiapatel
Director Of Animal Husbandry
Dr. F. S. Thakar
Joint Director OF Animal Husbandry (Statistics)
Dr. K. V. Prajapati
I/C Deputy Director (Statistics)
Shri H. V. Shah
5HVHDUFK2I¿FHU
Staff
Smt. I. J. Chauhan
(Statistical Assistant)
I
II
PR E FAC E
gigantic task that involved sincere and dedicated efforts which are appreciated and
acknowledged.
Appreciations are due to Dr. F.S. Thakar, Joint Director of Animal Husbandry
(Statistics), Dr. K.V. Prajapati, Deputy Director (Statistics) and his team of EDP cell of
(Dr. A. J. Kachhiapatel)
Director
Directorate of Animal Husbandry
Gujarat State, Gandhinagar
Date : 10/09/18
Place : Gandhinagar
III
IV
From the Desk………….
It is an enormus pleasure that the Department of Animal Husbandry,
Gujarat, is publishing the 39th publication “Bulletin of Animal Husbandry and
Dairying Statistics : 2017-18 which is consolidated with reliable database of
Animal Husbandry sector in the State..
ǡ ϐ
economic activity next to Agriculture. It is an ancestral and easiest profession for
skilled, semi-skilled as well as unskilled persons. The livestock sector is the power
house of growth. Gujarat state have remarkable position in the country as far as
livestock health, wealth and development are concerned.
Gujarat state coverage for the veterinary services like mass
ǡ ǡ
ǡ ϐ
ǡ
SHCcampaign , Mobile veterinary dispensary service for 10 village , Chief Minister’s
Free animal treatments at veterinary dispensaries& Polyclinics. Pashu arogya
mela , Krishi mahotsav are the major steps taken by Department for animal
health care & extension services.
Centrally Sponsored programmes like National Dairy Mission, National
Dairy plan, ASCAD, FMD-CP, Fodder development programmes , NADRES, RKVY
ǡ
ϐ
sector of the state.
Dairy Co-operative sector is well established & equipped in the state,
which is being taken as model for other state.. The estimate of major livestock
products like milk, egg, wool production has been considerably increasing in the
last decade.
The Statistics branch , EDP cell and Livestock Census cell are jointly
working at the Directorate of Animal Husbandry. They have jointly collected the
statistical data , compiled & analyzed it in some useable form. These statistical
information on various relevant aspect of livestock sector will help in evaluation
on socio-economic, environment and food resources.
V
VI
Index
Chapter Table
Content Page No.
No. No.
1 2 3 4
1 Animal Husbandry At a Glance
2 Livestock Census
VII
Chapter Table
Content Page No.
No. No.
1 2 3 4
3 3.9 No. of Castrations performed and Cases treated 31
Cases treated in the Sexual Health Control and Surgical camps organised
3.12 34
by Veterinary Polyclinics 2017-18
Cases treated in the Sexual Health Control and Surgical camps organised
3.13 35
by I.C.D.P. Centres. 2017-18
3.14 'LVWULFWZLVH$YLDQ,QÀXHQ]D6DPSOHV 36
4.7 1RRI&HQWUHV6XEFHQWUHVKDYLQJ$UWL¿FLDO,QVHPLQDWLRQ)DFLOLWLHV 52
4.8 $UWL¿FLDO,QVHPLQDWLRQZRUNGRQHDW$UWL¿FLDO,QVHPLQDWLRQ&HQWUHV 54
4.11 Work Done Under Central Head Registration Scheme, Ahmedabad Unit 57
VIII
Chapter Table
Content Page No.
No. No.
1 2 3 4
5 Poultry Development
IX
Chapter Table
Content Page No.
No. No.
1 2 3 4
8 Dairy Development
8.11 Strengthening of Infrastructure for quality and clean Milk Production(CSS) 107
8.12 Infrastructure facility provided to dairy union under the State Plan 108
Assistance for establishment of infrastructure to village Milk Co-op. Societies &
8.13 109
Dist. Co- op. Milk Producers’Union Under general category .
Assistance for establishment of infrastructure to village Milk Co-op. Societies
8.14 110
& Dist. Co- op. Milk Producers’Union Under Scheduled cast category
Assistance for establishment of infrastructure to village Milk Co-op. Societies
8.15 111
& Dist. Co- op. Milk Producers’ Union 96 Under Scheduled Tribe category
Assistance Provide under the Scheme of National Mission of Protein
8.16 112
Suppliment (NMPS) , 2012-13.
Assistance Provide under the Scheme of National Mission of Protein
8.17 113
Suppliment (NMPS) 2012-13
Assistance Provide under RKVY for establishment of Milk Processing
8.18 113
Plant - 2011-12 & 2012-13 and 2014-15
Assistance Provided under RKVY for establishment of AMCS & Milking
8.19 114
Machine-2011-12, 2012-13, 2014-15 and 2015-16.
Assistance Provided under RKVY for establishment of AMCS & Milking
8.20 115
Machine-2015-16.
X
Chapter Table
Content Page No.
No. No.
1 2 3 4
8 Assistance Provide under RKVY for establishment of Bulk Milk Cooler
8.21 116
Plant - At Dairying Sector - 2010-11,2011-12 and 2014-15.
Information regarding Milk Producers’ Co-operative Unions of the State
8.22 117
: 2014-15
9 Fodder Development
9.2 Target and Achievement under different Fodder Dev. Activities 124
Production and Distribution of Fodder on Village Fodder / Seed Production
9.3 125
Farms
Production and Distribution of Fodder on Farms (attached to Breeding
9.4 126
Farms)
10 Production Estimates
XI
Chapter Table
Content Page No.
No. No.
1 2 3 4
13 Animal Husbandry Extention
Annexure
Human Population Census-2011 & Livestock Products : 2017-18 of
1 179
Gujarat State Comparision with India
XII
1
2
1.1 Livestock Population-2012(P) Gujarat State, Compare With Year - 2007.
Sr. &ODVVL¿FDWLRQ Year Percentage
No. 2007 2012 (P) increase or
decrease in
2012 (P) over
2007
1 2 3 4 5
Cattle
A. Crossbred
(1) Under 1 year 69424 Age group -
(2) 1 to 2.5 year 50263 has been -
(I) Male changed.
(3) Over 2.5 years 91798 -
(4) Total Male 211485 192542 -8.96
(1) Under 1 year 177515 323129 82.03
(2) 1 to 2.5 year 180669 362569 100.68
(3) Over 2.5 years
(a) In milk as on 15-10-2012 397177 732208 84.35
(II) Female (b) Dry 127799 230633 80.47
(c )Not calve even once
47544 85622 80.09
(with other)
(d) Total (a to c) 572520 1048463 83.13
(4) Total Female 930704 1734161 86.33
3
1.1 Conti.
Sr. &ODVVL¿FDWLRQ Year Percentage
No. 2007 2012 (P) increase or
decrease in
2012(P) over
2007
1 2 3 4 5
Buffaloes
(1) Under 1 year 544933
Age group
-
(2) 1 to 2.5 year 301926 has been -
(I) Male changed.
(3) Over 2.5 years 169272 -
(4) Total Male 1016131 835775 -17.75
(1) Under 1 year 1363308 1950283 43.06
(2) 1 to 3 year 1564758 1953765 24.86
2
(3) Over 3 years
(a) In milk as on 15-10-2012 3040460 3534030 16.23
(II) Female
(b) Dry 1349517 1544788 14.47
(c )Not calve even once (with other) 439395 566933 29.03
(d) Total (a to c) 4829372 5645751 16.90
(4) Total Female 7757438 9549799 23.11
(III) Total Buffaloes (I + II) 8773569 10385574 18.37
3 Sheep 2001564 1707750 -14.68
4 Goats 4640137 4958972 6.87
5 Horses & Ponies 14003 18264 30.43
6 Mules & Donkeys 50198 38993 -22.32
7 Camels 38454 30415 -20.91
8 Pigs 21785 4279 -80.36
9 Total Livestock 23515434 27128200 15.36
10 Rabbits 9108 8658 -4.94
11 Dogs 268971 253312 -5.82
4
1.2 Veterinary Services and Animal Health 2017 - 18.
Kamdhenu University
4 Polyclinic 33
Rural Primary Veterinary Health Care Centres (under R. P. Units, Sheep &
10 178
Poultry Schemes)
Epidemiology Units
(ii) Poultry 4
5
1.3 Cattle and Buffalo Development 2017 -18.
1 2 3
Gasushalas 667
(c ) Others 359
4 Panjarapoles 269
5 (ii) Blocks 26
6
1.4 Poultry Development 2017-18.
Sr. No Item Number
1 2 3
1 Regional Poultry Breeding Farm 3
2 District Poultry Breeding Farm 9
Broiler Farm
3 (A) Government 4
(B) Private 2434
Layer Farm
4 (A) Government 5
(B) Private 197
5 Duck Breeding Farm 0
6 Poultry Demonstration Centers 4
Hatcheries
7 (A) Government 5
(B) Private 33
8 Chick Rearing Centers 7
Intesive Poultry Development Program
9 (i) Blocks 12
(ii) Service Centers 65
District Poultry Extension Farm
10 (i) Blocks 5
(ii) Service Centers 20
Poultry Feed Compounding Units
(A) Government :
(i) Nos. 5
11 (ii) Capacity per shift (M.T.) 32
(B) Private :
(i) Nos. 38
(ii) Capacity per shift (M.T.) ---
12 Poultry Farmers Co-Operative Societies ---
13 Poultry Feed Testing Laboratory 1
14 Poultry farmers Training Centers 17
15 Farmers Trained in Poultry Farming 6740
16 Poultry research station under Gujarat Agriculture University 1
17 Poultry Disease Diagnosis Laboratories 2
18 Poultry Vaccine Production Unit 1
19 Pullorum Testing Unit 3
7
1.5 Sheep, Goat and Wool Development 2017-18.
Sr. No. Item Nos.
1 2 3
Sheep Breeding Farm 4
1 (i) under Animal Husbandry Department 3
(ii) under GSWDC 1
2 Goat Breeding Farm 5
Intensive Sheep Development Programme
(A) Blocks 5
(i) under Animal Husbandry Department 3
3 (ii) under GSWDC 2
(B) Service Centers 86
(i) under Animal Husbandry Department 41
(ii) under GSWDC 45
District Sheep And Wool Extension Programme
(A) Blocks 6
(i) under Animal Husbandry Department 4
(ii) under GSWDC 2
4
(B) Service Centers 91
(i) under Animal Husbandry Department 31
(ii) under GSWDC 15
(iii) LSSBF Centers GSWDC 45
5 Sheep Centers for Migratory Flocks 2
6 Wool Analysis Laboratory (under Dept. of A. H.) 1
7 Wool Grading Centers (under GSWDC) 1
8 Wool Utilisation Centers (under GSWDC) --
9 Ram Depots 5
10 National Demonstration Units for Goats 1
11 Wool Testing Center (under GSWDC) --
12 Integrated Sheep & Wool Development Project (Under GSWDC) 1
GSWDC = Gujarat Sheep & Wool Development Corporation SBF shifted to Morabi
LSSBF = Large Scale Sheep Breeding Farm
8
1.6 Other Livestock 2017-18.
Sr. Item Nos.
No.
1 2 3
1 Camel Breeding Farms 1
2 Horse Breeding Farm 1
3 Horse & Donkey Breeding Farms 1
4 Horse Service centers - Kathi Breed 10
5 Horse seervice centers - Marwadi Breed 2
9
10
11
12
D - 1 : 20th Livestock Census-2017 (Breed wise)
13
Scope of Census
(1) The 20th Livestock Census will cover all important breed wise species. Cattle,
Buffalo, Sheep, Goat, Camel, Pigs, Dogs, and Poultry as well as agriculture
equipments used for livestock keeping.
(2) The Livestock Census covers all the 18225 Villages including villages in forest
areas, 248 Talukas, 33 Districts, 162 Nagarpalikas & 8 Maha Nagarpalikas.
During Year : 2017-18 several activities were be carried out within the
stimulated period for 20th Livestock Census e.g.
(1) Preparation of Local Govt. Directory.
0DSSLQJRIVFUXWLQ\RI¿FHUVVXSHUZLVHUDQGHQXPHUDWRUVIRU/*'LUHFWRU\
(3) Purchase process to procure Tablet P.C. through G.L.D.B., Gandhinagar.
-----------
14
2.1 Livestock Population of Gujarat State From 1951 to 2012(P).
(‘000 Nos.)
Sr. Year Breedable Cattle Total Breedable Buffaloes Total
No. In milk Dry NCEO Cattle In milk Dry NCEO Buffaloes
1 2 3 4 5 6 7 8 9 10
1 1951 845 548 140 5345 987 421 130 2514
2 1956 791 708 124 6055 896 461 113 2640
3 1961 805 873 144 6557 899 655 130 2917
4 1966 813 813 136 6544 1016 639 146 3140
5 1972 903 744 150 6457 1095 779 166 3468
6 1977 835 704 150 6006 1224 685 176 3473
7 1982 1072 752 133 6994 1620 790 148 4443
8 1988 1025 647 109 6240 1729 721 133 4502
9 1992 1315 683 137 6803 2085 899 164 5268
10 1997 1481 689 262 6749 2547 986 402 6285
11 2003 1657 781 184 7424 2794 1144 239 7140
12 2007 1732 797 297 7976 3040 1350 439 8774
2012
13 2462 1098 326 9984 3534 1545 454 10385
(P)
2.1 Conti...
(‘000 Nos.)
Sr. Year Sheep Goat Other * Total Livestock Total
No. Livestock Poultry
1 2 11 12 13 14 15
1 1951 1574 2326 218 11977 1137
2 1956 1744 2600 268 13312 1854
3 1961 1481 2223 277 13454 2048
4 1966 1652 2771 230 14338 2324
5 1972 1722 3210 241 15098 2736
6 1977 1592 3084 251 14406 3426
7 1982 2357 3300 1346 18440 3572
8 1988 1559 3584 1458 17343 5492
9 1992 2027 4241 1333 19672 5657
10 1997 2158 4386 1393 20970 7231
11 2003 2062 4541 1680 22846 8153
12 2007 2002 4640 403 23794 13373
2012
13 1708 4959 354 27390 15006
(P)
*Other Livestock includes Horses & Ponies, Mules & Donkeys, Camel, DOG, Pig & Rabbit.
15
2.2 Livestock Population and Growth Rate over previous Livestock Census 1951 to 2012(P).
(‘000 Nos.)
Sr. Year Cattle Buffalo Sheep Goat Horses & Ponies Camels
No. Nos. Growth Nos. Growth Nos. Growth Nos. Growth Nos. Growth Nos. Growth
rate rate rate rate rate rate
(%) (%) (%) (%) (%) (%)
1 2 3 4 5 6 7 8 9 10 11 12 13 14
1 1951 5345 - 2514 - 1574 - 2326 - 79 - 36 -
2 1956 6055 13.28 2640 5.01 1744 10.8 2606 12.04 101 27.85 44 22.22
3 1961 6557 8.29 2917 10.49 1481 -15.08 2223 -14.7 113 11.88 44 0
4 1966 6544 -0.2 3140 7.64 1652 11.55 2771 24.65 70 -38.05 46 4.55
5 1972 6457 -1.33 3468 10.45 1722 4.24 3210 15.84 63 -10 63 36.96
6 1977 6006 -6.98 3473 0.14 1592 -7.55 3084 -3.93 76 20.63 56 -11.11
7 1982 6994 16.45 4443 27.93 2357 48.05 3300 7 28 -63.16 75 33.93
8 1988 6240 -10.78 4502 1.33 1559 -33.86 3584 8.61 16 -42.86 58 -22.67
9 1992 6803 9.02 5268 17.01 2027 30.02 4241 18.33 13 -18.75 62 6.9
10 1997 6749 -0.79 6285 19.31 2158 6.46 4386 3.42 15 15.38 65 4.84
12 2007 7976 7.44 8774 22.88 2002 -2.92 4640 2.19 14 -22.67 38 -27.78
13 2012 (P) 9984 25.18 10385 18.36 1708 -14.68 4959 6.88 18 28.57 30 -21.05
2.2 Conti.....
(‘000 Nos.)
Sr. Year Pigs Mules & Rabbits Dog
Total Livestock Poultry
No. Donkeys (Including Dog &
Rabbit)
Nos. Growth Nos. Growth Nos. Growth Nos. Growth Nos. Growth Nos. Growth
rate rate rate rate rate rate
(%) (%) (%) (%) (%) (%)
1 2 15 16 17 18 19 20 21 22 23 24 25 26
2 1956 1 -75 122 23.23 N.A. - - - 13312 11.15 1854 63.06
3 1961 5 400 115 -5.74 N.A. - - - 13454 1.07 2048 10.46
4 1966 2 -60 112 -2.61 N.A. - - - 14338 6.57 2324 13.48
5 1972 8 300 107 -4.46 N.A. - - - 15098 5.3 2736 17.73
6 1977 34 325 85 -20.56 N.A. - - - 14406 -4.58 3426 25.22
7 1982 171 402.94 100 17.65 N.A. - 972 - 18440 28 3572 4.26
8 1988 93 -45.61 84 -16 N.A. - 1207 24.18 17343 -5.95 5492 53.75
9 1992 103 10.75 80 -4.76 N.A. - 1075 -10.94 19672 13.43 5657 3
10 1997 199 93.2 74 -7.5 10 - 1030 -4.19 20970 6.6 7236 27.91
11 2003 351 76.38 66 -10.81 17 70 1175 14.08 22846 16.13 8153 12.62
12 2007 21 -93.80 51 -23.88 9 -45.63 269 -77.1 23794 4.15 13373 64.02
13 2012 (P) 4 -80.36 39 -22.32 9 -4.94 253 -5.82 27390 15.11 15006 12.34
P = Provisional
16
2.3 Districtwise Live stock Population 2012(P).
(‘000 Nos.)
Sr. District
Buffalo
Poultry
Sheep
Goat
Improved (Poultry)
Rabbit
(Poultry)
No.
Deshi
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
1 Ahmedabad 248 394 17 144 1 2 1 1 16 1 825 370 21 349
2 Amreli 602 240 104 136 1 0 0 0 2 0 1085 10 8 2
3 Anand 211 486 5 70 0 5 1 0 5 0 783 4485 16 4469
4 Banaskantha 955 1172 116 296 1 1 4 0 37 0 2582 278 99 179
5 Bharuch 126 133 3 134 1 1 1 0 4 0 402 294 166 128
6 Bhavnagar 415 395 175 207 2 1 0 0 3 0 1198 42 28 13
7 Dahod 692 362 5 679 0 2 0 0 55 0 1795 836 778 58
8 Dang 78 25 0 30 0 0 0 0 3 0 136 193 190 4
9 Gandhinagar 161 331 14 74 0 1 1 0 2 0 585 133 6 127
10 Panchmahal Godhara 674 733 2 598 0 2 0 0 15 0 2024 539 481 58
11 Jamnagar 369 299 213 176 1 1 2 0 12 0 1073 36 16 21
12 Junagadh 515 546 41 127 1 0 1 0 3 0 1233 177 46 130
13 Kachchh 581 374 571 396 2 3 8 0 9 0 1945 50 12 38
14 Kheda 301 758 22 134 0 7 2 0 9 1 1233 562 45 517
15 Mahesana 283 538 13 103 1 2 5 0 3 0 947 192 12 180
16 Narmada 175 80 0 82 0 0 0 0 1 0 338 162 144 18
17 Navsari 233 115 2 85 0 0 0 0 3 1 439 874 337 537
18 Patan 130 372 38 80 1 2 3 0 1 0 627 33 5 28
19 Porbandar 81 145 22 19 0 0 0 0 4 0 272 9 2 7
20 Rajkot 574 432 196 172 1 1 0 0 8 0 1386 961 7 954
21 Sabarkantha 708 736 62 333 1 3 2 0 19 2 1867 587 168 419
22 Surendranagar 600 379 77 158 2 1 0 0 5 0 1222 8 2 6
23 Surat 289 300 2 150 1 1 0 1 13 0 758 922 399 523
24 Tapi 235 172 0 92 0 0 0 0 2 0 501 522 438 84
25 Vadodara 502 789 5 362 0 3 0 1 13 0 1677 1646 334 1311
26 Valsad 244 76 4 122 0 0 0 0 7 1 455 1082 664 418
TOTAL 9984 10385 1708 4959 18 39 30 4 253 9 27390 15006 4425 10578
Total may not tally due to round up. P = Provisional
17
2.4 Districtwise Density As Per Livestock Population- 2012(P) .
Sr. No. District Total Livestock Total Density of
(Including Dog & Geographical Livestock per Sq.
Rabbit) Area Km.
(in Sq. Km.)
1 2 3 4 5
1 Ahmedabad 824504 8107 102
2 Amreli 1085823 7397 147
3 Anand 783386 3204 245
4 Banaskantha 2582394 10743 240
5 Bharuch 402272 6509 62
6 Bhavnagar 1198360 10034 119
7 Dahod 1794636 3642 493
8 Dang 135760 1766 77
9 Gandhinagar 584964 2140 273
10 Jamnagar 1072838 14184 76
11 Junagadh 1233687 8831 140
12 Kachchh 1945438 45674 43
13 Kheda 1233074 3953 312
14 Mahesana 947013 4401 215
15 Narmada 338263 2817 120
16 Navsari 438816 2246 195
17 Panchmahal 2024388 5231 387
18 Patan 626555 5792 108
19 Porbandar 272294 2316 118
20 Rajkot 1385647 11198 124
21 Sabarkantha 1866556 7394 252
22 Surandranagar 1222165 10423 117
23 Surat 757715 4549 167
24 Tapi 501304 3139 160
25 Vadodara 1677367 7546 222
26 Valsad 454951 3008 151
Gujarat State 27390170 196244 140
P = Provisional
18
19
20
D - 2 : Veterinary Services and Animal Health- 2017-18
The animal health care is more important for all over economic growth in Gujarat
state. For veterinary Services 675 Veterinary Dispensaries, 45 Mobile Veterinary
Dispensaries, 27 Branch Veterinary Dispensary, 552 First aid veterinary Centers, 33
Veterinary polyclinics and One Biological Product Station-Gandhinagar are working
at present. Still these facilities are not available in the interior villages, 120 Mobile
Animal Disease Diagnostic Laboratory Ambulance Van cum Veterinary Dispensaries
are established & attached with veterinary Dispensary. A New Scheme of “Mobile
Veterinary Dispensary per 10 Villages” was established in the year 2015-16.Under
this scheme 345 M.V.D. were came into existence. The objective of this scheme is to
provide veterinary services at village level through mobile vehicle in each 10 villages
of respective Vet. Dispensary by different prescribed route. The coverage of livestock
unit per institution is around 13771.
For the control of emerging diseases of livestock and poultry, 18 Diseases
Diagnostic Units, 2 Epidemiology Units and one Foot and Mouth typing unit are
working in the State. There are number of emerging and re-emerging livestock diseases
OLNH335%UXFHOORVLV/HSWRVSLURVLV*ODQGHUV%LUGÀX6ZLQHÀXDQG%OXHWRQJXH,Q
poultry, diseases like Infectious Bursal Disease, Ranikhet and Salmonellosis are also
more important to control them at present.
The epidemiology units at state level are required to strengthen with necessary
infrastructure facilities like equipment, man power and computerization etc.
For sustainable animal breeding and health program, suitable Centrally Sponsored
scheme should be introduced. The man power engaged in high technical work should
be trained at central level and also in well-developed institution.
Rinderpest Surveillance & Monitoring Program in Gujarat State
The Indian Animal Health care industry is in the process of great transformation
ZLWKDQREMHFWLYHWRLQFUHDVHOLYHVWRFNSURGXFWLRQE\KHDOWKFDUHDQGVFLHQWL¿FPDQDJHPHQW
Rinderpest - a cattle plague, was greatest challenge for the globe and created a lot of
HFRQRPLFORVVLQODVWFHQWXU\1RZJOREDOO\HUDGLFDWHG5LQGHUSHVWLVWKH¿UVWDQLPDOGLVHDVH
LQ,QGLDZKLFKLVHUDGLFDWHG:LWKFRQFUHWHHIIRUWVHIIHFWLYHYDFFLQHVXI¿FLHQWLQSXWVHWF
India got a proud of “Rinderpest free country”. Gujarat has shown all kind of alertness
in implementation of the project. Due to active efforts at various levels, no outbreak of
Rinderpest disease has been reported after 1988 in Gujarat State.
21
Gujarat state is located in Western Region of India. It has area of 196024 square
kilometers and Livestock population of 74.23 lakh cattle and 71.40 lakh buffaloes. The state has
33 districts and it has adjoining borders with the state of Maharashtra on South, Rajasthan on
North and Madhyapradhesh on Eastern direction. State has international border with Pakistan
in Rann of Kachchh , Banaskantha and Patan. Gujarat is having large sea coast of nearly 1600
Km. State is richly endowed with Kankrej and Gir breeds of cattle and Surati , Mahesani and
Jafrabadi breeds of buffalo. Rinderpest is the most dreaded viral disease (Plague) of Livestock
mainly cattle, buffalo, sheep , goat , domestic pigs and wild ruminants , which had caused
average death toll of 10 lacs animals annually during past years in India in early and middle era
of 19th Century.
Eradication program had been succeed through the various stages like Mass vaccination
, Immune belt scheme , Vigilance scheme , R.P. check post scheme , Follow up scheme , R.P.
zero scheme , etc. Rinderpest vaccination has been totally discontinued in Gujarat since July
‘ 96 as per the pathway suggested by O.I.E.. O.I.E. has declare India “ Free From Rinderpest
Disease “ on 27/5/2004.
Presently for preventive measures under RP Surveillance & Monitoring program CBPP
& BSE are also included in lines of Rinderpest, to maintain freedom status of the diseases where
search and surveillance is the main target.
Works done under R.P. Surveillance & Monitoring Eradication Program during
the year : 2017-18.
----------
22
3.1 Veterinary Institutions 2017 - 18.
Sr. District Polyclinic Hightech 9'%9' FAVC MVD MVD Total ADIO
No. Veterinary ( Per 10 Veterinary
Policlinic Village ) Institutions
1 2 3 4 5 6 7 8 9 10
1 Ahmedabad 1 0 27 17 1 9 55 1
2 Amreli 1 0 33 24 0 10 68 1
3 Anand 1 0 20 20 0 8 49 0
4 Aravalli 1 0 21 15 3 12 52 0
5 Banaskantha 1 0 62 27 3 18 111 1
6 Bharuch 1 0 19 25 1 14 60 1
7 Bhavnagar 1 0 27 19 1 18 66 1
8 Botad 1 0 10 6 0 10 27 0
Chhota
9 1 0 10 14 4 12 41 0
Udepur
10 Dahod 1 0 19 23 3 9 55 1
11 Dang 1 0 6 9 1 5 22 0
Devboomi
12 1 0 13 6 0 10 30 0
Dwaraka
13 Gandhinagar 1 0 23 13 0 3 40 0
14 Gir Somnath 1 0 19 5 1 8 34 0
15 Jamanagar 1 0 20 17 0 11 49 1
16 Junagadh 1 0 30 7 0 10 48 1
17 Kachchh 1 0 32 29 6 18 86 1
18 Kheda 1 0 17 18 0 11 47 0
19 Mahesana 1 0 33 20 0 5 59 1
20 Mahisagar 1 0 19 17 1 11 49 0
21 Morbi 1 0 15 8 0 8 32 0
22 Narmada 1 0 14 16 4 12 47 0
23 Navsari 1 0 17 15 2 11 46 1
24 Panchmahal 1 0 23 21 1 7 53 0
25 Patan 1 0 29 15 2 12 59 1
26 Porbandar 1 1 11 7 1 5 26 0
27 Rajkot 1 0 28 18 0 14 61 1
28 Sabarkantha 1 0 24 22 4 11 62 1
29 Surat 1 0 18 25 2 10 56 1
30 Surendranagar 1 0 28 14 0 11 54 1
31 Tapi 1 0 10 26 2 11 50 0
32 Vadodara 1 0 15 17 0 10 43 1
33 Valsad 1 0 10 17 2 11 41 1
Total 33 1 702 552 45 345 1678 18
23
3.2 Production and Distribution of Vaccines :- 2017-18.
Sr. Name of Institute and Opening Quantity Quantity Total Quantity Closing
No. vaccine Stock as of Vaccine of Vaccine (colm. of Vaccine Stock
on Produced Purchased 3+4+5) Distributed as on
1-4-2017 during from other during the 31-3-2018
the year agencies year (colm.6-7)
1 2 3 4 5 6 7 8
Animal Vaccine Institute-Gandhinagar
1 H.S.A.P. 4040500 0 6742000 10782500 8685800 2096700
2 Black Quarter 606700 0 500000 1106700 477500 629200
3 Enterotoxaemia 504000 0 1700000 2204000 742300 1461700
4 Sheep Pox 145000 0 20000 165000 85000 80000
5 R.D. (F1-Strain) 519000 0 300000 819000 516200 302800
6 R.D. (R2B-Strain) 468800 0 800000 1268800 471800 797000
7 R.D. (Lasota strain) 474800 0 600000 1074800 480800 594000
8 R.D. N.D.Killed 320000 0 0 320000 232600 87400
9 Fowl Pox Vaccine 916600 0 800000 1716600 660800 1055800
10 Rinderpest (T.C.) 0 0 0 0 0 0
11 Anthrax Vaccine 0 0 3000 3000 2000 1000
12 I. B. Live 81400 0 100000 181400 86400 95000
13 I.B. Killed 0 0 0 0 0 0
14 Gumboro live 511600 0 600000 1111600 468100 643500
15 Gumboro killed 0 0 15000 15000 0 15000
16 IB+IBD+ND Killed 800 0 11000 11800 4800 7000
17 F.M.D.(AVI Level) 394000 0 164000 558000 389000 169000
18 Marek’s Disease 571000 0 500000 1071000 507000 564000
19 PPR 80000 0 0 80000 45000 35000
20 Theileriasis 0 0 0 0 0 0
Brucellosis (RJD
21 0 0 181200 181200 0 181200
Level)
Antirabic Vaccine
23 50350 0 5000 55350 51890 3460
(courses) (1 ml)
Antirabic Vaccine
24 10420 0 0 10420 10420 0
(courses) (5 ml)
Total : - 9694970 0 13041200 22736170 13917410 8818760
Salmonella pullorum
25 color antigen (in ml) 0 0 1500 1500 1500 0
(SPCA)
24
3.3 Details of Animal Health Camps Organized by Polyclinics : 2017-18.
Sr. District No.of No.of Total Total Castration $UWL¿FLDO No.of
camp
No. organized
Villages Treatment Vaccination Insemination EHQH¿WHG
covered Livestock
owners
1 2 3 4 5 6 7 8 9
1 Ahmedabad 31 31 4599 4134 370 540 1227
2 Amreli 17 17 1568 13004 217 288 602
3 Anand 33 33 4813 12590 383 1319 2194
4 Aravalli 0 0 0 0 55 0 0
5 Banaskantha 24 24 4094 3194 391 260 998
6 Bharuch 12 12 2715 4785 25 308 440
7 Bhavnagar 30 30 38711 6069 385 539 1252
8 Botad 0 0 0 0 0 0 0
9 Chhota udepur 0 0 0 0 0 0 0
10 Dahod 30 30 6973 6182 322 324 1022
11 Dang 0 0 0 0 0 0 0
Devbhoomi
12 10 10 776 0 27 0 358
Dwarka
13 Gandhinagar 30 30 7076 8904 416 940 2540
14 Gir Somnath 0 0 0 5000 0 0 0
15 Jamanagar 30 30 10768 249 474 603 10738
16 Junagadh 31 31 10625 5000 298 540 969
17 Kachchh 0 0 0 13778 56 48 0
18 Kheda 15 15 3856 0 63 0 1063
19 Mahesana 33 33 2748 5573 397 809 1232
20 Mahisagar 11 11 1347 1703 36 0 612
21 Morbi 0 0 0 0 16 69 0
22 Narmada 0 0 0 0 0 3 0
23 Navsari 21 21 2612 6861 333 168 563
24 Panchmahal 30 30 3676 4156 382 734 990
25 Patan 40 40 7065 8249 261 347 1546
26 Porbandar 27 27 7764 9116 420 538 1781
27 Rajkot 30 30 14481 173 385 657 1248
28 Sabarkantha 52 52 9307 15431 382 746 2966
29 Surat 15 15 1143 3230 414 79 238
30 Surendranagar 30 30 3212 3400 392 566 1442
31 Tapi 0 0 0 0 0 0 0
32 Vadodara 24 24 2703 5573 503 51 631
33 Valsad 14 14 1193 426 313 92 807
Hitec Poly-
34 0 0 0 0 19 0 0
porbandar
Gujarat State 620 620 153825 146780 7735 10568 37459
25
3.4 Details of Animal Health Camps Organized In Krishi Mahotsav-2017.
Sr. District No.of No.of Total Total Castration $UWL¿FLDO No.of
No. camp Villages Treatment Vaccination Insemination EHQH¿WHG
organized covered Livestock
owners
1 2 3 4 5 6 7 8 9
1 Ahmedabad 3 8 2179 110538 0 4164 182
2 Amreli 2 6 3881 205775 23 3003 166
3 Anand 24 104 6411 140771 85 2723 1320
4 Arvalli 2 8 1245 164865 25 4515 181
5 Banaskantha 31 203 16978 405497 185 18441 2472
6 Bharuch 2 16 1540 142235 10 2141 134
7 Bhavnagar 2 15 1752 153076 14 3072 180
8 Botad 4 7 2732 86255 29 644 285
9 Chhota Udepur 4 17 2557 138415 29 1685 290
10 Dahod 43 133 20689 128378 392 942 4315
11 Dang 1 4 799 60590 15 365 109
12 Devbhoomi
2 8 944 41756 15 530 97
Dwarka
13 Gandhinagar 2 6 1019 285381 18 12601 128
14 Gir Somnath 10 50 7393 77822 63 997 661
15 Jamnagar 2 11 5671 82465 17 1596 175
16 Junagadh 2 18 982 117379 16 3621 117
17 Kachchh 2 8 5650 135077 0 485 110
18 Kheda 20 51 7506 103500 102 1563 2987
19 Mahesana 20 69 6979 298658 26 14147 1513
20 Mahisagar 6 19 5235 74719 30 438 625
21 Morbi 51 80 37748 72364 119 1292 2228
22 Narmada 2 5 1547 87997 10 1773 230
23 Navsari 2 4 392 90992 3 2860 79
24 Panchmahal 2 7 966 82500 2 1221 192
25 Patan 2 11 1646 112015 14 6057 180
26 Porbandar 0 0 0 80177 0 2018 0
27 Rajkot 2 11 3362 79906 45 6222 214
28 Sabarkantha 9 40 4447 194456 0 12317 650
29 Surat 3 8 634 186400 11 1806 154
30 Surendranagar 2 8 1631 110696 16 1824 129
31 Tapi 2 12 859 122006 46 995 105
32 Vadodara 2 5 1597 204581 15 3659 154
33 Valsad 7 17 1965 85800 34 1781 395
Gujarat State 270 969 158936 4463042 1409 121498 20757
26
3.5 ,QIRUPDWLRQ5HJDUGLQJ,QQRFXODWLRQ9DFFLQDWLRQGRQH
Sr. District R.P. H.S. B.Q. Anthrax FMD ARV ET Sheep Fowl Ranikhet Mareks Others Total
No. Pox Pox F1- R2B -
Strain Strain
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
1 Ahmedabad 0 272850 0 0 433381 1850 53500 0 3337 39674 3337 109544 291005 1208478
2 Amreli 0 119514 66911 14 609605 662 6000 0 0 0 0 0 48986 851692
3 Anand 0 1041073 8600 0 1631034 1879 0 0 0 131073 0 0 251157 3064816
4 Aravalli 0 374777 0 0 1203090 2615 252165 5250 0 23206 25221 0 69669 1955993
5 Banaskantha 0 1331147 4946 0 1326606 10922 0 0 15000 44838 32000 0 507850 3273309
6 Bharuch 0 204660 13594 6250 439323 1593 66424 0 11684 11852 12877 0 303058 1071315
7 Bhavnagar 0 143979 26347 0 1169108 846 1680 0 0 9675 30000 0 177415 1559050
8 Botad 0 55810 4996 0 166856 285 4000 0 0 0 0 0 30710 262657
9 Chhota udepur 0 369023 0 0 871747 512 58074 9959 66541 22928 26749 121413 195984 1742930
10 Dahod 0 323654 44720 0 1167315 1329 28961 0 6882 81957 25593 8900 277592 1966903
11 Dang 0 29610 43129 0 62100 108 0 0 2142 0 3035 0 51891 192015
Devbhoomi
12 0 31749 0 0 278957 0 22448 0 0 65700 0 0 18300 417154
Dwarka
13 Gandhinagar 0 357939 0 0 661331 2260 38332 55045 0 14600 0 0 207963 1337470
14 Gir Somnath 0 97732 9503 0 699799 363 21461 0 0 65700 0 0 49401 943959
27
15 Jamanagar 0 58698 4248 0 512176 399 29850 0 2000 46275 0 0 41500 695146
16 Junagadh 0 104539 11025 0 455726 609 22103 0 9560 9783 9525 0 43798 666668
17 Kachchh 0 660647 11100 0 1593683 2603 39749 0 0 0 0 0 314961 2622743
18 Kheda 0 350818 0 0 878849 778 878 0 0 190252 2000 0 151976 1575551
19 Mahesana 0 662675 890 0 999153 2522 54030 0 2975 1975 0 0 132863 1857083
20 Mahisagar 0 1029765 760 0 1128077 3629 0 0 0 14400 0 0 42257 2218888
21 Morbi 0 64354 9171 0 233127 61 10990 0 3593 1785 2492 0 152871 478444
22 Narmada 0 118526 15151 0 368323 543 0 0 4580 3472 4580 0 90602 605777
23 Navsari 0 64135 35498 0 178506 445 41000 0 108944 427261 106944 22860 413477 1399070
24 Panchmahal 0 840043 0 0 1510659 5866 0 0 4800 18600 16800 0 80216 2476984
25 Patan 0 761888 0 0 1335575 3082 3495 0 2940 1970 0 1000 104506 2214456
26 Porbandar 0 51774 23253 0 273465 153 33566 0 0 0 0 0 0 382211
27 Rajkot 0 128061 27064 0 1070248 667 142000 1490 0 14823 0 0 145957 1530310
28 Sabarkantha 0 451540 0 0 2262440 1879 67009 10474 6664 14071 13675 24980 168245 3020977
29 Surat 0 580015 28987 0 1629995 4653 2000 0 128169 84512 126292 70545 241585 2896753
30 Surendranagar 0 167736 28295 2273 568366 49 0 0 0 0 0 0 36763 803482
31 Tapi 0 330042 34305 0 1053389 2586 0 1484 89595 32010 85634 0 81930 1710975
32 Vadodara 0 322575 0 0 538062 1817 0 0 28024 23566 23409 101413 104634 1143500
33 Valsad 0 262334 4281 0 708421 650 450 0 48487 130766 48487 0 196423 1400299
Gujarat State 0 11763682 456774 8537 28018492 58215 1000165 83702 545917 1526724 598650 460655 5025545 49547058
3.6 9DFFLQDWLRQGRQHW\SHRI$JHQF\DQG1DPHRI9DFFLQH
Sr. Agency R.P. H.S. B.Q. Anthrax FMD ARV ET Sheep Fowl Ranikhet Mareks Others Total
No. Pox Pox F1- R2B-
Strain Strain
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
3 V.D/B.V.D./F.A.V.C. 0 4459785 303608 8273 14248155 23988 225137 34595 0 6795 0 0 1260679 20571015
4 Mobile Vet. Disp. 0 25642 4003 250 222694 234 2000 0 0 0 0 0 18486 273309
5 I. C. D. P. 0 2711205 91089 0 5311396 1862 32601 1484 2951 0 4913 0 225297 8382798
28
7 IPDP/ PPBF/ DPBF/ 0 0 0 0 0 0 0 0 542966 1519929 593737 460655 2692122 5809409
PDC/ CRC
District Milk
10 Producers’ Co-op. 0 4123786 9360 0 7275159 28038 0 0 0 0 471654 11907997
Soci. (Dairy)
Gujarat State 0 11763682 456774 8537 28018492 58215 1000165 83702 545917 1526724 598650 460655 5025545 49547058
3.7 Disease Investigation Work 2017-18.
Sr. No. Details Total
1 2 3
1 Outbreak attended 21
2 6DPSOHVFROOHFWHGDQGUHFHLYHGIURP¿HOG 119817
3 Samples examined 89240
Samples found positive for disease 13425
(i) Anthrax 1
(ii) Black Quarter 0
(iii) Haemorrhagic Septicemia 54
(iv) Mastitis 4364
(A) Bacterial (v) Pneumonia 293
(vi) Brucellosis 2416
(vii) Collibacillosis 233
(viii) Others 6858
Sub Total (A) 14219
(i) Foot and Mouth Disease 3033
(ii) Ranikhet Disease 1
(iii) Chronic Respiratory 0
(iv) Avian Leucosis Complex 0
(v) Mareks 0
(B) Viral (vi) Gumboro 0
(vii) RP Seromonitoring 0
(viii) PPR 0
(ix) IBR 0
(x) Others 32
Sub Total (B) 3066
4 (i) Surra 1558
LL/LYHUÀXNH 680
(iii) Coccidiosis 339
(iv) Round worm infestation 4446
(v) Tape Worm Infestation 671
(vi) Amphistomum spp. 988
(C ) Parasitic Infestation
(vii) Amoebiasis 21
(viii) Scraping 346
(ix) Babesiosis 352
(x) Theileriosis 309
(xi) Others 1294
Sub Total ( C) 11004
(i) Miscellaneous Diseases 1370
LL'H¿FLHQF\'LVHDVH 333
(iii) Food Poisoning 31
(iv) Ring Worm 222
(v) Heat Stroke 128
(D) Others
(vi) Yock Sac Infection 0
(vii) Fatty Liver Haemorrhagic Syndrome 203
(viii) Others 2181
Sub Total (D) 4468
Grand Total (A+B+C+D) 32757
29
3.8 Result of the Samples sent to other Laboratories for Investigation 2017-18.
Sr. Name of Disease & Details No of Samples No of Samples
No. Analysed found Positive
1 2 3 4
(A) Bacterial Disease (i) Haemorrhagic Septicemia 21 13
(ii) Mastitis 0 0
(iii) Black Quarter 0 0
(iv) Coryza 15 5
(v) Pneumonia 0 0
(vi) Brucellosis 138 25
(vii) Anthrax 4 4
(viii) Leptospirosis 0 0
(ix) Collibasilosis 72 0
(x) Bacterial Infection 1226 100
(xi) Others 1563 14
Sub Total (A) 3039 161
(B) Viral Disease (i) Foot and Mouth Disease 6639 19
LL$YLDQ,QÀXHQ]D 10776 0
(iii) Gumboro Disease 0 0
(iv) Rabies antibodies 3 0
(v) Ranikhet Diseases 0 0
(vi) PPR 38 1
YLL(TXLQH,QÀXHQ]D 0 0
YLLL6ZLQH,QÀXHQ]D 0 0
(ix) Others 3382 226
Sub Total (B) 20838 246
(C ) Parasitic Infestation (i) Surra 0 0
LL/LYHUÀXNH 0 0
(iii) Round worm infestation 0 0
(iv) Babesiosis 0 0
(v) Others 159 0
Sub Total ( C) 159 0
(D) Others (i) Food Poisoning 54 3
(ii) Miscellaneous Disease 94 0
(iii) Fatty Liver Syndrome 0 0
LY'H¿FLHQF\'LVHDVH 5 0
(v) Tumours 0 0
(vi) Colic 0 0
(vii) B S E 54 0
(viii) Others 414 0
Sub Total (D) 621 3
Grand Total (A+B+C+D) 24657 410
30
3.9 No. of Castrations performed and Cases treated 2017-18.
Sr. District Castrations Treatement to Animals
No.
Indoor Outdoor Medicine Total Cases
Patient Patient Sypplied (Col. 4 to 6)
1 2 3 4 5 6 7
1 Ahmedabad 6565 191 69238 43414 112843
2 Amreli 3951 82 47769 73610 121461
3 Anand 4686 101 82977 71859 154937
4 Aravalli 5325 0 31883 33312 65195
5 Banaskantha 11473 211 345576 119075 464862
6 Bharuch 3874 28 38386 35266 73680
7 Bhavnagar 5403 784 131335 84327 216446
8 Botad 880 5549 5774 9355 20678
9 Chhota udepur 4118 53 22728 30127 52908
10 Dahod 9988 135 111386 113146 224667
11 Dang 2841 29 26593 44923 71545
12 Devbhoomi Dwarka 1400 39 34847 19208 54094
13 Gandhinagar 6358 0 122451 61521 183972
14 Gir Somnath 2679 0 27056 41364 68420
15 Jamanagar 4543 98 358975 39877 398950
16 Junagadh 5974 155 99698 70354 170207
17 Kachchh 11805 379 72239 77227 149845
18 Kheda 5025 0 92056 50668 142724
19 Mahesana 9948 228 453646 72678 526552
20 Mahisagar 6681 0 103242 62464 165706
21 Morbi 3175 3 22122 52014 74139
22 Narmada 3559 0 21014 23964 44978
23 Navsari 3797 106 42653 41362 84121
24 Panchmahal 7240 82 46659 98707 145448
25 Patan 6101 168 237377 79599 317144
26 Porbandar 2774 61 14709 22703 37473
27 Rajkot 6273 52 72231 95332 167615
28 Sabarkantha 7358 297 102567 79556 182420
29 Surat 9391 200 65587 46608 112395
30 Surendranagar 6005 2026 161941 68559 232526
31 Tapi 6631 0 210636 36864 247500
32 Vadodara 3687 14 64013 45884 109911
33 Valsad 3196 60 27849 31452 59361
34 Hitec Poly-porbandar 19 0 240 0 240
Gujarat Satate 182723 11131 3367453 1876379 5254963
31
3.10 Cases treated in the Cattle Camps organised by Polyclinics 2017-18.
Sr. District No. of No. of cases Treated De- Clinical Total
Treatment
No. Camps Surgery Gynaecology worming cases
Organised
1 2 3 4 5 6 7 8
1 Ahmedabad 31 414 1086 2024 1075 4599
2 Amreli 17 11 611 505 441 1568
3 Anand 33 72 1305 879 2557 4813
4 Aravalli 0 0 0 0 0 0
5 Banaskantha 24 36 1003 2260 795 4094
6 Bharuch 12 0 492 1816 407 2715
7 Bhavnagar 30 21 672 35678 2340 38711
8 Botad 0 0 0 0 0 0
9 Chhota udepur 0 0 0 0 0 0
10 Dahod 30 110 1263 2739 2861 6973
11 Dang 0 0 0 0 0 0
12 Devbhoomi Dwaraka 10 0 468 170 138 776
13 Gandhinagar 30 183 970 3718 2205 7076
14 Gir Somnath 0 0 0 0 0 0
15 Jamanagar 30 174 510 8458 1626 10768
16 Junagadh 31 168 876 8275 1306 10625
17 Kachchh 0 0 0 0 0 0
18 Kheda 15 9 682 2685 480 3856
19 Mahesana 33 34 1057 1020 637 2748
20 Mahi sagar 11 17 276 369 685 1347
21 Morbi 0 0 0 0 0 0
22 Narmada 0 0 0 0 0 0
23 Navsari 21 14 708 1278 612 2612
24 Panchmahal 30 22 906 1484 1264 3676
25 Patan 40 154 1868 4623 420 7065
26 Porbandar 27 38 1087 5897 742 7764
27 Rajkot 30 279 783 12010 1409 14481
28 Sabarkantha 52 628 1688 5497 1494 9307
29 Surat 15 0 172 850 121 1143
30 Surendranagar 30 52 763 0 2397 3212
31 Tapi 0 0 0 0 0 0
32 Vadodara 24 156 566 1455 526 2703
33 Valsad 14 99 334 402 358 1193
34 Hitec Poly-porbandar 0 0 0 0 0 0
Gujarat State 620 2691 20146 104092 26896 153825
32
3.11 &DVHV7UHDWHG,Q7KH&DWWOH&DPSV2UJDQLVHGE\3DQFKD\DWV9'%9')$9&
and MVD) : 2017 - 18.
Sr. District No. of No. of Cases De- Clinical Total Castration AI Vaccination Grand
Camps Treatment
No. Treated worming Cases Cases
Total
rganised
Surgery Gynae-
cology
1 2 3 4 5 6 7 8 9 10 11 12
1 Ahmedabad 211 236 12289 60038 10632 83195 331 448 10662 94636
2 Amreli 343 444 6707 194683 18620 220454 872 196 14134 235656
3 Anand 225 85 9743 31557 9216 50601 269 237 0 51107
4 Aravalli 202 197 8521 113821 6606 129145 799 362 2200 132506
5 Banaskantha 540 676 15812 447204 13445 477137 1814 418 2950 482319
6 Bharuch 156 387 6767 45144 9171 61469 568 321 10276 72634
7 Bhavnagar 178 964 5804 118359 20019 145146 890 345 45933 192314
8 Botad 71 13 2173 32131 4124 38441 213 146 25679 64479
9 Chhota udepur 112 134 3281 35795 7757 46967 799 891 41093 89750
10 Dahod 175 515 7226 41757 9415 58913 1384 844 131774 192915
11 Dang 94 185 922 22561 1084 24752 224 30 0 25006
12 Devbhoomi Dwaraka 244 311 1290 226454 5945 234000 335 116 20933 255384
13 Gandhinagar 230 334 12736 49669 9534 72273 1098 604 1399 75374
14 Gir Somnath 122 268 6336 65579 7952 80135 763 246 13283 94427
15 Jamanagar 114 975 3219 444941 18749 467884 1039 198 33524 502645
16 Junagadh 153 359 3504 64188 5386 73437 694 60 5028 79219
17 Kachchh 178 372 4866 99574 13344 118156 713 124 64581 183574
18 Kheda 300 189 10639 78838 7099 96765 734 746 11790 110035
19 Mahesana 247 448 14615 33391 6988 55442 106 277 0 55825
20 Mahi sagar 117 218 7120 19975 5504 32817 666 360 18320 52163
21 Morbi 98 112 1819 45635 10416 57982 237 68 46816 105103
22 Narmada 101 164 3603 33606 4209 41582 282 227 17273 59364
23 Navsari 115 289 3342 9141 5332 18104 118 97 0 18319
24 Panchmahal 183 972 7979 62380 11485 82816 1182 6 13469 97473
25 Patan 181 408 6264 162829 8044 177545 329 168 178042
26 Porbandar 83 55 1970 80628 1777 84430 393 149 6686 91658
27 Rajkot 205 303 6387 351733 20589 379012 1681 263 21253 402209
28 Sabarkantha 525 60 8611 364231 8024 380926 464 45 52308 433743
29 Surat 1480 822 8752 80690 8046 98310 1174 463 2838 102785
30 Surendranagar 239 433 5885 196072 6875 209265 834 564 65751 276414
31 Tapi 310 472 6584 128191 9570 144817 1728 3198 8912 158655
32 Vadodara 208 731 7523 83572 7844 99670 849 1971 40644 143134
33 Valsad 129 52 1957 62242 3933 68184 343 155 5179 73861
Total 7869 12183 214246 3886609 296734 4409772 23925 14343 734688 5182728
33
3.12 Cases treated in the Sexual Health Control camps organised by
Veterinary Polyclinics : 2017-18.
Sr. No. District SHC Camps
No. Cases Treated
1 2 3 4
1 Ahmedabad 16 2305
2 Amreli 13 1077
3 Anand 18 2178
4 Arvalli 0 0
5 Banaskantha 19 3403
6 Bharuch 12 2715
7 Bhavnagar 15 15371
8 Botad 0 0
9 Chhotaudepur 0 0
10 Dahod 15 2912
11 Dang 0 0
12 Devbhumi Dwarka 10 776
13 Gandhinagar 15 4057
14 Gir-somnath 0 0
15 Jamanagar 15 1419
16 Junagadh 15 900
17 Kachchh 0 0
18 Kheda 5 2723
19 Mahesana 18 1204
20 Mahisagar 11 1347
21 Morbi 0 0
22 Narmada 0 0
23 Navsari 18 1820
24 Panchmahal 15 1801
25 Patan 25 4492
26 Porbandar 21 5650
27 Rajkot 15 5881
28 Sabarkantha 33 4431
29 Surat 15 1143
30 Surendranagar 15 1423
31 Tapi 0 0
32 Vadodara 14 1049
33 Valsad 13 913
Total 381 70990
34
3.13 Cases treated in the Sexual Health Control Camps organized by I.C.D.P.
Centres in 2017-18.
Sr. District No. of S.H.C. S.H.C. Cases Other Cases Total Cases
No. Camps Treated Treated Treated
1 2 3 4 5 6
1 Ahmedabad 139 6632 10706 17338
2 Amreli 98 4034 4980 9014
3 Anand 93 4696 3020 7716
4 Arvalli 87 4258 1340 5598
5 Banaskantha 150 9722 21716 31438
6 Bharuch 96 4353 11366 15719
7 Bhavnagar 85 4602 8188 12790
8 Botad 24 855 2487 3342
9 Dahod 49 2696 1786 4482
10 Gandhinagar 231 9990 5885 15875
11 Jamnagar 60 2367 624 2991
12 Junagaddh 194 5066 16269 21335
13 Kachchh 11 367 5210 5577
14 Kheda 75 4115 4330 8445
15 Mahesana 225 9449 14171 23620
16 Narmada 84 3376 6568 9944
17 Navsari 117 4105 7628 11733
18 Panchm GDR 60 2672 4375 7047
19 Patan 135 4660 11216 15876
20 Rajkot 198 8433 1743 10176
21 Sabarkantha 160 9103 7899 17002
22 Surat 213 10517 9215 19732
23 Surendar Nagar 96 3037 8776 11813
24 Tapi 87 4459 5830 10289
25 Vadodara 157 7655 9948 17603
26 Valsad 33 1184 2001 3185
Total 2957 132403 187277 319680
35
3.14 'LVWULFWZLVH$YLDQ,QÀXHQ]D6DPSOHV
Sr. No. ADIO Unit 7UDFKHDO&ORDFDO Serum %LUG(JJV Total Sample
Swab from
Migratory
Birds
1 2 3 4 5 6 7
1 Ahmedabad 3171 15 4 3190 382
3 Banaskantha 82 50 0 132 0
6 Dahod 0 0 0 0 0
10 Kachchh 0 0 0 0 0
11 Mahesana
435 0 0 435 30
12 Patan
16 Surendranagar 91 39 0 130 0
18 Valsad 0 0 0 0 0
36
3.15 ANIMAL DISEASES STATUS REPORT OF GUJARAT STATE.
SR. NAME OF DISEASE No. Of Out Break (Year Wise)
NO. 2001-02 2002-03 2003-04 2004-05 2005-06 2006-07 2007-08 2008-09 2009-10 2010-11 2011-12 2012-13 2013-14 2014-15 2015-16 2016-17 2017-18
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19
1 F. M. D. 52 60 71 35 25 13 13 8 18 8 2 2 2 1 2 5 6
2 H. S. 29 46 43 38 27 18 13 24 12 15 19 7 8 4 12 4 4
3 B. Q. 4 2 0 1 8 2 0 2 0 3 2 1 0 0 0 0 0
4 ANTHRAX 7 4 1 2 6 0 1 1 1 0 0 0 0 0 0 1 1
5 RABIES 4 4 4 2 1 2 3 2 4 0 1 3 2 8 0 0 4
6 C. C. P. P. 12 10 3 3 7 0 1 2 0 5 0 2 0 2 0 0 1
7 Enterotoxeamia (E. T.) 1 1 1 0 0 0 0 0 0 0 1 3 1 1 1 0 0
8 GOAT POX 6 2 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0
9 SHEEP POX 3 1 1 1 4 4 12 7 1 0 0 1 3 2 0 0 0
10 &2:32;%XIIDOR3R[ 1 2 0 1 11 1 3 0 2 1 2 0 1 0 0 1 0
11 PPR 1 3 0 6 0 3 4 5 5 3 7 1 6 4 6 6 1
12 TRYPANOSOMIASIS 2 3 2 2 3 2 1 1 0 3 3 3 2 3 0 0 0
13 IBD 5 11 2 5 2 1 1 1 0 0 1 4 3 3 0 0 0
14 RANIKHET 3 1 1 4 2 2 0 0 1 0 0 2 0 2 1 0 0
37
15 COCCIDIOSIS 1 1 1 3 3 1 2 1 0 0 0 3 1 0 0 0 2
16 THILERIOSIS 0 1 0 0 0 0 0 0 0 0 0 1 1 1 1 0 0
17 COLLIBACILOSIS 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0
18 FASCIOLIASIS 1 1 3 0 1 0 0 0 1 0 0 2 2 0 0 0 1
19 MAREK’S 0 0 1 0 0 0 0 0 0 0 0 0 0 0 1 0 0
20 SALMONELLOSIS 0 2 1 0 0 0 0 0 0 3 0 0 0 0 0 0 0
21 CHRONIC RESPIRATORY 0 0 0 1 3 0 1 0 0 0 0 0 0 1 0 0 0
22 FOWL POX 0 0 0 0 0 0 0 0 0 0 1 0 1 1 0 0 0
23 MYCOTOXICIS 0 0 0 1 4 0 0 0 0 0 0 0 0 0 0 0 0
24 BRUCELLOSIS 2 0 0 0 0 0 1 0 0 0 0 0 2 0 0 0 0
25 CBPP 1 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
26 Mycoplasmosis 0 1 0 0 0 4 3 0 0 0 0 0 0 0 0 0 0
27 BIRD FLU 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 2 0
28 FOOT_ROOT 0 0 0 0 0 7 0 0 0 2 0 0 0 0 0 2 0
29 EQUINE INFLUENZA 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0
30 Glander 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 7 8
31 Amphistomiasis & Namotidiasis 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0
32 Mcf 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 0 0
TOTAL 135 161 135 106 108 60 59 54 49 43 39 36 35 33 31 30 28
N.B: Bold Figure Indicating Zoonotic Diseases
38
39
40
D - 3 : Cattle And Buffalo Development
Gujarat State has a noteworthy position in the country as far as livestock wealth
and dairy development is concerned. Animal Husbandry and Dairy sector contributes
about 5.08 % share to the Gross State Domestic Product.
Gujarat is lucky to have high yielding indigenous breed of cattle and buffalo.
Gir and Kankrej breed of Cattle and Mahesani, Jafarabadi and Banni breed of buffalo
are well known for their high yielding capacity. Kankrej bullocks are known for their
sawaichal.
Indigenous livestock breeds were developed for their utility under a certain
set of agro-climatic condition and have developed some unique traits. Conservation
of these breeds is to be done in a way that they may yield the greatest sustainable
EHQH¿WVWRSUHVHQWJHQHUDWLRQZKLOHPDLQWDLQLQJLWVSRWHQWLDOWRPHHWWKHQHHGVDQG
aspiration of future generation. The best way to conserve these resources is within their
native environment with the help of livestock livestock owners and non-government
organizations. Emphasis is laid on improving the performance of local breeds through
improve germ plasm through selective breeding, improving feeding resources and
adequate health coverage. The institutional herd maintain at Research Stations/
university/State Breeding Farm/Bull Mother Farm etc. are constantly strengthened
both in terms of superior germ plasm as well as modern tools and techniques.
Considerable success has been made in conservation of our native breeds, this
has been possible through breeders association and keeping proper records. Central
Herd Registration Scheme has been launched by the central government for registration
of outstanding animals in their respective home tract. It has become imperative to form
breedwise breeders association and at present Breeder Association for Banni, Mahesani,
Surti and Jafarabadi buffalo are working for conservation of particular breed. Farmers
are participating in state milk yield competition and central herd registration scheme and
KLJK\LHOGLQJDQLPDOVDUHSURYLGHGLQFHQWLYHVLQWHUPVRIFDVKSUL]HVDQGFHUWL¿FDWHV
This helps in conservation and improvement of the breeds in their home tract.
Scheme for conservation and improvement of Cattle and Buffalo
1. Cattle Breeding Farms:-
The state government has established 4 cattle breeding farms for Gir and
Kankrej Cattle to improve its genetic potentials in terms of milk production. Junagadh
Agricultural University has one farm for Gir Cattle at Junagadh. Animals of others
breeds are also reared at livestock research station of all four agricultural Universities
in the state.
41
The state Government Farms make continuous affords for improvement of our
breeds. Bulls of superior genetic potentials are raised at these farms for breeding.
The bulls so reared are supplied to the state semen centers for A.I. activities and also
to the Jilla panchayat, Gaushala and private breeders at nominal cost of Rs.1500 for
QDWXUDOVHUYLFHV7KHIDUPVDOVRSURYLGHEDVLFYHWHULQDU\VHUYLFHVOLNH$,¿UVWDLG
sexual health care, castration and vaccination to the nearby villages. Various extension
DFWLYLWLHVOLNHV6KLELUV*UDPVDEKDWUDLQLQJLQDQLPDOEUHHGLQJDQGPDQDJHPHQW¿OP
VKRZVHWFDUHDOVRFRQGXFWHGE\WKHIDUPVWRLPSDFWVFLHQWL¿FNQRZOHGJHWRWKHFDWWOH
owner.
2. Milk Yield Competition:-
State level Milk Yield Competition of different breeds are organized to locate
KLJK\LHOGLQJDQLPDOVWRHQFRXUDJHIDUPHUVIRUVFLHQWL¿FDQLPDOKXVEDQGU\DFWLYLWLHV
:LQQHUVLQWKH&RPSHWLWLRQVDUHJLYHQFDVKSUL]HVDQGFHUWL¿FDWHVDVLQFHQWLYHV7RWDO
target for 2017-18 was 1500 and achievement was 1509.
3. Technical Training Centre:-
5HIUHVKPHQWWUDLQLQJSURJUDPIRUDUWL¿FLDOLQVHPLQDWLRQIRUOLYHVWRFNLQVSHFWRU
DQG ¿HOG YHWHULQDULDQV DUH RUJDQL]HG E\ GHSDUWPHQW DW 7HFKQLFDO 7UDLQLQJ &HQWUH
Morbi.
4. Sankalp Patra Scheme :-
Department of A.H. organizes sexual health camps. The target for 2017-18 was
900 sexual health camps and achievement was 707 sexual health camps where 220021
animal were treated .
5. Interest Subsidy Scheme for 1 to 4 Animals Unit :-
Dairy farming is an important source of constant subsidiary income. The small
farmer’s can purchase 1 to 4 animals as per their need and capacity to maintain. Animal
owner gets 12% interest subsidy on the loan amount (as per NABARD unit cost) which
he has borrowed to purchase 1 to 4 animals from bank for 5 years.
During 2017-18 Rs.100.00 lacs was utilized for interest subsidy. During the year
2017-18 total application received 1369 out of them 353 were sanctioned for subsidy.
6FKHPHIRUVXEVLG\IRUGHDWKRI$QLPDOIRZOGXFNDWWKHWLPHRI
FHUWDLQGLVHDVHSRLVRQLQJ
The main aim of the scheme is to aid economical help to the animal owner for
loss of animal due to certain disease like Anthrax, Rabies, Bird Flu and poisoning like
chemical, food, snakebite… so he can purchase the replacement of his lost animal or
bird and continue his income generation.
During the year 2017-18 total 106 applications were sanctioned and subsidy
were given to Animal owner for the death of their animals with in the budget provision
of Rs 20.00 lacs.
42
7. Interest Subsidy Scheme for 1 to 10 Animals Unit :-
Dairy farming is an important source of constant subsidiary income. The small
woman farmers can purchase 1 to 10 animals as per their need and capacity to maintain.
If any bank recognized by Reserve Bank Of India , sanction loan for any dairy animal
FRZ EXIIDORWKHEHQH¿FLDU\FDQJHWVLQWHUHVWRXWRIZKLFKZRXOGEHDVVLVWHG
by Govt. of Gujarat and remaining 2% would be borne by Gujarat Co-operative Milk
0DUNHWLQJ )HGHUDWLRQ /WG$QG 'LVWULFW &RRSHUDWLYH 0LON XQLRQV HTXDOO\ IRU ¿YH
years on bank loan amount (as per unit cost of NABARD guide line).
During the year 2017-18 total application received 1414 out of them 496 were
sanctioned for subsidy.
8. Interest Subsidy for Establishment of Unit of 1 to 20 Milch Animals :-
Dairy farming is an important source of constant subsidiary income. The small
and poor families can purchase 1 to 20 animals as per their need and capacity to
maintain. If any bank recognized by Indian Reserve bank sanction loan for any dairy
DQLPDOFRZ EXIIDORWKHEHQH¿FLDU\FDQJHWLQWHUHVWVXEVLG\RQXSWR
LQWHUHVWIRU¿YH\HDUVRQEDQNORDQDPRXQWDVSHUXQLWFRVWRI1$%$5'JXLGHOLQH
It also provides a good quality organic manure for improving. crop fertility &crop
yields. The surplus fodder agricultural by products are utilized by animals & converted
into value add products viz. Milk, Meat etc., Animal Husbandry provides additional
source of income to the farmers.
During the year 2017-18 total application received 3701 out of them 2273 were
sanctioned for subsidy.
9. Interest Subsidy for Establishment of Unit of 1 to 20 Milch Animals to the
People of Scheduled Caste :-
Dairy farming is an important source of constant subsidiary income. The small
and poor families can purchase 1 to 20 animals as per their need and capacity to
maintain. If any bank recognized by Indian Reserve bank sanction loan for any dairy
DQLPDOFRZ EXIIDORWKHEHQH¿FLDU\FDQJHWLQWHUHVWVXEVLG\RQXSWR
LQWHUHVWIRU¿YH\HDUVRQEDQNORDQDPRXQWDVSHUXQLWFRVWRI1$%$5'JXLGHOLQH
It also provides a good quality organic manure for improving. crop fertility &crop
yields. The surplus fodder agricultural by products are utilized by animals & converted
into value add products viz. Milk, Meat etc., Animal Husbandry provides additional
source of income to the farmers.
During the year 2017-18 total application received 176 out of them 71 were
sanctioned for subsidy.
43
10. Interest Subsidy for Establishment of Unit of 1 to 20 Milch Animals to the
People of Scheduled Tribe :-
----------
44
4.1 Performance Characters of Farm Animals 2017–18.
Sr. District Name and Location of Breed Average Average Average Average
No. Cattle Breeding Farm Intercalving Lactation Dry Age at
period Yield (Litres) period First
(Days) (Days) Calving
(Months)
1 2 3 4 5 6 7 8
A. CATTLE
1 Rajkot CBF Bhutwad (AH) Gir 250 1456.58 194 64
2 Kachchh CBF Bhuj (AH) Kankrej 477 1256.60 173 57
3 Banaskantha CBF Thara (AH) Kankrej 436 1156.70 155 43
4 Surat CBF Mandvi (AH) Kankrej 434 1448.75 127 78
5 Junagadh CBF Junagadh (AU) Gir 408 2206.80 129 48
LRS Sardar- Kankrej 444 2648.42 126 39
6 Banaskantha (AU)
Krishinagar C. B. --- --- --- ---
Crossbred 419 4001.24 135 29
7 Anand LRS Anand (AU) Kankrej 446 2563.54 177 37
Gir --- --- --- ---
45
4.2 Maintenance and Distribution of Breeding Animals at Cattle Breeding Farms 2017 - 18.
Sr. District Name and Breed Male over 3 years Female over 3 years Young Stock Others Bull Total No.of Male
No. Location of Depot Calves
Castr Rearing Breeding In- Dry Not 2 to 3 Years 1 to 2 Years Below 1 Years
Cattle Breeding attached distributed
ated of bull bulls main Milk Calved
Farm Male Female Male Female Male Female to Farm for
calves tained Even once
Propagation
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20
1 Rajkot Bhutwad Gir 0 0 0 36 28 27 0 25 7 23 13 14 0 0 173 15
2 Kachchh CBF-Bhuj Kankrej 0 36 0 46 28 24 14 18 21 12 24 23 0 0 246 7
3 Banaskantha CBF-Thara Kankrej
0 0 0 47 37 36 12 21 23 18 20 27 0 30 271 0
LRS - S.K.nagar Kankrej 4 0 14 77 19 12 7 56 7 38 43 53 0 0 330 6
4 Surat CBF-Mandavi Kankrej 0 0 0 44 63 73 1 22 3 16 43 48 7 0 320 2
5 Junagadh CBF-Junagadh Gir 2 3 14 110 131 21 6 87 73 75 76 74 0 0 672 60
6 Anand LRS- Anand Crossbreed 1 0 0 46 11 0 0 32 21 30 25 38 0 0 204 2
Kankrej 0 0 0 16 4 0 0 0 0 0 0 0 17 0 37 0
Gir 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
7 Kheda Bull Mother 1 Jersey
46
Farm - SAGP (Pure) 0 0 0 4 3 0 0 0 0 0 1 0 0 0 8 3
- Bidaj Farm 2 H.F.(Pure)
(NDDB) 0 0 0 5 4 0 0 0 2 2 6 6 0 0 25 12
3 C.B. 0 0 0 83 53 0 0 31 9 14 20 22 0 0 232 50
4 Gir 0 0 0 8 8 0 0 6 1 3 3 5 0 0 34 6
5 Kankrej 0 0 0 0 0 0 0 0 0 1 0 0 0 0 1 0
6 Khillar 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
7 Shahiwal 0 0 0 12 15 0 0 8 4 6 8 9 0 0 62 8
8 Red-sindhi 0 0 0 5 6 0 0 1 2 2 2 5 0 0 23 4
8 Navsari LRS -Navsari Kankrej 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
H.F. x K. 0 1 1 19 1 2 0 5 0 0 4 12 0 0 45 1
LRS= Livestock Research Station CBF= Cattle Breeding Farm BMF = Bull Mother Farm
NDDB = National Dairy Dev. Board SAGP = Sabarmati Ashram Gaushala Project
4.3 Maintenance and Distribution of Breeding Animals (Buffalo) at Cattle Breeding Farms 2017 - 18.
Sr. District Name and Breed Male over 3 years Female over 3 years Young Stock Others Total No.of Male
No. Location Calves
of Cattle Castr Rearing Breeding In- Dry Not 2 to 3 Years 1 to 2 Years Below 1 distributed for
Breeding ated of bull bulls Milk Calved Years Propagation
Farm calves main Even Male Female Male Female Male Female
tained once
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19
1 Kachchh CBF-Bhuj Banni 1 0 1 39 35 17 19 16 13 19 13 20 0 193 6
Banaskantha LRS - Mahesani 0 0 3 24 15 8 4 19 9 16 17 6 0 121 3
2 S.K.nagar
Banni 0 0 0 1 3 1 1 5 1 0 2 1 0 15 0
Surat C.C.B.F.- Surti 0 29 0 114 17 39 17 49 16 25 59 56 0 422 32
3 Dhamrod
47
4 Junagadh
Kheda Bull Mother 1 Murrah 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Farm
2 Pandharpuri 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
- SAGP -
5 Bidaj Farm 3 Jafrabadi 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
(NDDB)
4 Banni 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
5 Mehsani 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Navsari LRS Surti 0 2 2 61 17 10 0 20 1 32 32 34 0 211 0
6 -Navsari
Anand RBRU- Surti 0 2 1 21 1 1 0 11 0 10 8 12 0 67 7
7 Anand (AU)
IDC =lndia Dairy Corporation NDDB =National Dairy Dev. Board
LRS =Livestock Research Station RBRU = Reproductive Biology Research Unit
4.4 Maintenance and Distribution of Breeding Animals at Sperm Station,
SAG, Bidaj Farm, Dist. - Kheda as 2016-17
Sr. Breed Male over 3 years Young Stock Others Bull Depot Total
No. attached to
Rearing Breeding 2 to 3 1 to 2 Below Farm
of bull bulls Years Years 1 Years
calves maintained
1 2 3 4 5 6 7 8 9 10
(A) COW :
Jersey
1 0 19 0 1 0 0 20
(Pure)
2 H.F.(Pure) 3 69 1 13 0 0 86
4 Gir 5 28 1 8 0 0 42
5 Kankrej 0 2 0 0 0 0 2
NA
6 Khillar 0 3 0 0 0 0 3
7 Shahiwal 3 33 1 3 0 0 40
8 Red-Sindhi 0 9 .0 1 0 0 10
9 Tharparkar 0 0 0 2 0 0 2
10 Rathi 0 0 1 4 0 0 5
(B) BUFFALO :
48
4.5 Information Regarding Key Village Scheme 2017-18.
Sr. Item Name of District Panchayat Total
No. Mahesana Gandhinagar Patan Anand Panchmahal Mahisagar Navsari Kheda Narmada Morbi Surendranagar Bharuch
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
1 Year of Inception -- -- 1983 -- 1960 -- 1966 -- -- -- -- -- --
2 Sub - Centres 6 1 1 2 6 3 2 1 1 2 1 1 27
3 Breedable Population
5863 1200 900 2988 8510 11202 2588 1450 1589 22658 1000 1000 60948
4 $$UWL¿FLDO
Insemination Centres 6 1 1 2 6 3 2 1 1 2 1 1 27
(B) Cross Breeding
Centres 6 1 1 2 6 3 2 1 1 2 1 1 27
5 Male Castrated 883 156 0 282 211 237 13 61 115 0 209 0 2167
6 $UWL¿FLDO,QVHPLQDWLRQ:RUN'RQH
( A ) Cows
49
( I ) Indigenous 1338 28 0 99 51 28 65 86 66 5 1766
( II ) Cross-Breed 930 174 552 150 1703 23 5 36 24 0 30 3627
( B ) Buffaloes 4600 1101 376 214 424 53 111 169 116 935 8099
Total 6868 1303 0 1027 415 2155 76 181 36 279 182 970 13492
7 &DOYHVERUQE\$UWL¿FLDO,QVHPLQDWLRQ
( A ) Cows
( I ) Indigenous 557 3 0 44 0 3 0 32 0 31 0 3 673
( II ) Cross Breed 181 76 0 445 0 205 3 0 7 10 0 0 927
( B ) Buffaloes 1669 407 0 413 0 219 7 45 0 49 0 425 3234
Total 2407 486 0 902 0 427 10 77 7 90 0 428 4834
8 Preventive
Innoculation /
67329 9486 0 32126 166530 8053 1697 4068 1287 0 67148 0 357724
Vaccination carried
out
9 Animals Treated 12200 2637 0 4881 5233 3227 352 225 5012 0 4403 147 38317
10 Sterility Cases Treated 0 0 0 0 935 0 0 0 277 0 808 0 2020
4.6 Information Regarding Intensive Cattle Development Programme 2017-18.
Sr. Item Intensive Cattle Development Programme
No.
Ahmedabad Amreli Anand Aravalli Banas- Bharuch Bhavnagar Botad Dahod Gandhi Jamnagar Junagadh Kachchh Kheda
kantha nagar - Bhuj
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
1 Year of Inception 1965 2010-11 2011-12 2016-17 1997 2010-12 1995 2016-17 2012-13 2011-12 2012-13 1995 2010-12 2011-12
2 Centres 44 59 19 29 50 78 29 18 20 77 20 66 50 25
3 Villages Covered 547 228 87 53 96 183 154 40 104 167 90 119 183 88
Breedable Population
4 420 57 139 63 147 53 57 35 137 289 55 36 48 33
(‘000)
5 Male Castrated 2990 2109 1272 1879 12414 1828 2290 508 1693 5680 1587 5341 316 1764
6 A. I. Carried out 43528 24564 20464 47368 118986 19597 27834 3722 19384 105234 10055 58952 1165 33778
7 Per Centre A.I. 989.27 416.34 1077.05 1633.38 2379.72 251.24 959.79 0.00 969.20 1366.68 502.75 893.21 23.30 1351.12
8 Vaccination 322900 411000 226874 382304 430560 180428 210060 20366 142917 729214 130831 605130 48156 165775
9 Animal Treated 12553 20692 11916 18496 25970 9814 14728 4812 10672 30078 8047 19497 1375 12408
10 Sexual Health Camp 139 98 93 87 150 96 85 24 49 231 60 194 11 75
50
Sexual Health Cases
11 6632 4034 4696 4258 9722 4353 4602 855 2696 9990 2367 5066 367 4115
Treated
Cattle Shed For 5 -
12 14 3 2 - 7 1 5 - 1 2 4 6 6 3
Animals
Cattle Shed For 10 -
13 14 3 2 - 7 1 5 - 1 2 4 6 5 3
Animals
Cattle Shed (For
14 37 13 10 - 30 3 21 - 5 10 19 27 17 20
Schedul Cast)
Cattle Feed Subsidy
15 for Pregnant Animal 374 128 180 896 651 10 212 65 91 519 131 135 125 372
(For Schedul Cast)
Jinjavo Biyaran Kit (For
16 5832 1082 834 - 2666 416 1834 - 416 834 1500 2250 2084 1084
Schedul Cast)
4.6 Conti.....
Sr. Item Intensive Cattle Development Programme
No. Mahesana Narmada Navsari Panch- Patan Rajkot Sabar- Surat Surendra Tapi Vadodara Valsad Total
mahal kantha Nagar
1 2 17 18 19 20 21 22 23 24 25 26 27 28 29
2016-
1 Year of Inception 1970 2012-13 2008 2008 1969 1996 1969 2012-13 2011-12 1970 1996 --
17
2 Centres 75 27 47 20 50 69 53 71 44 29 69 18 1156
3 Villages Covered 196 201 25 127 138 234 316 426 426 97 357 205 4887
4 Breedable Population (‘000) 154 43 8 58 85 124 199 114 200 60 93 75 2782
5 Male Castrated 5993 1551 3286 1143 3708 6996 4365 5683 2539 2358 10909 1120 91322
6 A. I. Carried out 134728 21227 34633 20603 53517 64944 125942 47771 17891 24721 50290 13258 1144156
7 Per Centre A.I. 1796.37 786.19 736.87 1030.15 1070.34 941.22 2376.26 672.83 406.61 852.45 728.84 736.56 989.75
8 Vaccination 664318 193622 127278 119936 468589 402330 770143 543498 301808 218329 512920 53512 8382798
51
9 Animal Treated 58995 10762 18575 5602 17150 23832 37233 39074 14898 15724 23402 7524 473829
10 Sexual Health Camp 225 84 117 60 135 198 160 213 96 87 157 33 2957
11 Sexual Health Cases Treated 9449 3378 4105 2672 4660 8433 9103 10517 3037 4459 7655 1184 132405
12 Cattle Shed For 5 - Animals 3 1 2 3 7 4 3 4 1 5 2 89
1 2 3 4 5 6 7 8 9 10 11 12
1 Ahmedabad 0 0 0 0 2 0 43 0 0 34
2 Amreli 0 0 0 0 0 0 59 0 0 23
3 Anand 0 1 0 0 0 0 19 2 0 25
4 Arvalli 0 0 0 0 0 1 29 0 0 11
5 Banaskantha 0 1 0 0 0 0 50 0 1 32
6 Bharuch 0 0 0 0 2 0 76 1 0 15
7 Bhavnagar 0 0 0 0 0 0 29 0 0 17
8 Botad 0 0 0 0 0 0 18 0 0 16
9 Chhota Udepur 0 0 0 0 2 1 23 0 0 16
10 Dahod 0 0 0 0 0 0 20 0 0 31
11 Dang 0 0 0 0 0 0 0 0 0 10
12 Devbhumi Dwarka 0 0 0 0 0 0 9 0 0 8
13 Gandhinagar 0 0 0 0 0 0 77 1 0 37
14 Gir - Somnath 0 0 0 0 0 0 6 0 0 8
15 Jamnagar 0 0 0 0 0 0 11 0 0 21
16 Junagaddh 0 0 0 0 0 0 51 0 0 20
17 Kachchh 0 0 0 0 0 0 50 0 1 12
18 Kheda 0 0 1 0 0 0 25 1 0 22
19 Mahesana 0 1 0 0 0 0 75 6 0 46
20 Mahisagar 0 0 0 0 0 0 7 3 0 15
21 Morbi 0 0 0 0 0 0 25 2 0 14
22 Narmada 0 0 0 0 0 0 27 1 0 21
23 Navsari 0 0 0 0 0 0 47 2 0 15
24 Panchmahal 0 0 0 0 0 0 13 6 0 27
25 Patan 1 0 0 1 0 0 49 1 0 37
26 Porbandar 0 0 0 0 0 0 9 0 0 9
27 Rajkot 0 0 0 1 0 0 52 0 1 29
28 Sabarkantha 0 0 0 0 0 0 53 0 0 20
29 Surat 0 0 0 0 0 0 71 0 1 19
30 Surendranagar 0 0 0 0 0 0 34 1 0 19
31 Tapi 0 0 0 0 0 0 29 0 0 8
32 Vadodara 0 0 0 0 0 0 46 0 0 21
33 Valsad 0 0 0 0 0 0 18 0 0 17
Total 1 3 1 2 6 2 1150 27 4 675
52
4.7 Conti.....
Sr. District Veterinary Rural Multi Under AIC under BAIF G.L.D.B. J.K. Total
No. Polyclinic Purpose Centre Gaushala Co. Op Trust
Under Panjarapol Dairy
(Lay
R.P. IPDP ISDP Inseminators)
1 2 13 14 15 16 17 18 19 20 21 22
1 Ahmedabad 1 2 0 0 0 93 1 0 0 176
2 Amreli 1 0 0 4 0 41 7 53 0 188
3 Anand 1 3 0 0 0 384 0 0 0 435
4 Arvalli 1 4 1 0 0 169 0 0 0 216
5 Banaskantha 1 0 2 16 0 1119 0 0 0 1222
6 Bharuch 1 0 3 0 0 99 4 0 0 201
7 Bhavnagar 1 0 0 0 34 147 0 36 0 264
8 Botad 1 0 0 0 11 10 0 0 0 56
9 Chhota Udepur 1 1 1 0 0 141 0 0 0 186
10 Dahod 1 0 0 3 0 352 0 0 40 447
11 Dang 1 0 0 0 0 0 5 0 0 16
12 Devbhumi Dwarka 1 0 1 0 0 0 2 0 0 21
13 Gandhinagar 1 0 1 0 0 135 0 6 0 258
14 Gir - Somnath 1 1 0 0 0 14 3 0 0 33
15 Jamnagar 1 0 1 0 0 72 1 1 49 157
16 Junagaddh 1 0 0 0 0 15 0 90 0 177
17 Kahchh 1 0 0 0 0 14 9 0 0 87
18 Kheda 1 0 2 0 0 577 2 0 0 631
19 Mahesana 1 1 0 0 0 473 117 29 0 749
20 Mahisagar 1 1 0 0 0 509 0 0 0 536
21 Morbi 1 2 0 0 0 26 0 0 0 70
22 Narmada 1 0 0 0 0 90 1 5 0 146
23 Navsari 1 0 0 0 0 168 5 0 0 238
24 Panchmahal 1 0 0 0 0 81 0 34 0 162
25 Patan 1 0 0 0 0 183 0 48 0 321
26 Porbandar 1 1 0 5 0 40 0 0 0 65
27 Rajkot 1 0 0 0 0 104 0 12 0 200
28 Sabarkantha 1 3 0 0 0 213 0 93 0 383
29 Surat 1 0 0 0 0 208 29 0 0 329
30 Surendranagar 1 2 0 3 0 83 0 19 32 194
31 Tapi 1 0 3 0 0 204 21 0 0 266
32 Vadodara 1 0 0 2 0 195 2 0 0 267
33 Valsad 1 0 0 0 0 113 26 0 0 175
Total 33 21 15 33 45 6072 235 426 121 8872
53
4.8 $UWL¿FLDO,QVHPLQDWLRQZRUNGRQHDW$UWL¿FLDO,QVHPLQDWLRQ&HQWUHV
Sr. District By Department of A. H. By Co. Operative Union- By Bhartiya Agro By J. K. Trust
No. & Panchayat Dairy Industries Foundation
Cattle Buffalo Total Cattle Buffalo Total Cattle Buffalo Total Cattle Buffalo Total
1 2 3 4 5 6 7 8 9 10 11 12 13 14
1 Ahmedabad 15516 40852 56368 21654 39306 60960 45 63 108 0 0 0
2 Amreli 16635 18677 35312 6281 6510 12791 1396 2228 3624 0 0 0
3 Anand 14309 22463 36772 169992 271917 441909 0 0 0 0 0 0
4 Arvalli 35429 19787 55216 182205 98459 280664 0 0 0 0 0 0
5 Banaskantha 89062 71752 160814 764605 490251 1254856 0 0 0 0 0 0
6 Bharuch 6619 16693 23312 15731 17644 33375 1934 1715 3649 0 0 0
7 Bhavnagar 13149 26282 39431 33767 39199 72966 0 0 0 0 0 0
8 Botad 4944 2526 7470 7685 2753 10438 0 0 0 0 0 0
9 Chhota Udepur 541 922 1463 36968 54516 91484 0 0 0 0 0 0
10 Dahod 14277 23282 37559 19499 38346 57845 0 0 0 3622 6106 9728
11 Dang 1707 339 2046 0 0 0 2450 418 2868 0 0 0
12 DevbhumiDwarka 574 5724 6298 0 0 0 219 1390 1609 0 0 0
13 Gandhinagar 67776 90380 158156 141680 75970 217650 0 0 0 0 0 0
14 Gir - Somnath 3211 1821 5032 3847 3448 7295 838 660 1498 0 0 0
15 Jamnagar 5415 19853 25268 3530 15823 19353 56 387 443 150 4019 4169
16 Junagaddh 28996 39487 68483 3996 3742 7738 0 0 0 0 0 0
17 Kahchh 6246 1736 7982 9841 1470 11311 841 758 1599 0 0 0
18 Kheda 20025 22046 42071 157606 293588 451194 127 639 766 0 0 0
19 Mahesana 69892 108019 177911 328225 274391 602616 75146 72749 147895 0 0 0
20 Mahisagar 1502 3173 4675 145856 167986 313842 0 0 0 0 0 0
21 Morbi 1707 1537 3244 6110 10775 16885 0 0 0 0 0 0
22 Narmada 11655 18757 30412 11780 14131 25911 72 64 136 0 0 0
23 Navsari 35078 10005 45083 195648 34061 229709 3599 2239 5838 0 0 0
24 Panchmahal 6977 18110 25087 72759 165961 238720 0 0 0 0 0 0
25 Patan 17293 49373 66666 75839 103675 179514 0 0 0 0 0 0
26 Porbandar 2097 9170 11267 2807 6252 9059 0 0 0 0 0 0
27 Rajkot 41614 37902 79516 37504 27118 64622 0 0 0 0 0 0
28 Sabarkantha 91255 59179 150434 198092 121211 319303 0 0 0 0 0 0
29 Surat 30289 24149 54438 95157 40636 135793 15008 7324 22332 0 0 0
30 Surendranagar 11787 13134 24921 6014 6314 12328 0 0 0 8239 9532 17771
31 Tapi 17680 11154 28834 95232 51208 146440 8610 6717 15327 0 0 0
32 Vadodara 16941 38270 55211 59444 124433 183877 316 826 1142 0 0 0
33 Valsad 11006 5128 16134 106682 19662 126344 20563 1499 22062 0 0 0
Total 711204 831682 1542886 3016036 2620756 5636792 131220 99676 230896 12011 19657 31668
54
4.8 Conti.....
By C.B.F. By Gopal Mitra
Total
Sr. ( G.L.D.B. ) (G.L.D.B.)
District
No.
Cattle Buffalo Total Cattle Buffalo Total Cattle Buffalo Total
1 2 15 16 17 18 19 20 21 22 23
1 Ahmedabad 0 0 0 0 0 0 37215 80221 117436
2 Amreli 0 0 0 7229 7319 14548 31541 34734 66275
3 Anand 0 0 0 0 0 0 184301 294380 478681
4 Arvalli 0 0 0 0 0 0 217634 118246 335880
5 Banaskantha 0 0 0 0 0 0 853667 562003 1415670
6 Bharuch 0 0 0 0 0 0 24284 36052 60336
7 Bhavnagar 0 0 0 10734 23124 33858 57650 88605 146255
8 Botad 0 0 0 0 0 0 12629 5279 17908
9 Chhota Udepur 0 0 0 0 0 0 37509 55438 92947
10 Dahod 0 0 0 0 0 0 37398 67734 105132
11 Dang 0 0 0 0 0 0 4157 757 4914
12 Devbhumi Dwarka 0 0 0 0 0 0 793 7114 7907
13 Gandhinagar 0 0 0 1282 1333 2615 210738 167683 378421
14 Gir - Somnath 0 0 0 0 0 0 7896 5929 13825
15 Jamnagar 0 0 0 169 210 379 9320 40292 49612
16 Junagaddh 1784 1536 3320 48518 44196 92714 83294 88961 172255
17 Kahchh 0 0 0 0 0 0 16928 3964 20892
18 Kheda 0 0 0 0 0 0 177758 316273 494031
19 Mahesana 0 0 0 22679 20520 43199 495942 475679 971621
20 Mahisagar 0 0 0 0 0 0 147358 171159 318517
21 Morbi 0 0 0 0 0 0 7817 12312 20129
22 Narmada 0 0 0 174 311 485 23681 33263 56944
23 Navsari 0 0 0 0 0 0 234325 46305 280630
24 Panchmahal 0 0 0 7844 14782 22626 87580 198853 286433
25 Patan 0 0 0 5321 9226 14547 98453 162274 260727
26 Porbandar 0 0 0 0 0 0 4904 15422 20326
27 Rajkot 0 0 0 3334 3055 6389 82452 68075 150527
28 Sabarkantha 0 0 0 53760 47942 101702 343107 228332 571439
29 Surat 0 0 0 0 0 0 140454 72109 212563
30 Surendranagar 0 0 0 2439 2629 5068 28479 31609 60088
31 Tapi 0 0 0 0 0 0 121522 69079 190601
32 Vadodara 0 0 0 0 0 0 76701 163529 240230
33 Valsad 0 0 0 0 0 0 138251 26289 164540
Total 1784 1536 3320 163483 174647 338130 4035738 3747954 7783692
55
4.9 Maintenance of Breeding Bulls on Patan Farm (GLDB) 2017-18.
Sr. Frozen CATTLE BULLS BUFFALO BULLS Frozen Semen Doses
No. Semen
Production
Farm H.F. Jersy H. F. Jersy Gir Kankrej Total Jafarabadi Mahesani Surti Banni Total 3URGXFHG 'LVWULEXWHG
100% 100% 50% 50% Bull Bulls Purchased Utilised
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
1 Patan
Under
4 0 12 0 17 1 34 9 34 5 0 48
Collection
2381445/49399 2286513
56
Under
0 0 5 0 7 11 23 5 16 1 0 22
Rearing
1 2 3 4 5 6 7 8 9 10 11 12 13
1 Cows
A. Gir 158 28.867 51000 26.23 20000 25.467 15000 25.233 5000 154000
Indigenous
Kankrej 137 24.933 51000 21.73 20000 21.600 15000 21.333 5000 133000
B. H. F. 248 42.600 25000 38.93 20000 36.867 15000 33.933 5000 244000
Crossbreed
Jersey 98 28.400 25000 28.00 20000 27.800 15000 27.267 5000 94000
2 Buffaloes
Jafarabadi 164 29.667 25000 25.200 20000 25.000 15000 24.667 5000 160000
Mahesani 268 27.867 25000 27.333 20000 24.733 15000 24.200 5000 264000
Surti 180 17.133 25000 15.967 20000 15.400 15000 15.333 5000 176000
N. D. 145 26.733 25000 21.400 20000 21.267 15000 20.533 5000 140000
21.400 20000
Banni 98 24.933 25000 22.733 20000 21.400 15000 21.200 5000 93000
21.400 15000
Note : - Milk Yield in Kg. , Prize in Rs.
4.11 Work Done Under Central Herd Registration Scheme, Ahmedabad Unit 2016-17 & 2017-18
Sr. Cattle Breed 2016-17 2017-18
No.
No. of Animals* Average lactation Average lactation No. of Average Average lactation
period (Days) Yields (Kgs.)* Animals* lactation Yields (Kgs.)*
period
(Days)
1 2 3 4 5 6 7 8
1 Cattle
Gir 492 299 3173.689 522 299 3281.47
Kankrej 565 296 2694.753 701 301 2759.25
2 Buffaloes
Jafarabadi 828 303 3611.317 1295 300 3151.430
Mahesani 1702 305 3126.164 639 305 3786.800
Surti 163 305 2428.530 96 294 2472.790
* The Scheme registering only good and elite animals.
57
4.12 No. of Gaushalas and Panjrapoles in Gujarat State 2017 - 18.
Sr. No. District Gaushalas attached to Total Total Total
Gaushalas Panjrapoles Gaushalas &
Religious Educational Other
Panjarapoles
Institutes Institutes Gaushalas
1 2 3 4 5 6 7 8
1 Ahmedabad 29 1 7 37 21 58
2 Amreli 10 2 12 24 18 42
3 Anand 6 1 7 14 5 19
4 Banaskantha 7 1 26 34 20 54
5 Bharuch 7 1 3 11 5 16
6 Bhavnagar 16 5 20 41 16 57
7 Dahod 0 0 5 5 0 5
8 Dang 0 0 0 0 0 0
9 Gandhinagar 10 8 4 22 6 28
10 Jamnagar 11 5 15 31 19 50
12 Kachchh 15 5 35 55 45 100
13 Kheda 3 0 3 6 8 14
14 Mahesana 1 2 4 7 9 16
15 Narmada 4 1 0 5 0 5
16 Navsari 5 1 9 15 1 16
17 Panchmahals 4 1 1 6 4 10
18 Patan 7 3 8 18 15 33
19 Porbandar 3 1 4 8 3 11
20 Rajkot 32 6 44 82 16 98
21 Sabarkantha 5 4 8 17 5 22
22 Surat 8 2 14 24 4 28
23 Surendranagar 20 5 21 46 19 65
24 Tapi 3 2 0 5 0 5
25 Vadodara 9 2 10 21 5 26
26 Valsad 4 1 15 20 6 26
58
4.13 Animals maintained by Government Aided Gaushalas And Panjarapoles 2017-18.
Sr. No. District Total Govt. Aided Cultivated Area No. of animals maintained as on 31-3-2017
Gau- Gaushalas Land under
shalas and (Hect.) Vidies
Panjara- (Hect.) Male Female Male Female Total
poles over 3 over 3 Young Young
Years Years Stock Stock
1 2 3 4 5 6 7 8 9 10 11
1 Ahmedabad 58 27 20 0 2666 2530 1131 7016 13343
2 Amreli 42 19 69 0 902 905 394 3847 6048
3 Anand 19 8 0 0 202 354 99 787 1442
4 Banaskantha 54 64 85 0 5767 4118 6761 21921 38567
5 Bharuch 16 4 10 0 224 286 116 678 1304
6 Bhavnagar 57 11 39 0 3404 3754 3573 10543 21274
7 Dahod 5 2 0 0 95 140 29 198 462
8 Dang 0 0 0 0 0 0 0 0 0
9 Gandhinagar 28 12 0 0 3194 917 263 5214 9588
10 Jamangar 50 6 20 0 5334 2455 389 5545 13723
11 Junagadh 132 32 20 0 1689 3786 674 8071 14220
12 Kachchh 100 38 120 0 7332 15459 4575 29727 57093
13 Kheda 14 3 0 0 395 557 164 1296 2412
14 Mahesana 16 14 2 0 712 423 236 1824 3195
15 Narmada 5 2 0 0 22 36 7 152 217
16 Navsari 16 6 0 0 359 219 84 686 1348
17 Panchamahals 10 6 0 0 292 270 185 561 1308
18 Patan 33 10 0 0 948 845 985 3180 5958
19 Porbandar 11 6 0 0 102 235 73 698 1108
20 Rajakot 98 64 20 0 2710 3267 1361 9561 16899
21 Sabarkantha 22 8 0 0 447 324 95 939 1805
23 Surendanagar 65 13 25 0 2524 1844 1114 18205 23687
24 Tapi 5 0 0 0 27 45 7 91 170
25 Vadodara 26 5 0 0 992 523 314 2263 4092
26 Valsad 26 5 9 0 541 906 458 1851 3756
Gujarat State 936 371 439 0 42530 45321 23299 136070 247220
59
60
61
62
D - 4 : Poultry Production In The State
7KH3RXOWU\3URGXFWLRQ3URJUDPFDQEHFODVVL¿HGLQWKHVWDWHDWSUHVHQWDVXQGHU
7KHSRXOWU\3URGXFWLRQFDQEHFODVVL¿HGLQWRWZRVHJPHQWV
Egg production
$W SUHVHQW HJJ SURGXFWLRQ LV ODUJHO\ LQ WKH ¿HOG RI RUJDQL]HG VHFWRU 7KLV SURJUDP
UXQVXQGHUKLJKO\VFLHQWL¿FZD\ZLWKWKHFDJHV\VWHPRIKRXVLQJIDFLOLWLHV/DUJHQR
of layer per units ranging from 5000 to 50,000 layers have been estimated. The units
consume high inputs and output.
Broiler Production
'HPDQGIURPSRXOWU\PHDWLQUHODWLRQWRPXWWRQSRUNEHHIDQG¿VKLVJURZLQJIRU
economical reasons. With consumer revolution of fast food and instant cooking in
urban areas, a range of easy to cook and tasty to eat delicious food are becoming
SRSXODU6WULFWOD\HUXQLWVDUHDOVRFRQYHUWHGLQWRSUR¿WDEOHEURLOHUXQLWV,QWKHEURLOHU
SURGXFWLRQSURJUDPFRPSHWLWLRQLVYHU\WRXJKDQGWKH¿WWHVWRQO\FDQVXUYLYH7KH
HI¿FLHQF\DQGHFRQRPLFVRXQGQHVVDUHWKHPRVWLPSRUWDQWFULWHULDIRUWKHVXFFHVVIXO
operation.
----------
63
5.1 Work Done under District Poultry Farms and Poultry Demostration Centres 2017-18.
Sr. Name and Location of Monthly Birds Sold For Eggs Eggs Number Debeaking Number of
No. Poultry Breeding Farms Average Breeding Table Production Sold for of Vaccination
Layer Purpose Purpose Table Broken
Purpose Eggs
1 2 3 4 5 6 7 8 9 10
I Regional Poultry Breeding Farms
1 Junagadh 0 0 0 0 0 0 0 0
2 Ahmedabad- Makaraba 1959 23231 3493 285854 18154 6430 4788 614462
3 Surat 1232 0 1745 202762 54840 1407 6000 560369
II District Poultry Farms
1 Jamnagar 0 6350 0 0 0 0 0 6350
2 Rajkot 410.26 818 414 56863 9765 0 799 27576
3 Shihor- Bhavnagar 0 9850 0 0 0 0 0 9675
4 Sabarkantha- Himmatnagar 642 310 464 96,605 39,736 1543 1705 82351
5 Vadodara 997 0 2299 129678 24863 157 4149 167849
6 Dahod - Panchmahals 678 0 1506 67452 14726 1790 1168 33970
7 Valsad-Vansda 734 0 648 72542 73091 0 0 11247
8 Ahwa-Dang 0 9375 0 0 0 0 7189 25419
9 Nadiad-Kheda 0 0 0 0 0 0 20600 822908
III Poultry Demonstartion Centres
1 BK-Palanpur 0 0 0 0 0 0 0 54432
2 Vadodara Dabhoi- 461 210 432 71493 6269 13 2668 10965
3 Bharuch-Divi 0 0 0 0 0 0 0 12174
4 Tapi-Vyara 0 1098 0 0 0 0 2187 3190
5.2 Work Done by Chick Rearing Centres 2017-18.
Sr. District Breed Chicks Reared Chicks Sold Vaccination
No. Reared Govt. Private Institutes Total
Institutes
1 2 3 4 5 6 7 8
111
RIR 9730 9619 9730
97
1 Palanpur- Banaskantha 0 54432
Broiler 0 0 0
0
0
Vanraja 0 0 0
0
0
Vadu-Vadodara RIR 1948 0 0 8605
0
2
CARI. 6902
D.P.F. - Vadodara 12305 4960 11862 167849
Bro. 4419
7757
3 Valiya- Bharuch RIR 7757 0 7757 23271
4419
0
RIR 0 0 0
4 Vyara-Tapi 19 13560
Broiler 0 0 0 0
6416
RIR 17016 10600 17016
11398
3740
5 Chanvai- Valsad Broiler 3740 0 3740 0
1835
0
Vanraja 0 0 0
0
RIR= Rhode Island Red
64
5.3 Work done under Intensive Poultry Development Blocks 2017- 18.
Sr. Item Surat Junagadh Makaraba- Valsad vadodara Valiya- Vyara-Tapi Himmat- Nadiad- Dahod Rajkot Mahesana Total
No. A’bad Bharuch nagar Kheda
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
1 No Of Centres 7 5 4 10 6 6 3 6 5 6 5 2 65
No of Birds Reported to
2 522836 16000 614462 1096189 389359 457417 143460 157307 831949 351080 226691 365860 5172610
Have been covered (000)
3 No of Poultry Keepers 2286 7 737 4893 4805 6544 517 3464 1958 2699 194 1069 29173
No of chicks Supplied
4 80044 0 187164 20756 125024 10200 133150 27760 0 24355 11550 2250 622253
(000)
5 Poultry Feed Manufacturing (MT)
(1) Chick Mash 71.54 0 71.5 0 72.52 0 0 33 0 32 0 0 280.56
(2) Grower Mash 131.32 0 191.5 0 114.66 0 0 104.47 0 45 0 0 586.95
(3) Layer Mash 126.42 0 0.00 0 0 0 0 28.00 0 0 0 0 154.42
(4) Breeder Mash 0 0 164.5 0 90.16 0 0 0.00 0 0 0 0 254.66
(5) Other 46.5 0 9.4 0 10.78 0 0 0.00 0 29 0 0 95.68
65
Total 375.78 0.00 436.90 0.00 288.12 0 0 165.47 0 106 0 0 1372.27
6 Poultry Feed Distributed (MT)
(1) Chick Mash 71.43 0 71.50 0 72.58 13.7 0 34.50 0 32.00 20.00 0 315.71
(2) Grower Mash 129.95 0 191.50 21.2 119.17 44.7 20.00 103.81 52.68 45 26.00 22.71 776.72
(3) Layer Mash 126.37 0 0.00 0 0 0 0 27.5 0 0 0.00 0 153.87
(4) Breeder Mash 0 0 164.50 0 26.43 0 0 0 0 0 23.50 0 214.43
(5) Other 45.5 0 9.25 0 74.51 0.00 0 0 0 29 0.00 0 158.26
Total 373.25 0.00 436.75 21.2 292.69 58.40 20.00 165.81 52.68 106.00 69.50 22.71 1618.990
7 No Of Vaccination
(1) Ranikhet F1- Strain 84512 9783 54273 551232 46494 15324 32010 37277 321325 110757 16608 3945 1283540
(2) R2B Strain 121379 9525 3337 155431 50158 23040 87009 30896 2000 26393 2492 0 511660
(3) Fowlpox 117371 9560 3337 157431 66541 16264 89615 31985 53222 11682 3593 5915 566516
(4) Mareks 79545 0 189544 22860 131413 0 0 24980 0 8900 0 0 457242
(5) Others 157562 19503 358971 697948 139611 236212 50195 25979 300661 121144 197052 146900 2451738
Total 560369 48371 609462 1584902 434217 290840 258829 151117 677208 278876 219745 156760 5270696
8 No of Birds Debeaked 6000 0 4788 228648 15974 8757 33010 8705 20600 16112 3012 26400 372006
9 No of Trainers Trained 441 405 623 617 405 464 272 396 625 517 438 256 5459
5.4 Work done Under District Poultry Extension Centres 2017-18.
Sr. Item Jamnagar Sihor- Kachchh Palanpur- Ahwa- Total
No. Bhavnagar B.K. Dang
1 2 3 4 5 6 7 8
1 Centres 4 3 4 6 3 20
5 (C ) Layer mash 0 0 0 0 0 0
(E) Other 0 0 0 0 0 0
No. Of Vaccination
(C ) Mareks 0 0 0 0 0 0
66
5.5 Production and Disposal of Egg at Poultry Breeding Farms : 2017-18.
Sr. District Location of the Breed Average No of No of eggs No of Eggs No Of Eggs Hatcha-bility Day Old Day Old
No. Farm 3URGXFHG set for Supplied For on Total Chicks Chicks
Layer Eggs
Purchased hatching table Purpose Eggs % Produced Distributed Or
Per
Sold
Layer
1 2 3 4 5 6 7 8 9 10 11 12
Broiler 0 0 0 0 0 0 0 0
1 Junagadh R P B F Junagadh
RIR 0 0 0 0 0 0 0 0
Broiler 1959 132 257689 220355 9990 67.72 149230 147372
2 Ahmedabad R P B F Makarba
Turkey 205 136 72218 60696 8069 66.42 40314 39750
Broiler 0 0 0 0 0 0 0 0
3 Vadodara D P B F Vadodara RIR 465 171 79516 55071 24482 70.50 36923 36608
Caribro 997 130 129678 110433 24863 80.00 84005 83572
67
Broiler 0 0 0 0 0 0 0 0
4 Surat R P B F Surat
RIR 1232 164 202762 143873 54840 56.18 80404 78765
DPBF Broiler 0 0 0 0 0 0 0 0
5 Sabarkantha
Himmatnagar RIR 642 150 96605 47555 39736 58.37 27760 27760
Broiler 0 0 0 0 0 0 0 0
6 Dahod D P B F Dahod Kadaknath 678 89 67452 53418 16516 50.43 26941 24355
RIR 0 0 0 0 0 0 0 0
Mandvi- Duck-Khakhi
7 D.B.F 0 0 0 0 0 0.00 0 0
Surat Campbel
R P B F= Regional Poultry Breeding Farm RIR= Rhode Island Red DBF=Duck Breeding Farm
1 (A) Hen Housed (%) 30.9 0 37.2 36.05 35.41 0 0 0 43.67 40 41.72 42.04 0
(B) Hen Day (%) 36 0 33.79 39.79 37.54 0 0 0 54.59 36 89.00 49.87 0
Kilos Of Feed Used per
2 6.09 0 3.28 5.94 2.46 0 0 0 3.4 3.1 44430 4.126 0
Dozen of Eggs (Kgs.)
Average Feed Used Per Bird /
3 140 0 106 140.83 132.25 0 0 0 120 160 116 129 0
Day (gms)
4 Average Weight Of Egg (gms) 45 0 56 65 53 0 0 0 52 55 35 53 0
Mortality (%)
68
(1) 0-8 Weeks 1.04 0 0 3.75 2.76 0 0 0 0.3 6.43 267.00 3.02 0
5
(2) 9-20 Weeks 0.31 0 0 2.3 2.31 0 0 0 0.23 1.27 22.00 2.11 0
(3) 21-72 Weeks 1.65 0 0 1.97 2.59 0 0 0 1.5 1.09 45.00 1.89 0
6 (1) 20 Weeks Of Age 1.92 0 1.5 2.8 1349 0 0 0 1.8 2.67 1220 1.42 0
(2) 72 Weeks Of Age 2.39 0 2.3 3.0 1714 0 0 0 2.1 3.71 0.0 2.29 0
Age at First Production
7 21 0 144 158 25 0 0 0 120 180 156 128 0
Days
RIR= Rhode Island Red
5.7 Poultry Feed Samples Received and Analysed by the Poultry Feed Testing
Laboratory - Anand.Year :2017-18.
Sr. Details Compound Feed Raw Other Total Samples
No. Samples Material Samples Received
Samples
1 2 3 4 5 6
Previous year’s
Poultry Feed Pending (if 0 0 0 0
1 Samples any)
Received
Current 241 224 24 489
Previous year’s
Poultry Feed Pending (if 0 0 0 0
2 Samples any)
Analysed
Current 241 224 24 489
1 2 3 4 5 6 7 8 9 10 11 12 13
2 Himmatnagar 33.00 520 104.47 460 28.00 520 0.00 0 0.00 0 165.47
Makarba-
3 71.50 524 191.50 464 0.00 0 164.50 488 9.40 528 436.90
Ahmedabad
5 Vadodara 72.52 529 114.66 462 0.00 0 90.16 480 10.78 492 288.12
6 Surat 71.54 528 131.32 440 126.42 492 0.00 0 46.50 0 375.78
69
70
71
72
D - 5 : Sheep, Goat and Wool Development
Sheep population is 17.07 lac in Gujarat as per livestock census - 2012.
More than 70% of sheep & goats are reared by small/marginal farmers and landless
labors. Major portion of sheep population is in Saurastra and North Gujarat. Sheep
DQGZRROGHYHORSPHQWDFWLYLWLHVRIWKHVWDWHKDYHVLJQL¿FDQWLPSURYHPHQWEHFDXVH
the population of the sheep is almost 8.47% of the total livestock population in the
state and it has tremendous scope for further expansion.
7KHUHDUHVL['LVWULFW([WHQVLRQ&HQWHUV¿YH,QWHQVLYH6KHHS'HYHORSPHQW
Projects, one Large Scale Sheep Breeding Farm and two Migratory Sheep and Goat
Service Centers are being run in the state, which provides technical and extension
services like Treatment, Vaccination, Drenching, Dusting, Castration, etc. to the
sheep and goat breeders of the state. Also, there are four Sheep Breeding Farms in
the State. The GSWDC provides all necessary marketing facilities for the sale of
wool and other by-products.
BREEDS OF SHEEP
There are three breeds of sheep viz ; Patanwadi, Marwadi and Dumba in the state.
PATANWADI
The breed is well known for Roman nose character,
brown to dark brown colour of face extended up to the
neck and all four legs below knee and hock. It possesses
low set body with pinched hip and pendulous abdomen.
The ears are twisted, tubular and of medium length.
Flower appendages are quite common. The breed is
polled.
MARWADI
The breed resembles black-headed Persian sheep but
LV VPDOOHU LQ VL]H DQG KDV JRRG ÁHHFH +DUG QDWXUH RI
Marwadi breeds which has been useful in migration
during frequent drought periods.
DUMBA
Dumba animals are heavy in body and good milk yielder.
Dumba sheep are found in Jamnagar and Rajkot district.
73
Programs & Schemes
Sheep Breeding Farms:
Goat development:
Goat population in the state is nearly 46.40 laces which are about 130% more
than the sheep population in the state. The main breed of Goat in Gujarat are Kachchhi,
Mahesani, Surati, Zhalawadi and Gohilwadi.
74
Status of various Goat farm of Gujarat
75
Name of Breed Breeding
Farm
Breed
Characters Track
Photograph
Goat breeding Kachchhi Body is black Kachchh
farm-Naliya. with few
Dist. Kachchh white spots
-Long and
coarse hair
coat-Long
and broad
ears- Ave.
Milk yield is
1.8 Kg
Goat breeding Surti White body Surat, Vadodara
farm-Kondh. colour – Small & Panchmahal
Dist. Bharuch horns going
backward-
Medium size
ears- Well
developed
udder- Ave.
Milk yield is
2.5 Kg
Conservation & propagation of pure breed is main object of Goat farm. The pure
breed adult buck produce on these farms are distributed to breeder at nominal cost.
Goats are reared and bred by selective breeding at the farm. There is one National
Goat Demonstration unit functioning at Morbi, which provides suitable demonstration
for the local goat breeder. Goat is domesticated for meat and milk.
Subsidy is given for goat unit (10+1) to Scheduled Caste people, Scheduled tribe
female and General category people for the establishment of Goat units.
Goat can thrive in areas where fodder resources are limited where milch cattle
do not thrive. The goat has ability of thrive on a class of fodder on which other animal
VWDUYHWRGHDWK*RDWLVFRQVLGHUHGDVSRRUPDQ¶VFRZ(FRQRPLFHI¿FLHQF\RIJRDW
over sheep is well documented. It is found that goat is 160% more economic than sheep
and 130% more economical than cattle on zero input basis. Goat has remarkably high
IHHGHI¿FLHQF\ERWKIRUPHDWDQGPLONSURGXFWLRQ
76
Horse Development:
Kathiawadi and Marwadi are two important horse breed of Gujarat. Kathiawadi
horses are found mostly in Saurastra region and Marwadi horses are found mostly in
north Gujarat. Animal Husbandry Dept. of Gujarat State has undertaken a program for
FUHDWLQJDZDUHQHVVDPRQJVWWKHKRUVHNHHSHUVUHJDUGLQJVFLHQWL¿FKRUVHNHHSLQJ)RUWKH
preservation and propagation of valuable germplasm of Kathiwadi horse, Department
of Animal Husbandry, Gujarat state has established one horse breeding farm at Inaj,
Ta: Veraval. Dist. : Gir Somnath. Horse breeding farm for Marwadi breed is established
at Chanasma Dist.-Patan. Breeding and other technical services are provided to the
horse keepers through 12 Stallion Service Centers. In Gujarat state, Kathiawadi and
Marwadi horse care taker association organizes exhibition and competition of horses
in collaboration with the State Govt. Horse Shows are also organized by Horse Society
ZKLFKDUHVHOHFWHGE\JRYHUQPHQWZLWK¿QDQFLDODVVLVWDQWE\WKH6WDWH*RYW7KHJRRG
KRUVHVFDQEHLGHQWL¿HGGXULQJVXFKFRPSHWLWLRQV
Kathiawadi Marwadi
Status of various Horse farms of Gujarat
+RUVH %UHHGLQJ )DUP ,QDM 7D 'HSDUWPHQWRI$+ Kathiawadi
Veraval, District- Gir Somanath
77
Donkey Development:
Generally two types of domesticated donkeys are seen in Gujarat i.e. White
coloured and Ash coloured (Bhagra). Ash coloured donkeys have black strip on the
back. This black strip of 9-10 inches extends vertically from withers to the shoulders
on either side. This strip extends right from the neck base up to the tail base. They are
short with long ears that stand erect. The white donkeys are totally white. The good
donkeys have height of 10-12 hands. Their ears are high, large and are such that hollow
portion can be seen from the front side. The legs are thick, strong and proportionately
long. In Gujarat, a fair organizes every year at ‘Vautha’ in Dholka Taluka. This fair is
very famous for sale of donkeys and also for race competition of donkeys. Department
of AH is established a donkey breeding farm for the purpose of pure bred white Donkey
production at Chanasma Dist-Patan.
Camel Development:
Camel is an important component of desert ecosystem. It possesses many unique
qualities which make it distinctly superior than other domesticated animals in the hot
and arid desert ecosystem. In the Indian dry land farming systems, the camel is a major
source of power for transport and agricultural activities. It also provides milk, hair,
hide, manure, bones and meat to the societies.
Kachchhi Kharai
78
Gujarat is best owed with Kachhchhi camel. Kachcchi breed is very old and pristine
breed and lightly built compared to Bikaneri. Its body coat is light brown in colour. It
has thin neck, small closely set mouth with small ears and prominent eyes. Muzzle is
barred. Kachchhi camels are good milk producer and can pull weight of 1600 kg with
speed of 5km/hour. It works with 0.75 to 1.32 HP energy. For pulling 1.4 -1.8 MT load
for 4 hours a day, its dry matter requirement is 1.8 -2.00% of body weight.
Gujarat state has a camel breeding farm located at Dhori, Dist: Kachchh for the
conservation and propagation of Kachchhi breed. Good camels are provided to the
army and police force and also to private farmer for camel cart. Efforts are made
to conserve breed characteristics of camels on these farms. Establishment of Camel
Breeder’s Association named-Kachchh Unt Ucherak Maldhari Sangathan is organized.
Recently a new breed of Camel in Gujarat “Kharai” is registered by NBGAR, Karnnal.
Kharai camel are able to survive in dual ecosystem (sea water and on desert land) of
kachchh region.Kharai camel also swimming in water, its body coat is mostly browen
white mix (charvo) and dark black.It has large head, thich neck , erect ears with tip
slightly curved inside , small and short chest pad and longer and softer hair.
&DPHO%UHHGLQJ)DUP'KRUL7D
'HSDUWPHQWRI$+ kachchhi
%KXM'LVWULFWNDFKFKK
----------
79
6.1 Production of Wool and Distribution of Sheep 2017-18.
Sr. District Name and Breed Foundation Stock as on Average of
No. Location of 1-4-2017 31-3-2017 Wool yield
Farm per Sheep
Adult Lamb Adult Lamb
(kg.)
1 2 3 4 5 6 7 8 9
1 Rajkot L.S.S.B.F, Patanwadi 67 49 82 49 0.656
Jasdan
Marwadi 0 0 0 0 0.000
(Under
GSWDC) G2 25 7 19 7 0.497
G3 0 0 0 0 0.000
Magra 17 3 6 4 0.582
Rus.Merino 0 0 0 0 0.000
Ramboilet 0 0 0 0 0.000
Awasi.x Pat. 84 60 91 56 0.411
F1 0 0 13 18 0.632
Duma 0 0 0 0 0.000
Total : A 193 119 211 134 0.556
2 Kachchh SBF, Naliya, Marwadi 0 0 0 0 0.000
Ram Depot
G2 0 0 0 0 0.000
Nana Layeja
F1 0 0 0 0 0.000
Dumba 0 0 0 0 0.000
Patanwadi 132 88 120 55 0.606
Chokhla 0 0 0 0 0.000
Total : B 132 88 120 55 0.606
Ram Depot, G2 0 0 0 0 0.000
Mankuva
F1 0 0 0 0 0.000
Dumba 0 0 0 0 0.000
Marwadi 0 0 0 0 0.000
Patanwadi 34 0 55 10 0.597
Chokla 0 0 0 0 0.000
Total : C 34 0 55 10 0.597
3 Banaskantha Ram Depot, Patanwadi 0 0 0 0 0.000
Asheda
Marwadi 207 90 169 67 0.698
(Under
GSWDC) Magra 0 0 0 0 0.000
Avikalin 0 0 0 0 0.000
Total : D 207 90 169 67 0.698
4 Amreli Chalala Patanwadi 0 0 0 0
Sheep Not shorn
Awasi.x Pat. 28 13 0 0 EHFDXVHLQ¿HOG
Total : E 28 13 0 0 for breeding
80
6.2 Sheep and Wool Development work done 2017-18.
Sr. Item ISDP District Extension Centres (Sheep and Wool) Total
No. Unit Bhuj Bhavnagar Palanpur Dahod Vadodara Surendra- Porbandar Morbi Amreli Jamkham- LSSBF Service
Kachchh (GSWDC) Banaskantha nagar Junagadh Rajkot bhalia Centres Centres
(GSWDC) Jamnagar (GSWDC) for
(GSWDC)
migratory
ÀRFNV
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
1 Centres Nos. 22 23 21 10 10 7 8 9 7 15 45 2 179
81
4 5DPEXFNVV&HUWL¿HG Nos. 16690 1972 1448 100 95 14 571 495 201 793 11275 206 33860
5 )ORFNV&HUWL¿HG Nos. 4115 2450 668 30 69 2 266 179 106 1608 4784 98 14375
6 Rams/bucks castrated Nos. 1790 1284 10069 650 636 1970 4380 4125 2853 936 5496 1126 35315
7 Sheep/Goat treated Nos. 61380 53817 48434 18750 20864 3634 3130 7191 12237 28844 119910 3883 382074
Sheep/Goat drenched with
8 Nos. 430362 287377 208032 70051 74188 10050 23994 118929 138369 184604 185395 200560 1931911
Anthelmentics
9 Sheep/Goat vaccinated Nos. 171534 78159 329738 75437 72455 41000 49776 416890 79310 60001 94980 101577 1570857
10 Sheep dusted with Gamaxin Nos. 0 2848 0 1279 0 2222 1377 5643 1734 0 42870 7545 65518
6.4 Purchase and Sale of Wool by Gujarat Sheep and Wool Development Corporation
2017 -18.
Sale of Wool
82
83
84
7.1 Details of the Kathi Horses maintained at Horse Breeding Farm, Junagadh and Inaj.
Sr. Category HBF, Junagadh HBF, Inaj
No.
1 2 3 4 5 6
1 Stallion 7 6 2 3
2 Mare 21 21 15 19
3 Colt Foal (1 to 4 Years) 2 3 6 8
4 Filly Foal(1 to 4 Years) 1 2 4 7
5 Foal (0 to 1 Year) 3 5 7 7
6 Teaser 0 1 0 0
Total 34 38 34 44
7.2 No. of Services provided by Stallions at Horse Breeding Farm, Junagadh and its Sub-centres 2017-18.
Sr. District Horse Breeding No of Services provided
No. )DUP6XE by Stallions
Centres
1 2 3 4
1 Rajkot Gondal 65
Chotila 0
2 Surendranagar
Limbdi 76
Gadhada 41
3 Bhavnagar Paliyad 183
Savarkundla 166
Babara 0
4 Amreli
Nageshri 61
5 Junagadh Junagadh 0
6 Gir Somnath Inaj,Veraval 261
7 Porbandar Porbandar 26
8 Banaskantha Deodar 25
9 Mahesana Chanasma 75
10 Ahmedabad Dhandhuka 0
Total 979
7.3 Details of Camels maintained at Camel Breeding Farm, Dhori, Kachchh 2017-18.
Sr. Category 1RRI$QLPDOVDVRQ No of Animals as on
No.
1 2 3 4
1 Male Camels (1 to 5 Years) 21 34
(5 to 25 Years) 0 0
2 Breeding Stud Camels 0 2
3 Adult Female Camels (5 to 25 Years) 166 178
4 Female Camels (1 to 5 Years) 69 73
5 Sucking Calves (0 to 1 Years)
(i) Male 33 33
(ii) Female 28 19
Total 317 339
85
7.4 Horse maintained at Horse - Donkey Breeding Farm,Chanasma,Patan, 2017-18.
Sr. Particulars Opening Increase Decrease Closing
No. Balance Balance
Birth Purchase Class Total Death Sell Class Total
transfer transfer
1 2 3 4 5 6 7 8 9 10 11 12 13 14
Pregnant 2 0 0 2 2 1 0 0 1 3
Conceived 6 0 0 0 0 0 0 3 3 3
1 Mare
Empty 1 0 0 1 1 0 0 0 0 2
Total 9 0 0 3 3 1 0 3 4 8
Pregnant 0 0 0 1 1 0 0 0 0 1
Empty 0 0 0 0 0 0 0 0 0 0
Pregnant 0 0 0 1 1 0 0 0 0 1
3 to 4yr Conceived 0 0 0 0 0 0 0 0 0 0
2 Foal
Empty 0 0 0 0 0 0 0 0 0 0
2 to 3 yr 1 0 0 0 0 0 0 1 1 0
1 to 2 yr 0 0 0 0 0 0 0 0 0 0
0 to 1yr 0 4 0 0 4 0 0 0 0 4
Total 2 4 0 2 6 0 0 2 2 6
Above 4yr 0 0 0 0 0 0 0 0 0 0
3 to 4yr 0 0 0 0 0 0 0 0 0 0
2 to 3 yr 0 0 0 1 1 0 1 0 1 0
3 Colt
1 to 2 yr 3 0 0 0 0 0 2 0 2 1
0 to 1yr 2 1 0 0 1 0 3 0 3 0
Total 5 1 0 1 2 0 6 0 6 1
Total (1+2+3) 16 5 0 6 11 1 6 5 12 15
5 Male at Farm 2 0 0 0 0 0 1 0 1 1
Grand total 20 5 0 6 11 1 7 5 13 18
86
7.5 Donkey maintained at Horse - Donkey Breeding Farm, Chanasma, Patan, 2017-18.
Sr. Particulars Opening Increase Decrease Closing
No. Balance Balance
Birth Purchase Class Total Death Sell Class Total
transfer transfer
1 2 3 4 5 6 7 8 9 10 11 12 13 14
Pregnant 5 0 0 5 5 1 0 5 6 4
Conceived 2 0 0 6 6 0 0 0 0 8
Jennies
1 (Donkey)
Empty 7 0 0 2 2 0 0 6 6 3
Total 14 0 0 13 13 1 0 11 12 15
Pregnant 0 0 0 0 0 0 0 0 0 0
Empty 0 0 0 0 0 0 0 0 0 0
Pregnant 0 0 0 0 0 0 0 0 0 0
3 to 4yr Conceived 0 0 0 0 0 0 0 0 0 0
2 Foal
Empty 0 0 0 0 0 0 0 0 0 0
2 to 3 yr 4 0 0 5 5 1 0 4 5 4
1 to 2 yr 5 0 0 3 3 1 0 5 6 2
0 to 1yr 3 6 0 0 6 0 0 0 0 9
Total 13 6 0 8 14 2 0 10 12 15
Above 4yr 0 0 0 0 0 0 0 0 0 0
3 to 4yr 0 0 0 0 0 0 0 0 0 0
2 to 3 yr 1 0 0 0 0 0 1 0 1 0
3 Colt
1 to 2 yr 7 0 0 0 0 1 6 0 7 0
0 to 1yr 4 6 0 0 6 0 6 0 6 4
Total 12 6 0 0 6 1 13 0 14 4
Stallion
4 Marwadi 0 0 0 0 0 0 0 0 0 0
at Center
Grand total 40 12 0 21 33 4 13 21 38 35
87
88
89
90
D - 6 : Dairy Development
India is leading on top in the world for total milk production per year. Likewise
Gujarat State is also leading State for milk production in the country. “Amul” pattern
is well known and accepted by all the states in our country and some of the other
countries also. Milk procurement by co-operative movement is basic theme in our
state. At village level 18932 Milk Co-operative Societies, 105 Chilling centers and
17 Dairy processing units at 21 district level (Dairy) are in functioning in the state.
Reaming four dairy union of Kachchh-Saurastra region is assisted for establishment of
processing plant under RKVY scheme. They collected total of 68015.68 Lakh Kg milk
and process, State government has given full support to Dairy Development through
Dairy Co-operation movement.
10 Districts Co-operative Union have established Cattle Feed Factories to
SURGXFHVDQGVXSSO\FDWWOHIHHGWRPHPEHUVDWYLOODJHOHYHODWQRSUR¿WQRORVVEDVLV
Total production of cattle feed is 1887330.959 M.T. by above eleven cattle feed factories.
21 Co-operative Dairy Unions have total 222.5 LLPD milk processing capacity and
they produced 186.34 LKPD milk in the year 2017-18.These 21 dairy unions have 105
chilling centers also having capacity of 98.34 LLPD milk.
State government has made provision of Rs.61.88 crore for Dairy development
XQGHUWKH$QLPDO+XVEDQGU\GHSDUWPHQWGXULQJWKH¿QDQFLDO\HDU:KLFK
include infrastructure development, cold chain maintenance, computerization system
for village milk society and cattle feed plant establishment.
-----------
91
8.1 Production & Sale of Cattle Feed 2017-18. (M.T.)
Sr. Location of Cattle feed factory Brand Name Apr-17 May-17 Jun-17 Jul-17 Aug-17 Sep-17
No.
Production Sale Production Sale Production Sale Production Sale Production Sale Production Sale
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
1 Ahmedabad - Uttam Dairy Uttam dan 1467 1468 1317 1339 1314 1213 1126 1206 1257 1282 1134 1106
2 Banaskantha- Banas Dairy Banas dan 43013 42691 42082 42933 39269 39121 37991 38179 46671 46282 44523 44462
4 Bhavanagar Sarvottam Dairy - 566 543 622 627 554 592 618 643 532 527 511 579
5 Gandhinagar Madhur Dairy - 0 111 0 65 0 51 0 27 0 26 0 27
6 Kheda-Kanajari Amul Dairy Amuldan 39719 38203 33351 34155 31689 32184 34511 33949 36555 35981 35947 36085
7 Mahesana - Boriyavi & Ubkhal Sagar Dairy Sagardan 22618 22270 21074 20170 19598 19025 17869 18201 20622 19750 18591 18049
8 Panchmahal- Godhra Panchamrut Dairy Panchamrutdan 4573 4382 3523 3832 3813 3868 4312 4173 4678 4715 5044 5073
92
9 Rajkot - Dairy Sarkhej - 0 392 478 318 273 475 310
10 Sabarkantha - Himatnagar Sabar Dairy Sabardan 30504 30202 27173 27131 26331 26252 28427 27787 28449 28319 28614 27967
11 Surat- Chalthan Sumul Dairy Sumuldan 12567 12287 14166 13861 11704 11732 12281 12314 11973 12261 12963 12801
12 Surendranagar - Sursagar Dairy - 0 316 0 307 0 340 0 191 0 218 0 274
13 Valsad-Sagbara Vasundhra Dairy Vasundhara dan 0 0 0 0 0 0 0 0 0 0 0 0
14 Vadodara- Itola Baroda Dairy Baroda dan 2061 1935 1709 1685 1501 1612 1515 1614 2101 1977 1601 1612
15 Amareli - Amar Dairy - 48 51 101 46 100 99 104 106 151 146 90 90
16 Junagadh - Sorath Dairy - 0 0 0 0 0 0 0 0 0 0 0 0
17 Kachchh - Sarhad Dairy - 0 2 0 1 0 1 0 1 0 1 0 0
TOTAL 157136 213653 145116 233531 135873 235309 138754 341914 152989 302511 149017 352984
8.1 Conti…. (M.T.)
Sr. Location of Cattle feed factory Brand Name Oct-17 Nov-17 Dec-17 Jan-18 Feb-18 Mar-18 TOTAL
No.
Production Sale Production Sale Production Sale Production Sale Production Sale Production Sale Production Sale
1 2 3 16 17 18 19 20 21 22 23 24 25 26 27 28 29
1 Ahmedabad - Uttam Dairy Uttam dan 1060 1026 1028 1054 1010 982 122 1133 1000 1048 1088 1080 12922 13937
2 Banaskantha- Banas Dairy Banas dan 45633 46946 47929 56533 48619 53278 52057 53012 46703 52503 48290 57347 542780 573287
3 Bharuch Dudhdhara Dairy - 0 101800 0 110800 0 76200 0 106950 0 115900 0 127250 0 1441850
4 Bhavanagar Sarvottam Dairy - 737 622 588 609 531 499 666 711 727 699 789 861 7442 7511
5 Gandhinagar Madhur Dairy - 0 34 0 37 0 63 0 86 0 61 0 26 0 613
6 Amuldan
Kheda-Kanajari Amul Dairy 40533 39703 46474 46201 43075 42989 45528 45023 44754 44434 43616 43205 475751 472113
7 Sagardan
Mahesana - Boriyavi & Ubkhal Sagar
17572 17339 19698 20231 20763 19637 20352 19999 18496 18518 17529 17240 234783 230429
Dairy
93
8 Panchmahal- Godhra Panchamrut Panchamrut-
dan 5205 5076 6392 6315 5287 5390 5301 5321 5152 4713 3693 4089 56972 56947
Dairy
9 0 419 0 287 0 413 0 356 0 248 0 263 0 4232
Rajkot Dairy -
10 Sabardan
Sabarkantha - Himatnagar Sabar
29983 30035 31214 30964 32235 32598 34716 35108 32337 30042 30515 30904 360497 357309
Dairy
11 Sumuldan
Surat- Chalthan Sumul Dairy 13840 13639 15431 15276 18542 18478 16304 16593 15464 15455 18393 18713 173627 173409
12 -
Surendranagar - Sursagar Dairy 0 126 0 135 0 182 0 186 0 165 0 182 0 2622
13 Valsad-Sagbara Vasundhra Vasundhara-
dan 0 0 0 0 0 0 0 0 0 0 0 0 0 0
Dairy
14 Baroda dan
Vadodara- Itola Baroda Dairy 1729 1749 1712 1636 1676 1729 1918 1827 1653 1754 1676 1552 20852 20682
15 Amareli - Amar Dairy - 50 75 768 757 52 101 105 76 37 59 100 66 1705 1672
16 Junagadh - Sorath Dairy - 0 0 0 0 0 0 0 0 0 0 0 0 0 0
17 Kutchh - Sarhad Dairy - 0 0 0 1 0 2 0 2 0 2 0 2 0 16
TOTAL 156342 258590 171233 290836 171791 252541 177070 286382 166323 285600 165688 302780 1887331 3356630
8.2 Information Regarding Dairy Development .
( In Lakh Liters )
Sr. 3ODQ<HDU Fluid Milk Capacity Average Average Milk
No. Plants of handling Milk distributed
Milk per procured per Day
day per Day
1 2 3 4 5 6
At the end of Seventh Plan i.e. 19
1 13.55 10.45 10.16
1990-91 (GDDC+Abad)
At the end of Eigth Plan i.e. 19
2 24.75 16.31 16.14
1992-93 to 96-97 (GDDC+Abad)
At the end of Ninth Plan i.e. 18 - 12
3 55.80 44.43 30.68
1997-98 to 2001-02 (6 GDDC)
94
8.3 Procurement and Distribution of Milk 2017-18.
(Lakh Liters)
Sr. District No. of Insalled Quantity Quantity of Rate of Distribution per Liter (Rs.)
No. Co-op. Capacity of Milk 0LON6DOH Whole Tonned Standard Double Skim
Dairies per day Procured Distributed Milk Milk Milk Tonned Milk
(lakh) per per day Milk
day
1 2 3 4 5 6 7 8 9 10 11
1 Ahmedabad 1 2.50 2.99 0 50.00 40.00 46.00 46.00 48.00
15 Porbandar 1 0 3.68 0 0 0 0 0 0
95
8.4 Cattle Feed Production Capacity and Price 2017-18.
Sr.No. Cattle Feed Factory Cattle Feed Production Production 3ULFH075V
Brand Capacity (M.T. per day ) as on Mar-18
(MTPD)
1 2 3 4 5 6
1 Ahmedabad –Sarkhej Uttamdan 100 - 15000.00
2 Banaskantha – Palanpur Banasdan 1600 - 15000.00
3 Bhavnagar Sarvottamdan 300 - 13660.00
4 Ubakhal, Mahesana Sagardan 450 -
17143.00
5 Jagudan, Mahesana Sagardan 1000 -
6 Sabarkantha –Himmatnagar Sabardan 1250 - 15615.00
7 Itola – Vadodara Barodadan 400 - 16500.00
8 Kanjari- Kheda Amuldan 2500 - 15857.00
9 Khandheri – Panchmahal Panchamrutdan 400 - 18000.00
10 Chalthan- Surat Sumuldan 800 - 16000.00
TOTAL 9100 - -
Dairy units registered under “Milk and Milk Product Order-1992” In Gujarat
8.5
State up to the end of year 2010-2011.
Sr. No. Agencies No. of Under Govt. Under Govt. of India
Registration of Gujarat
1 2 3 4 5
Dist. Co-op. Milk Producers’ 12
1 15 3
Union
2 G.D.D.C.* 7 6 1
3 Private Sectors 26 3 23
4 Others 5 4 1
TOTAL 53 25 28
96
8.6 Cattle Camps organized and Treatments provided 2017-18.
Sr.No. District No.of Cattle Cases treated Treatments
Camp In Cattle First Aid Normal Special TOTAL
Camp visit visit
1 2 3 4 5 6 7 8
3 Banaskantha 0 0 0 0 0 0
5 Bhavnagar 0 0 0 0 0 0
7 Devbhoomi Dwarka 0 0 0 0 0 0
8 Gandhinagar 22 1386 0 0 0 0
9 Junagadh 52 4114 0 0 0 0
13 Morbi 0 0 0 0 0 0
97
8.7 Dairy Products manufactured by Co-op. Dairies in Gujarat State 2017-18.
( M. T. )
Sr. District Milk Powder Butter Butter Ghee Cream Mava Cheese Butter Butter Amul spray Penda
No. (Delhi milk milk (Delhi Spray
Skim Skim Milk Powder Whole Operation) (000’lit) Operation)
(Delhi Operation) Milk Milk
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
1 Ahmedabad 0 0 0 0 0 339.00 0 0 0 8687 0 0 0
2 Amreli 0 0 0 0 0 392 0 0 0 0 0 0 0
3 Banaskantha 15426 0 0 0 0 9508.00 0 0 7786 24943 0 13066 0
4 Bharuch 0 0 0 0 0 0 0 0.0 0 0 0 0 0
5 Bhavnagar 0 0 0 0 0 4.46 0 0 0 31.54 0.00 0 0
6 Botad 0 0 0 0 0 0.00 0.00 0 0 0.00 0.00 0 0
7 Devbhoomi Dwarka 0 0 0 0 0 0 0 0 0 0.00 0.00 0 0
8 Gandhinagar 192 0 0 0 0 617.32 1608 0 0 14339.11 0.00 0 0
9 Junagadh 0 0 0 0 0 0.00 0 0.0 0.0 0.00 0.00 0 0
10 Kachchh 212 0 0 0 0 615 0 0 0 15427.03 0.00 0 0
11 Kheda 22040 0 395 0 0 5441 0 2 16255 42863.00 0.00 15897 223
98
12 Mahesana 25001 8395 1339 0 1076 10691.92 0 0 0 23853.00 5501.24 16577 0
13 Morbi 0 0 0 0 0 0 0 0 0 0 0 0 0
14 Panchmahals 7890 0 0 0 0 5181.00 0.0 0 0 19545.00 0.00 0 0.0
15 Porbanadar 0.0 0.0 0 0 0 0.00 0 0 0 0.00 0.00 0.0 0.0
16 Rajkot 0.0 0.0 0 0 0 1744.00 5178 0 0 23866.00 0.00 0 20.0
17 Sabarkantha 6409 0 0 0 0 3366 0 0 0 33518 0 19765 0
18 Surat 8133 0 0 7033 0 3839.29 0.0 143 0 66663.15 0.00 0 0
19 Surendranagar 0 0 0 0 0 0 0 0 0 35 0 0 0
20 Vadodara 0 0 0 330 0 880 5025 0 0 16798 0 0 0
21 Valsad 0 0 0 0 0 0 0 0 0 0 0 0 0
TOTAL : 85302.36 8394.80 1733.61 7033.14 1076.03 41738.72 6786.03 144.89 24041.49 273770.91 5501.24 65305.45 242.50
8.7 Conti…..
( M. T. )
Sr. District Ice-cream Ice-cream Sweet Shri Chocolate Amulya Paneer Flavered &XUG &XUG0DVWL Amul 7HD Nuetramul Amul
No. (000’ lit) (Delhi khand milk Masti Dahi (Delhi Lite Coffee Cool
( ‘ 000 Operation) Dahi Operation)
lits) ( ‘ 000 lits)
1 2 16 17 18 19 20 21 22 23 24 25 26 27 28 29
1 Ahmedabad 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
2 Amreli 0 0 0 0 0 0 0 0.00 306 0 0 0 0 0
3 Banaskantha 7466 0 0 0 0 30109 1997 4.00 0 0 0 0 0 0
4 Bharuch 0 0 0 0 0 0 0.00 0.00 0.00 0.00 0 0 0 0
5 Bhavnagar 0 0 0 0 0 0 1 0.00 5 0 0 0 0 0
6 Botad 0.00 0.00 0.00 0.00 0 0 0.00 0.00 0.00 0.00 0 0 0 0
7 Devbhoomi Dwarka 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
8 Gandhinagar 81 0 115 19 0 0 32 0.00 173 0 0 0 0 0
9 Junagadh 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
99
10 Kachchh 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
11 Kheda 0 0 0 0 2590 628 3704 4755460.00 1428 0 806 0 0 0
12 Mahesana 0 6503 0 0 0 296 0 0.00 167 7562 0 0 0 0
13 Morbi 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
14 Panchmahals 0 0 0 1005 0 145 0 13007.00 7873 0 0 0 0 0
15 Porbanadar 0.0 0.0 0.0 0 0 0 0 0.00 0 0 0 0 0 0
16 Rajkot 0.0 0.0 0.0 0 0 0 0 0.00 0 0 0 0 0 0
17 Sabarkantha 0 0 0 2181 0 584 4089 201.00 16277 0 0 0 0 0
18 Surat 8711.4 0.0 226.3 336.153 0 0 861.346 31.61 5501.666 0 0 0 0 0
19 Surendranagar 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
Vadodara 0 0 0 0 0 0 0 4772.88 99.138 0 0 0 0 0
20 Valsad 0 0 0 0 0 0 0 0.00 0 0 0 0 0 0
TOTAL 16258.71 6503.15 341.68 3541.52 2590.00 31761.47 10683.94 4768703.61 31731 7562 806.01 0.00 0.00 0.00
8.7 Conti…..
( M. T. )
Sr. District Table Delicious White Malted Other Amul Jira Amul Butter SCM Amul Amul Moti (Delhi UHT
No. Butter Table Butter Powder Masti Chhash Milk & Prolife Moti Operation) (Tazza)
Margarine B.M. AMUL AMUL MOTI(DELHI
MOTI OPERATION)
1 2 30 31 32 33 34 35 36 37 38 39 40 41
1 Ahmedabad 0 0 0 0 0 0 0 0 0.00 0 0 0
2 Amreli 0 0 0 0 0 0 0 7807 0.00 0 0 0
3 Banaskantha 12074 0 9523 0 0 0 0 0 4.00 0 0 0
4 Bharuch 0 0 0.00 0 0 0 0 0 0.00 0.00 0.00 0
5 Bhavnagar 0 0 0 0 0 0 0 0 0.00 0 0 0
6 Botad 0 0 0.00 0 0 0 0 0 0.00 0.00 0.00 0
Devbhoomi
7 0 0 0 0 0 0 0 0 0.00 0 0 0
Dwarka
8 Gandhinagar 0 0 817 0 0.00 0 0 0 0.00 0 0 0
9 Junagadh 0 0 0 0 0 0 0 0 0.00 0 0 0
10 Kachchh 0 0 0 0 0 0 0 0 0.00 0 0 0
100
11 Kheda 15353 9565 9586 772 0 0 0 0 4755460.00 0 0 0
12 Mahesana 11779 0 9712 0 0 0 0 0 0.0 4942 19430 0
13 Morbi 0 0 0 0 0 0 0 0 0.00 0 0 0
14 Panchmahals 1876 0 0 0 0 0 0 0 13007* 0 0 1889*
15 Porbanadar 0 0 0 0 0 0 0 0 0.00 0 0 0
16 Rajkot 0 0 2111 0 0 0 0 0 0.00 0 0 0
17 Sabarkantha 10365 0 3430 0 24812 0 0 0 201.00 0 0 0
18 Surat 2.304 0 0 0 8779 0 1432 0 31.61 0 0 0
19 Surendranagar 0 0 0 0 0 0 0 0 0.00 0 0 0
20 Vadodara 82.343 0 1504.355 0 0 0 2672 0 4772.88 0 0 0
21 Valsad 0 0 0 0 0 0 0 0 0 0 0 0
TOTAL 51448.68 9564.96 35178.57 772.47 33591.09 0.00 1432.15 7806.57 4755696.61 4942 0.00
8.8 Information regarding Milk Producers’ Co-operative Unions of the State 2017-18.
Sr. Item No Dairy Plants under Co-operative Milk Producers’ Union
No.
Ahmeda- Amareli Banas- Bharuch Bhav- Botad Devbhoomi Gandhi- Juna- Kachchh Kheda Mahe- Morbi Panchmahals Porbandar Rajkot Sabar- Surat Surendra- Vado- Valsad Total
bad kantha nagar Dwarka nagar gadh sana kantha nagar dara
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24
Milk Co-op.Soc.
(i) Registered 436 76 1392 481 433 96 115 118 290 302 1190 1128 116 1738 253 552 1790 1041 749 1226 1040 14562
1 (ii)Proposed 233 873 79 203 219 135 110 41 184 431 43 111 54 417 523 205 131 132 53 228 65 4470
(iii)Total 669 949 1471 684 652 231 225 159 374 733 1233 1239 170 2155 776 757 1921 1173 802 1454 1105 18932
(iv) Functioning 655 592 1437 684 652 231 225 159 374 684 1193 1295 0 1580 776 721 1704 1041 788 1229 1137 17157
Members of Milk Co-op.
2 89735 35533 349196 62000 54798 13364 18248 45950 39077 47942 699000 611588 17540 289000 41036 60000 369270 240382 89223 226353 121652 3294534
Soc. (000)
3 No of Female Co- Society 148 26 112 175 536 0 145 73 234 141 36 190 146 455 163 384 163 189 184 130 928 4558
4 No of Fem Mem of Co-Soc 29747 15462 104172 38000 46020 5790 8673 12150 18026 12461 118000 330257 12540 81000 15509 34000 113868 68412 28004 63535 75404 1231030
Milk collected from :
101
(i) Soc. (lakh Kg.) 1092 626 15879 589 956 346 439 738 551 1312 7899 6799 288 4839 1344 1497 8645 4216 2061 2372 3090 65577
5
(ii) Other. (lakh Kg.) 0 0 2112 31 0 0 0 0 0 0 250 0 0 46 0 0 0 0 0 0 0 2439
Total Milk collected (lakh
1092 626 17991 620 956 346 439 738 551 1312 8149 6799 288 4885 1344 1497 8645 4216 2061 2372 3090 68016
Kg.)
Milk Procure (LKPD) : 2.99 1.71 49.29 1.70 2.62 0.95 1.20 2.02 2 4 22.33 18.63 0.79 13.38 3.68 4 24 12 6 6 8 186
6 (i) Collected from Soc. 2.99 1.71 43.51 1.61 2.62 0.95 1.20 2.02 2 4 21.64 18.63 0.79 13.26 3.68 4 24 12 6 6 8 180
(ii) Collected from Others 0.00 0.00 5.79 0.09 0.00 0.00 0.00 0.00 0 0 0.68 0.00 0.00 0.13 0.00 0 0 0 0 0 0 7
7 Installede Capacity (LLPD) 2.5 2 76 2 5 0 0 3 2 2 27 26 1 13.5 0.0 6 25 20 9 8 4 234
Milk Processing Cap.
8 2.50 2 76 2 5 0 0 2 2.0 2.0 27 26 0 11.0 0.0 6.0 25.0 20.0 2.0 8.0 4.0 223
(LLPD)
Procurement price Cow 291 280 300 295 290 310 295 316 290 630 315 292 617 630 296 618 299 608 671 319 660 8621
9
5VOLW)DW Buffalo 620.55 700 660 650 595 640 600 675 535 290 670 625 617 295 560 618 650 648 539 700 660 12548
10 Sale of Rajka Seed (kgs) 0 0 0 - 0 0 0 0 0 0 8160 0 240 6814 0 0 22952 1873 - 2783 0 42822
11 Sale of other Seeds (kgs) 0 0 0 - 0 0 0 0 0 0 34921 0 0 227225 0 96 0 1473000 - 58500 0 1793742
12 5RRWV6OLSVGLVWULEXWHG1RV 0 0 0 - 0 0 0 0 0 0 - 0 0 - 0 0 0 - - 1290 0 1290
Production of Cattle feed
13 13 2 543 0 7 0 0 0 0 0 476 235 0 57 0 0 360 174 0 21 0 1887
(M.T.)
14 Sale of Cattle feed(M.T.) 48 5 573286 0 21448 0 1 0 0 0 1293 768 135 56995 1 0 1145 477 2622 20682 0 678906
15 Supply of Chalff Cutter 0 36 419 0 0 0 82 0 0 0 0 150 0 4771 82 0 948 801 0 10 0 7299
8.9 Information regarding infrastructure facility in Dairy 2017-18.
Sr. No. Name of Milk Total No of ,62&HUWL¿HG No. of Societies with
Producers’ Co-op. Societies Societies
Union Ltd. Bulk Milk Automatic Milk
Cooler (BMC) Collection System
(AMCS)
1 2 3 4 5 6
1 Ahmedabad 669 0 46 425
9 Junagadh 374 0 8 0
21 Valsad 1105 0 0 0
102
8.10 No. of Chilling Centers and their installed Capacity : 2017-18.
Sr. Districts Milk Producers’ Co-operative Union Location of Chilling Installed Capacity
No. Centres /LW'D\
1 2 3 4 5
1 Ahmedabad Ahmedabad Dist. Co-op. Milk
Producers’ Union Ltd. 1.Dahegam 30
2.Viramgam 30
3.Dhandhuka 30
4.Kotasan BMC 20
TOTAL 110
2 Banaskantha Banaskantha Dist. Co-op. Milk
Producers’ Union Ltd. 1.Dhanera 100
2.Radhanpur 100
3.Khimana 200
4.Tharad 200
TOTAL 600
3 Bharuch Bharuch Dist. Co-op. Milk Producers’
Union Ltd 1.Bhachrwada 30
2.Jambusar 40
3.Dediyapada 20
4.Bharuch 20
TOTAL 110
4 Bhavnagar Bhavnagar Dist. Co-op. Milk
Producers’ Union Ltd. 1.Thadach 500
2.Shihor 300
TOTAL 800
5 Kheda Kheda Dist. Co-op. Milk Producers’
Union Ltd. 1.Balasinor 70
2.Kapadwanj 90
TOTAL 160
103
8.10 No. of Chilling Centers and their installed Capacity : 2017-18.
Sr. Districts Milk Producers’ Co-operative Union Location of Chilling Installed Capacity
No. Centres /LW'D\
1 2 3 4 5
6 Mahesana Mahesana Dist. Co-op. Milk
1.Harij 100
Producers’ Union Ltd
2.Patan 300
3.Kadi 300
4.Kheralu 300
5.Vihar 500
TOTAL 1500
7 Panchmahals Panchmahal Dist. Co-op. Milk
1.Chopada-Lunawada 200
Producers’ Union Ltd.
2.Limdi-Zalod 30
3.Narulot-Halol 50
4.Dhanpur-Dhanpur 10
5.Kharedi-Dahod 10
6.Pratappura-Rajasthan 30
8.Zalsag-Kadana 10
TOTAL 440
8 Rajkot Rajkot Dist. Co-op. Milk Producers’
1.Jam- Kandorana 75
Union Ltd.
2.Majevadi 75
3.Vichhiya 30
4. Lajjai 50
5.Wankaner 100
6.Kalavad 25
TOTAL 355
9 Sabarkantha Sabarkantha Dist. Co-op. Milk
1.Bayad 150
Producer’s Union Ltd.
2.Dhansura 150
3.Idar 150
4.Shamlaji 150
TOTAL 600
104
8.10 No. of Chilling Centers and their installed Capacity : 2017-18.
Sr. Districts Milk Producers’ Co-operative Union Location of Chilling Installed Capacity
No. Centres /LW'D\
1 2 3 4 5
10 Surendranagar Surendranagar Dist. Co-op. Milk 1. Halvad 70
Producers’ Union Ltd.
2. Chotila 80
3. Patdi 40
4. Wadhawan 80
TOTAL 270
11 Vadodara Baroda Dairy .Vadodara 1 Bodeli - Sankheda 450
TOTAL 450
12 Surat Sumul Dairy .Surat 1. Nizar 150
2.Bajipur 200
3.Uchchhal 80
4.Navi Pardi 180
TOTAL 610
13 Valsad Vasundhara Dairy. Valsad 1 Vaghai - Dang 50
2. Subir - Dang 30
3.Karanjwan-Maharashra 40
4.Dhule-Maharashra 100
TOTAL 220
14 Junagadh Sorath Dairy 1.Bagasara ghed 100
2.Balwa 200
3.Gir Gadhada 100
4.Harinagar Mota Monpari 200
5.Lalpur 150
6.Talala 300
7.Saradiya 150
8.Bamnasa 300
9.Patrapasar 200
10.Mekhadi 50
11.Nagichana 200
12.Arena 50
13.Zapodal 50
14.Upleta 150
*Lalpur Centre shifted to Jamnagar DCMPU,
Bhesan Centre is closed
TOTAL 2200
105
8.10 No. of Chilling Centers and their installed Capacity : 2017-18.
Sr. Districts Milk Producers’ Co-operative Union Location of Chilling Installed Capacity
No. Centres /LW'D\
1 2 3 4 5
15 Kachchh Kachchh Dist. Co-op. Milk 1.Rapar 40
Producers’ Union Ltd. 2.Chandrani 35
3.Bhirandiara 35
4.Bidada 50
5.Nakhatrana 40
6.Amarapar 12
7.Kothara 35
8.Vagoth 15
9.Dayapar 35
10.Patri 30
11.Samakhiyari 20
12.Bhuvad 20
13.Khavada 20
14.Koriyani 20
15.Palasva 12
16.Rajpar 45
17. Loriya 45
18. Lakhond 75
19. Layja 35
TOTAL 619
16 Amreli Amreli. Dist. Co-op. Milk Producers’
Union Ltd. Amreli 100
17 Porbandar Porbandar, Dist. Co-op. Milk 1. Porbandar 40
Producers’ Union Ltd. 2. Khambhodar 15
3.Sindhpur 15
4.Khageshree 10
5.Kutiyana 15
6.Simar 10
7.Bhatia 35
8.Khambhadiya 35
9.Varvada 15
10.Veraval 20
11.Dolasa 10
12.Siloj 20
13.Mahiyari 10
14.Talala 10
* Pata BMC & Prach Chiller plant has closed
TOTAL 260
18 Morbi Morbi 120
19 Botad Gadhada(Swami nara.) 140
20 Devbhoomi Krishna DCMPU 1. Varvada 30
Dwarka
2. Bhatiya 70
3. Khambhadiya 70
TOTAL 170
Total 105 9834
106
8.11 Strengthening Infrastructure For Quality And Clean Milk Production(Centrally Sponsored Scheme) (Rs in lakh).
Sr Name of District Milk Union Project Organization Central Fund released by the Central Govt ( Rs in lakh) Total
No. Outlay Share Share 2005- 2006- 2007- 2008- 2009- 2010- 2011- 2012- 2014- 2015- 2016- 2017- Fund
06 07 08 09 10 11 12 13 15 16 17 18 released
I II III IV V VI VII VIII IX X XI XII
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18
1 Surat Dist. Co-op Milk Producer’s
Union. SUMUL DAIRY 498.56 98.62 399.94 251.25 20.00 0.00 75.00 53.69 0.00 0.00 0.00 0.00 0.00 0.00 0.00 399.94
2 Ahmedabad Dist. Co-op Milk
Producer’s Unoin. UTTAM DAIRY 439.00 72.73 366.27 38.58 50.00 100.00 100.00 77.69 0.00 0.00 0.00 0.00 0.00 0.00 366.27
3 Mahesana Dist. Co-op Milk Prod
Union. DUDH SAGAR DAIRY 435.30 91.50 343.80 50.00 68.40 113.65 50.00 61.75 0.00 0.00 0.00 0.00 0.00 343.80
4 Vadodara Dist. Co-op Milk Producer
Unin. BARODA DAIRY 218.60 37.50 181.10 54.70 100.87 25.53 0.00 0.00 0.00 0.00 0.00 0.00 0.00 181.10
5 Panchmahal Dist. Co-op Milk Prod
Union. PANCHAMRUT DAIRY 449.10 92.50 356.60 50.00 106.42 60.00 100.00 0.00 40.18 0.00 0.00 0.00 0.00 356.60
107
6 Valsad Dist. Co-op Milk Producer
Union. VASUNDHARA DAIRY 343.75 77.50 266.25 36.00 40.00 0.00 93.00 0.00 97.25 0.00 0.00 0.00 266.25
7 Banaskantha Dist. Co-op Milk
Producer’s Union. BANAS DAIRY 406.58 87.50 319.08 50.00 85.17 60.00 60.00 63.91 0.00 0.00 0.00 0.00 0.00 319.08
8 Sabarkantha Dist. Co-op Milk
Producer’s Union. SABAR DAIRY 485.60 110.00 375.60 144.45 138.45 0.00 92.70 0.00 0.00 0.00 0.00 375.60
9 Rajkot Dist. Co-op Milk Producer’s
Union. RAJKOT DAIRY 286.04 69.25 216.79 50.00 44.88 0.00 100.00 21.91 0.00 0.00 0.00 216.79
10 Amreli Dist. Co-op Milk Producer’s
Union. AMAR DAIRY 261.30 49.39 211.91 50.00 0.00 114.37 47.54 0.00 0.00 0.00 0.00 211.91
11 Surendranagar Dist. Co-op Milk
Producer’s Union.SURSAGAR 433.75 90.88 342.87 90.00 221.15 0.00 0.00 0.00 0.00 0.00 311.15
DAIRY
Approved project & released by GOI 4257.58 877.37 3380.21 251.25 163.28 292.42 429.44 697.32 561.02 554.18 280.42 119.16 0.00 0.00 0.00 3348.49
Total released by GOG 251.25 163.28 292.42 429.44 697.32 561.02 546.61 280.42 119.16 0.00 0.00 0.00 3340.92
8.12 Infrastructure Facility Provided to Dairy Union under the STATE PLAN 2012-13 to 2016-17 (Rs in lakh).
Sr.No. Name of Project Name of Implementing Agency Assistance in the Year 2012-13 2013-14 Assistance in the Year 2014-15 Assistance in the Year 2015-16 Assistance in the Year 2016-17
Financial Physical Assistance Financial Physical Financial Physical Financial Physical
Project Assistance BMC AMCS - Project Assistance BMC AMCS Project Assistance BMC AMCS Project Assistance BMC AMCS
cost cost cost cost
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20
1 Assistance for Sarhad Dairy - Kachchh 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0
2 establishment of Madhur dairy -Gandhinagar 137.5 96.25 10 45 0 53 37.1 3 20 216.85 151.8 16 33 52.8 25.6 4 8
3 infrastructure to villageAmar Dairy-Amreli 50 35 0 50 0 149 104.3 0 149 9 6.3 0 8 0 0 0 0
Milk Co-op. Societies DudhSagar dairy – Mahesana 537.5 376.25 50 50 0 217.25 152.08 15 101 494.3 346 38 56 154 78 10 40
4
& Dist. Co- op. Milk
5 Rajkot Dairy 226.25 158.5 25 0 0 133.25 93.28 9 50 68 47.6 0 52 74.8 36.91 6 8
Producers’ Union Under
6 general category Banas Dairy- B.k. 0 0 0 0 0 287.75 201.43 15 149 216.28 151.4 17 22 71.5 63.5 5 15
7 Sabar dairy- S.K 0 0 0 0 0 480.75 336.53 39 150 0 0 0 0 1045 661.59 93 20
8 Amul dairy-Kheda 0 0 0 0 0 100 70 0 100 48 33.6 0 48 78.1 47.7 1 61
9 Saravottam dairy-Bhavnagar 0 0 0 0 0 150 105 0 150 178 124.6 0 178 5.5 3.5 0 5
12 Demand No-95 Under DudhSagar - Mahesan 1407.5 985.25 150 200 0 0 0 0 0 0 0 0 0 0 0.47 0 0
13 Scheduled cast category Uttam dairy -Ahmd 327.5 229.25 30 50 0 0 0 0 0 0 0 0 0 0 0.30 0 0
14 Sudama dairy- Porbandar 0 0 0 0 0 190 133 10 50 17.1 11.97 11 9 0 0 0 0
15 Sursagar dairy- Surendranagar 0 0 0 0 0 154 107.8 10 14 96.57 67.6 11 10 0 17.57 0 0
16 Banas Dairy- B.k. 0 0 0 0 0 177.5 124.25 10 100 358.57 251 27 32 27.5 26.37 2 5
17 Sorath dairy -Junagadh 0 0 0 0 0 100 70 0 100 10 7 0 1 0 0 0 0
108
18 Sarhad Dairy - Kutchh 424 296.8 16 200 0 378 264.6 14 18 39.85 27.9 2 18 11 11.40 1 0
19 Demand No-96 Under Sumul Dairy -Surat 2574 1801.8 234 350 0 0 0 0 0 178 124.6 7 113 158.4 32.26 7 74
20 Scheduled Tribe category Dhudhdhara -Bharuch 311.5 218.05 30 79 0 195 136.5 20 40 62.71 43.9 6 8 93.5 46.05 7 15
21 Panchamrut Dairy - Panchmahal 0 0 0 0 0 367.5 257.25 32 100 287.14 201 23 95 1.1 90.89 0 1
22 Banas Dairy- B.k. 385 269.5 20 200 0 0 0 0 0 0 0 0 0 11 8.25 1 0
23 Baroda Dairy –Vadodara 643.5 450.45 70 101 0 240 168 20 70 7.5 5.25 0 5 12.1 0 0 11
24 Sabar dairy- S.K 586.75 410.73 53 116 0 0 0 0 0 347.71 240.6 38 18 22 16.27 2 0
25 Vasundhara -Valasad 0 0 0 0 0 196.25 137.38 9 100 40.78 28.55 4 2 0 23.87 0 0
26 Assistance for Dhudhdhara -Bharuch 0 0 0 0 0 0 0 0 0 1000 500 0 0 1000 0 0 0
27 establishment of cattle Sarhad Dairy - Kutchh 0 0 0 0 0 0 0 0 0 1000 500 0 0 1000 0 0 0
feed factory in dairy back Sumul Dairy -Surat 0 0 0 0 0 4509 1000 300MT 0 0 0 0 0 0 0 0
28
ward area for improvement
in milk productivity of Vasudhara dairy-Val 2100 1000 150 expandable 0 0 0 0 0 0 0 0 0 0 0 0 0
29 up to 300MT/D
milch animals
Grand Total 9711 6328 688 1441 0 8078.25 3498.5 206 1461 4676.36 2870.67 200 708 3818.3 1190.5 139 263
8.13 Infrastructure Facility Provided to Dairy Union under the STATE PLAN : 2017-18
Project Name : Assistance for establishment of infrastructure to village Milk Co-op. Societies &
Dist. Co- op. Milk Producers’Union Under general category . (Rs in lakh)
Sr District Name DCMPU Name Bulk Milk Cooler Automatic Milk Milk Adulteration
No. Collection System Detection Machine
Physical Financial Physical Financial Physical Financial
Achievement Achievement Achievement Achievement Achievement Achievement
1 2 3 4 5 6 7 8 9
1 Ahmedabad Uttam Dairy 0 0 0 0 0 0
Amar Dairy
2 Amreli 0 0 0 0 0 0
Rajkot Dairy
3 Arvalli Sabar Dairy 5 4787100 10 800000 0 0
4 Anand Amul Dairy 0 0 0 0 11 904200
5 Kutch Sarhad Dairy 3 3141174 13 1337492 4 400000
6 Kheda Amul Dairy 0 0 4 320000 1 200000
DudhSagar Dairy
7 Gandhinagar Uttam Dairy 3 4007060 9 720000 0 0
Madhur Dairy
8 Gir-Somnath Sorath Dairy 0 0 2 160000 0 0
9 Chhota Udepur Baroda Dairy 0 0 2 160000 0 0
10 Junagadh Shree 2 1480000 2 160000 1 100000
11 Jamnagar Rajkot Dairy 0 0 11 880000 0 0
12 Dang Vasudhara Dairy 0 0 0 0 0 0
13 Tapi Sumul Dairy 0 0 17 1360000 0 0
Devbhumi
14 Krishna Dairy 0 0 0 0 0 0
Dwarka
15 Dahod Panchamrut Dairy 0 620000 12 1040000 3 400000
Dudhdhara Dairy
16 Narmada 0 0 8 640000 0 0
Baroda Dairy
17 Navsari Vasudhara Dairy 0 0 0 0 0 0
18 Panchmahal Panchamrut Dairy 4 2813500 22 1920000 5 600000
Dudhsagar Dairy
19 Patan 1 740000 18 1440000 0 0
Banas Dairy
20 Porbandar Sudama Dairy 0 0 0 240000 0 0
21 Banaskantha Banas Dairy 30 28352200 13 1040000 0 400000
22 Botad Botad Dairy 0 0 0 0 0 0
23 Bharuch Dudhdhara Dairy 0 0 5 400000 5 410700
24 Bhavnagar Sarvottam Dairy 0 620000 43 3440000 1 82200
25 Mehsana Dudh sagar Dairy 18 14845671 27 2160000 0 0
Amul Dairy
26 Mahisagar 5 4727100 20 1920000 0 0
Panchamrut Dairy
Sursagar Diary
27 Morbi 4 620000 19 1600000 0 1600000
Rajkot Dairy
Sursagar Diary
28 Rajkot 0 0 29 2320000 0 500000
Rajkot Dairy
29 Vadodara Baroda Dairy 0 0 46 3680000 0 0
30 Valsad Vasudhara Dairy 0 0 0 0 0 0
31 Surat Sumul Dairy 0 0 0 0 0 100000
32 Surendrangar Sursagar Dairy 0 0 1 80000 0 1800000
33 Sabarkantha Sabar Dairy 35 39963561 24 2000000 0 0
Total 110 106717366 357 29817492 31 7497100
109
8.14 Infrastructure Facility Provided to Dairy Union under the STATE PLAN : 2017-18
Project Name : Assistance for establishment of infrastructure to village Milk Co-op. Societies &
Dist. Co- op. Milk Producers’Union Under Scheduled cast category
Sr No. District Name DCMPU Name Bulk Milk Cooler Automatic Milk Milk Adulteration
Collection System Detection Machine
Physical Financial Physical Financial Physical Financial
Achievement Achievement Achievement Achievement Achievement Achievement
1 2 3 4 5 6 7 8 9
1 Ahmedabad Uttam Dairy 0 0 0 0 0 0
Amar Dairy
2 Amreli 0 0 0 0 0 0
Rajkot Dairy
3 Arvalli Sabar Dairy 3 2834116 0 0 0 0
4 Anand Amul Dairy 0 0 0 0 0 0
5 Kutch Sarhad Dairy 0 0 0 0 0 0
6 Kheda Amul Dairy 0 0 0 0 0 0
DudhSagar Dairy
7 Gandhinagar Uttam Dairy 0 0 0 0 0 0
Madhur Dairy
8 Gir-Somnath Sorath Dairy 0 0 0 0 0 0
9 Chhota-Udepur Baroda Dairy 0 0 0 0 0 0
10 Junagadh Shree 0 0 0 0 0 0
11 Jamnagar Rajkot Dairy 0 0 0 0 0 0
12 Dang Vasudhara Dairy 0 0 0 0 0 0
13 Tapi Sumul Dairy 0 0 0 0 0 0
Devbhumi
14 Krishna Dairy 0 0 0 0 0 0
Dwarka
15 Dahod Panchamrut Dairy 0 0 0 0 0 0
Dudhdhara Dairy
16 Narmada 0 0 0 0 0 0
Baroda Dairy
17 Navsari Vasudhara Dairy 0 0 0 0 0 0
18 Panchmahal Panchamrut Dairy 3 2235400 3 240000 1 200000
Dudhsagar Dairy
19 Patan 0 0 0 0 0 0
Banas Dairy
20 Porbandar Sudama Dairy 0 0 0 0 0 0
21 Banaskantha Banas Dairy 0 0 3 240000 0 0
22 Botad Botad Dairy 0 0 0 0 0 0
23 Bharuch Dudhdhara Dairy 0 0 0 0 0 0
24 Bhavnagar Sarvottam Dairy 0 0 0 0 0 0
25 Mehsana Dudh sagar Dairy 9 8185673 3 240000 0 0
Amul Dairy
26 Mahisagar 0 0 3 240000 0 100000
Panchamrut Dairy
Sursagar Diary
27 Morbi 0 0 0 0 0 0
Rajkot Dairy
Sursagar Diary
28 Rajkot 0 0 0 0 0 0
Rajkot Dairy
29 Vadodara Baroda Dairy 0 0 0 0 0 0
30 Valsad Vasudhara Dairy 0 0 0 0 0 0
31 Surat Sumul Dairy 0 0 0 0 0 0
32 Surendrangar Sursagar Dairy 0 0 0 0 0 0
33 Sabarkantha Sabar Dairy 13 13796500 11 880000 0 100000
Total : 28 27051689 23 1840000 1 400000
110
8.15 INFRASTRUCTURE FACILITY PROVIDED TO DAIRY UNION UNDER THE STATE PLAN 2017-18
Project Name : Assistance for establishment of infrastructure to village Milk Co-op.
Societies & Dist. Co- op. Milk Producers’ Union 96 Under Scheduled Tribe category
Sr No. District DCMPU Name Bulk Milk Cooler Automatic Milk Milk Adulteration
Name Collection System Detection Machine
Physical Financial Physical Financial Physical Financial
Achievement Achievement Achievement Achievement Achievement Achievement
1 2 3 4 5 6 7 8 9
1 Ahmedabad Uttam Dairy 0 0 0 0 0 0
Amar Dairy
2 Amreli 0 0 0 0 0 0
Rajkot Dairy
3 Arvalli Sabar Dairy 5 4007058 3 240000 0 200000
4 Anand Amul Dairy 0 0 0 0 0 0
5 Kutch Sarhad Dairy 0 0 0 0 0 0
6 Kheda Amul Dairy 0 0 0 0 0 0
DudhSagar Dairy
7 Gandhinagar Uttam Dairy 0 0 0 0 0 0
Madhur Dairy
8 Gir-Somnath Sorath Dairy 0 0 0 0 0 0
Chhota-
9 Baroda Dairy 0 0 0 80000 0 0
Udepur
10 Junagadh Shree Dairy 0 0 0 0 0 0
11 Jamnagar Rajkot Dairy 0 0 0 0 0 0
12 Dang Vasudhara Dairy 0 0 0 0 0 0
13 Tapi Sumul Dairy 0 0 0 0 0 0
Devbhumi
14 Krishna Dairy 0 0 0 0 0 0
Dwarka
15 Dahod Panchamrut Dairy 0 0 11 800000 0 0
Dudhdhara Dairy
16 Narmada 0 0 0 0 3 370000
Baroda Dairy
17 Navsari Vasudhara Dairy 0 0 0 0 0 0
18 Panchmahal Panchamrut Dairy 2 1500000 5 640000 0 100000
Dudhsagar Dairy
19 Patan 0 0 0 0 0 0
Banas Dairy
20 Porbandar Sudama Dairy 0 0 0 0 0 0
21 Banaskantha Banas Dairy 4 4401400 2 160000 0 0
22 Botad Botad Dairy 0 0 0 0 0 0
23 Bharuch Dudhdhara Dairy 0 0 1 80000 1 123200
24 Bhavnagar Sarvottam Dairy 0 0 0 0 0 0
25 Mehsana Dudh sagar Dairy 0 0 0 0 0 0
Amul Dairy
26 Mahisagar 0 500000 14 1120000 0 200000
Panchamrut Dairy
Sursagar Diary
27 Morbi 0 0 0 0 0 0
Rajkot Dairy
Sursagar Diary
28 Rajkot 0 0 0 0 0 0
Rajkot Dairy
29 Vadodara Baroda Dairy 0 0 0 0 0 0
30 Valsad Vasudhara Dairy 0 0 0 0 0 0
31 Surat Sumul Dairy 1 1047058 5 400000 1 123185
32 Surendrangar Sursagar Dairy 0 0 0 0 0 0
33 Sabarkantha Sabar Dairy 3 2220000 6 480000 0 200000
Total : 15 13675516 47 4000000 5 1316385
111
8.16 Assistance Provide under the Scheme of National Mission of Protein Suppliment (NMPS) 2012-13.
(Rs. in Lakh)
Sr. No. Name of Dairy Union Project Project Provision Fund Expenditure Physical Achievement
Outlay under released as on
RKVY 31.03.2013
(38%)
1 2 3 4 5 6 7 8
Bharuch District Co-operative Project for Purchase/Installation of Milk fat tester-300 Milking
1 176.00 66.88 66.88 66.88
Milk Producer’s Union Milking machine/Milkotester machine machine -205
Surat District Co-operative Milk UHT Sterilized Equipment and Aseptic 21000 lit milk processing unit
2 962.37 365.70 365.70 365.7
Producer’s Union Packing Machinery & 80 UPS establish
112
Parlor. milk procured
Kheda District Co-operative Heifer Calf rearing of 25 calf for 100 206.60 EHQH¿FLDULHVFRYHUHGIRU
4 876.00 206.60 206.6
Milk Producer’s Union units (23.5%) heifer rearing
1 2 3 4 5 6 7
1 Bharuch District Co-operative Milk Producer’s Union Installation of Milk Processing Plant with capacity of 2.00 LLPD at Bharuch District 3404.00 749.03 749.03 749.03
Co-operative Milk Producer’s Union. machine/Milkotester machine
2 Surat District Co-operative Milk Producer’s Union Dairy Modernization with installation of cream separator and Homonizer 610.00 231.80 231.80 231.80
3 Panchmahal District Co-operative Milk Producer’s Expansion of existing 100 MT/day cattle feed manufacturing plant up to 1000MT/day 3764.41 563.17 563.17 563.17
Union under RKVY in Panchmahal District.
Total 7778.41 1544.00 1544.00 1544.00
8.18 ASSISTANCE PROVIDED UNDER RKVY FOR ESTABLISHMENT OF MILK PROCESSING PLANT-2011-12 , 2012-13,2014-15, 2015-16 , 2016-17 & 2017-18.
Total Approved Assistance under RKVY
Project
Sr. No Implementing Agency Name of Projects RKVY Agency
Cost (Rs. Fund Released
Contribution Contribution
In Lakh)
113
1 2 3 4 5 6 7
1 Surendranagar District Co-operative Milk Producers To setup Milk Processing Plant of 1.0 Lakhs Liters Per Day Capacity. (Expandable upto
Union Ltd. 2.0 Lakhs Liters per day) 1250.00 837.50 412.50 837.50
2 Kachchh District Co-operative Milk Producers Union To setup Milk Processing Plant of 1.0 Lakhs Liters Per Day Capacity. (Expandable upto
Ltd. 2.0 Lakhs Liters per day) 1250.00 837.50 412.50 837.50
3 Amreli District Co-operative Milk Producers Union Expansion of Milk processing plant up to 2.00 LLPD Capacity at Amar Dairy, Amreli.
Ltd. 1250.00 837.50 412.50 837.50
4 Junagadh District Co-operative Milk Producers Union RKVY Project Proposal for installation of Milk Processing Plant with capacity of
Ltd. 1LLPD Expandable up to 2.00 LLPD at Shree Sorath JDCMPL. Junagadh. 1250.00 837.50 412.50 837.50
114
Milk Producers Union AMCS at village co. societies Surat 51.80
Ltd. Of the State through D.C.M.P.U.Ltd
Bharuch 2.21
Mahesana 400.40
Total : A 865.31
Bharuch 95.79
454.67 During
Valsad 140.00
the year 2015-
Rajkot 70.70
16
Ahmedabad 81.20
Total : B 387.69
Grand Total : A+B 1253.00
TOTAL : 3000 1816.24 -- 1732.38 1665.40
8.20 ASSISTANCE PROVIDED UNDER RKVY FOR ESTABLISHMENT OF AMCS & MILKING MACHINE - 2011-12, 2012-13 ,
2014-15, 2015-16 , 2016-17 & 2017-18.
(Rs. In lakh).
Sr.No Implementing Agency Name of Project Project RKVY Subsidy Fund %HQHÀFLDU\'DLU\8QLRQ %HQHÀFLDU\'LVWULFW Fund
Outlay Contribution rate Released released
40 % Gen
60 % SC
60 % ST
1 2 3 4 5 6 7 8 9 10
1 The project will Assistance to 1589.00 1191.75 75% In 2015- 1.Ahmedabad Ahmedabad 4.46
be implemented install 2750 units 16 : 2.Amreli Amreli 5.06
E\'LVWULFW&R of Milking machine 1012.73 %DQDVNDQWKD %DQDVNDQWKD 451.19
operative Milk at milk producer In 2016-17 %KDUXFK %KDUXFK1DUPDGD 6.41
Producer’s Union %KDYQDJDU 7.09
level through village : 390.75 %KDYQDJDU
Ltd. %RWDG 1.94
dairy co.-operative In 2017-18 %RWDG
7.Devbhumi Dwarka Devbhumi Dwarka 9.62
societies. : 185.50
8.Gandhinagar Gandhinagar 12.83
115
9.Junagadh Junagadh , Gir Somnath 12.47
10.Kachchh Kachchh 8.10
11.Kheda Kheda , Anand 214.71
12.Mahesana Mahesana , Patan 30.54
Panchmahal, Dahod,
13.Panchmahals 168.24
Mahi-Sagar
14.Porbandar Porbandar 5.15
15.Rajkot Rajkot , Jamnagar 10.55
16.Sabarkantha Sabarkantha, Aravalli 573.65
17.Surat Surat , Tapi 26.24
18.Surendranagar Surendranagar , Morbi 7.17
9DGRGDUD&KKRWD
19.Vadodara 18.56
Udeppur
20.Valsad 9DOVDG'DQJ1DYVDUL 15.01
TOTAL : 1588.98
8.21 Assistance Provided Under RKVY For Establishment of Bulk Milk Cooler Plant - At Dairying
Sector 2010-11 & 2011-12 & 2014-15.
Sr. No. Name of Project Name of Installation Total RKVY Total fund
Implementing for BMC project Contribution assisted
Agency Cost ( Rs in lakh)
1 2 3 4 5 6 7
Installation of Bulk Milk Sarhad Dairy -
1 30 300 180 180
Cooler Kachchh District
Distribution of improved
Amul Dairy- Kheda
8 variety of fodder seeds in -- 19 7.76 7.76
District
Kheda
116
8.22 Information regarding Milk Producers’ Co-operative Unions of the State 2017-18.
Sr. Item No Veterinary activity done by Co-operative Milk Producers’ Union
No.
Ahmedabad Amreli Banaskantha Bharuch Bhav-nagar Devbhoomi Gandhinagar Kheda Mahesana Panchmahal Rajkot
Dwarka
1 2 3 4 5 6 7 8 9 10 11 12 13
1 1RRI9HW2I¿FHUV 14 2 169 6 15 0 18 198 125 52 10
2 No of A.I. Centers 0 50 1119 178 147 0 8 1100 786 688 148
$UWL¿FLDO,QVHPLQDWLRQGRQH1RV
(i) Cow 34825 5584 764605 23642 27220 0 11423 349408 534602 189535 41336
3
(ii)Buffaloes 59022 5794 490251 27279 33264 0 13722 553634 439421 334253 37542
(iii) Total 93847 11378 1254856 50921 60484 0 25145 903042 974023 523788 78878
Pregnancy diagnosed (Nos)
(i) Cow 25264 2908 612449 9252 8558 0 10223 136899 165598 140819 37620
4
(ii)Buffaloes 39109 3418 393564 12578 11015 0 13545 246937 156107 264617 34762
117
(iii) Total 64373 6326 1006013 21830 19573 0 23768 383836 321705 405436 72382
No. of Progeny born by AI
(i) Cow 9653 2017 299482 5795 3962 0 4177 58194 84454 58162 16934
5
(ii)Buffaloes 12602 2160 195013 7875 4843 0 6018 92825 79807 106503 14262
(iii) Total 22255 4177 494495 13670 8805 0 10195 151019 164261 164665 31196
Treatment Cases (Nos.)
6 0 0 0 10935 0 0 29583 786753 308635 228738 0
(excludung in camp)
Vaccination perfomed
(i) H.S. 80000 0 1020557 0 0 0 0 1292603 473673 852945 0
(ii) F.M.D 80980 43112 1102552 73268 387287 0 0 2611018 493841 1047298 590800
5 (iii) Theileriasis 0 0 323238 0 0 0 0 20230 1835 86 0
(iv) A.R.V 899 0 11400 0 0 0 0 0 4932 8638 0
(v) Other vaccination 0 0 39520 0 0 0 0 69540 0 9862 0
TOTAL 161879 43112 2497267 73268 387287 0 0 3993391 974281 1918829 590800
8.22Conti.....
Sr. Item No Veterinary activity done by Co-operative Milk Producers’ Union
No. Sabarkantha Surat Surendra- Vadodara Valsad Junagadh Kachchh Porbandar Morbi Botad Total
nagar
1 2 14 15 16 17 18 19 20 21 22 23 24
1 1RRI9HW2I¿FHUV 137 67 17 61 0 1 5 4 0 3 904
2 No of A.I. Centers 382 417 83 347 0 28 14 40 0 8 5543
$UWL¿FLDO,QVHPLQDWLRQGRQH1RV
(i) Cow 380297 204229 6014 99069 282304 8754 9841 3485 0 3814 2979987
3
(ii)Buffaloes 219670 104389 6314 182959 50695 5836 1470 8390 0 1130 2575035
(iii) Total 599967 308618 12328 282028 332999 14590 11311 11875 0 4944 5555022
Pregnancy diagnosed (Nos)
(i) Cow 282924 173825 2840 34829 226187 4814 3865 2120 0 2650 1883644
4
(ii)Buffaloes 181879 89312 3005 61065 44856 3209 630 6835 0 1030 1567473
(iii) Total 464803 263137 5845 95894 271043 8023 4495 8955 0 3680 3451117
No. of Progeny born by AI
118
(i) Cow 121830 93326 1287 38619 23698 3502 3865 386 0 2630 831973
5
(ii)Buffaloes 81793 50721 1296 72172 134867 2334 630 2290 0 1020 869031
(iii) Total 203623 144047 2583 110791 158565 5836 4495 2676 0 3650 1701004
Treatment Cases (Nos.)
6 0 423373 18273 0 0 0 4685 4277 0 1815252
(excluding in camp)
Vaccination perfomed
(i) H.S. 0 251342 27298 89510 196305 0 6412 0 0 0 4290645
(ii) F.M.D 681212 792824 114545 173850 532730 0 39834 49808 0 375 8815334
5 (iii) Theileriasis 52437 27925 0 328 5785 0 0 0 0 0 431864
(iv) A.R.V 0 6760 0 8910 0 0 64 0 0 0 41603
(v) Other vaccination 18403 17352 0 0 0 0 0 0 0 0 154677
TOTAL 752052 1096203 141843 272598 734820 0 46310 49808 0 375 13734123
119
120
D - 7 : Fodder Development
Irrespective of the best genetically potential and better management, if
nutritional (feeding) aspect of livestock is overlooked; the optimum level of production
is not achieved. Moreover, when feed and fodder account for more than 70% cost of
milk production and as green fodder has very important and inevitable role in Milk
production, it necessitates today more emphasis on fodder development programs.
Now a day, due to increasing human population burden and fast industrialization,
land under fodder cultivation is decreasing which compels to grow more fodder per
unit of land which can be done only by adopting latest high producing improved
variety of fodder seeds by livestock owners. So in order to increase fodder production,
encouraging farmers for growing improved varieties of high yielding fodder crops,
making them well conversant regarding fodder conservation and its better utilization,
Improving pastureland. State Animal Husbandry Department is running different
fodder development schemes.
Schemes
1 Supply of Minikits :
With the aim to wide spread publicity and adoption of varieties of fodder crops
fodder minikits for demonstrations are distributed to livestock owners through District
Panchayat, Intensive Cattle Development Programmes of the states.
2 Supply of Power Driven Chaff Cutter :
For purchasing of Power Driven Chaff Cutter for the better utilization of fodder
subsidy is given to `15000/- for each Power Driven Chaff Cutter.
3 Fodder Farms :
Round the year availability of green fodder at a reasonable price to the livestock
owners. Department runs six village fodder production farms, which also helps as a
demonstration unit to the areas.
4 Establishment of fodder seed production farms :
Fodder crops are always shy seeders. Generally all farmers growing green fodder
do not go for fodder seed production. Which creates short fall between the requirement
and availability and of fodder seed in general. To some extent it caters the need of
fodder seed requirement. Department has established the fodder seed production farms
in different region of the state. These farms also serve as demonstration purpose to
nearby farmers about the fodder seed production practices. State Animal Husbandry
Department is running two fodder seed production farms. They are at (i) Mota Jampura,
Dist.-Banaskantha (ii) Bhutwad, Dist-Rajkot.
121
5 Cattle Shed for Cattle :
(`IRU$QLPDOV` IRU$QLPDOV`$QLPDOV
Generally it is seen that, poor people has no facility to tie and protect their milch
animals due to lack of cattle shed. They are also in need of house for their own family
but due to lack of money this facility is not available with them. Those poor people
are keeping their milch animal under tree or in the shadow of house or in open space.
By keeping milch animals in open space protection from cold and hot weather rain is
not available. It badly affects on milk production, health and resistance power of the
milch animal. Poor people do not get expected production from milch animals due to
lack of cattle shed and poor health condition of the milch animals. Milch animals gets
affected with so many diseases due to lack of resistance power without cattle shed
and manger cattle feed also gets spoiled and fodder wastages goes up to 20% and
PRUHVRPLONSURGXFWLRQFRVWJRHVRQKLJKHUVLGH7RRYHUFRPHDERYHGLI¿FXOWLHVWR
dairy husbandry in scheduled cast and other general category family implementation of
assistance scheme for cattle shed, feeding trough, water tank and 7 litre steel bucket is
started. 50% assistance of expenditure or ` 18,000/- for 2 Animals, 50% assistance of
expenditure or ` 63,000/- for 5 Animals, 50% assistance of expenditure or ` 1,25,000/-
for 10 Animals maximum given these people.
6 Centrally Sponsored Fodder Development Schemes :
The main objective of the scheme is to take steps for improvement for enhancement
of production of protein rich feed and fodder for livestock and to improved Quality
of feed and fodder for livestock in the country.
-------------
122
9.1 Fodder development Acitivities under various Development Scheme 2017-18.
Sr. Details Intenstive Cattle District Panchayats Inte- Tribal Krishi Regular RKVY Total
No. Development Programme grated Mahotsav minikits Chaff
cutter
1 2 3 4 5 6 7 8 9 10 11 12
Fodder Demonstrations Plots/Minikits
1 50000 0 0 0 5000 4000 0 215 0 59215
(10 Gunthas)
123
Subsidy)
Cattle Shed
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
1 2001-02 7510 8720 --- --- 1025 687 --- --- 34000 21140 3 3 --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
2 2002-03 5937 8225 --- --- 975 762 --- --- 32000 32157 10 8 --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
4 2003-04 6500 6860 --- --- 975 457 --- --- 32000 32125 3 3 --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
5 2004-05 7000 7350 --- --- 975 415 --- --- 12000 12650 1 1 --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
6 2005-06 7000 7000 --- --- 725 553 --- --- 12000 12140 4 2 --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
666
7 2006-07 10000 10700 --- --- 775 517 608 --- 13785 Scheme Closed --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
12000
685
8 2007-08 7000 8185 --- --- 775 754 692 --- 12725 Scheme Closed --- --- --- --- --- --- --- --- --- --- --- --- --- --- ---
12000
680
9 2008-09 7000 7000 --- --- 775 587 691 --- 14412 Scheme Closed 610 215 --- --- --- --- --- --- --- --- --- --- --- --- ---
124
12000
10 2009-10 2609 2565 --- --- 7000 7370 775 632 690 648 12000 15705 877 877 152 149 34080 30912 64992 --- --- --- --- --- --- --- ---
(a)1024 1023
11 2010-11 --- --- 13000 13250 775 300 740 737 12000 13655 --- --- 152 151 13214 23905 37119 --- --- --- --- --- --- --- ---
(b)1163 1163
(a)1024 1019
12 2011-12 --- --- 13000 13370 775 366.5 740 735 12000 10410 ---- ---- 152 151 15918 28269 44187 --- --- 15000 15000 --- --- 91220 91220
(b)1163 1162
13 2012-13 (b)3433 3431 --- --- 7000 7000 725 578.8 740 731 12000 7745 --- ---- 152 152 0 0 0 --- --- 7500 7500 --- --- 91220 91340
14 2013-14 3146 3089 --- --- 7000 6905 725 417 740 714 12000 14215 --- ---- 152 152 0 0 0 --- --- 7500 7500 --- --- 91340 91310
15 2014-15 3146 3146 7000 7000 650 774 630 630 12000 12025 --- ---- 152 152 0 0 0 --- --- 7500 7500 --- --- 182620 183100
16 2015-16 730 501 4000 4000 675 552.92 400 374 12000 11310 --- ---- --- --- --- --- --- --- --- 9050 9050 --- --- --- ---
3333 3332
17 2016-17 1215 911 9000 9000 650 580.48 454 422 12000 7269 --- ---- 220 147 --- --- --- --- --- 9050 9050 --- --- --- ---
18 2017-18 1118 2519 9000 9000 650 611.30 400 365 12000 7510 --- ---- 176 176 --- --- --- 215 215 --- --- 50000 33332 990 990
(a) Round Wheel Chaff Cutter (b) Hand Operated Chaff Cutter
9.3 3URGXFWLRQDQG'LVWULEXWLRQRI)RGGHURQ9LOODJH)RGGHU6HHG3URGXFWLRQ)DUPV
Sr. District Name and Location of Area of Main Fodder Crops Area Sown (Hect.) Green Quantity of Fodder (Kg.) 4XDQWLW\RI5RRWV
No. 9LOODJH)RGGHU6HHG The Farm Dry Slipsd (Nos.)
Production Farms (Hect.)
Irrgated Un Produced 'LVWULEXWHG Produced 'LVWULEXWHG
irrigated Utilised Utilised
1 2 3 4 5 6 7 8 9 10 11 12
Fodder Production Farm- Guvar, Rajka Bajri , Green 89100 89100 720 450
1 Banaskantha 10.00 2.00 8.00
Panthavada,ICDP Palanpur. Oat Kent, Hy. Jower. Dry 8000 8000 0 0
10.61
(ii) Fodder Production Farm-
2 Vadodara (2.05 hect. Green 46515 46515
Kondh Ta: Valiya, ICDP Jower SSG 2.66 7.95 0 0
125
Kharaba Dry 0 0
Vadodara.
land)
1 2 3 4 5 6 7 8 9 10 11 12 13 14
$*RYHUQPHQWRI*XMDUDW*6:'&
C.B.F. Bhutvad, Maiz A.T., Kent Oat, Sorgum-ssg, Green 333525 333525 0 0
120.00 Marvel,Forest. 8.00 28.00 0 0
Ta.Dhoraji Dry 0 0 0 0
1 Rajkot
S . B . F. - J a s d a n Lucerne, Juwar, Bajari, Mung, Maize, Green 104576 104576
70.14 Groundnut, N.B.-21, Castor etc. 56.00 14.14 34440 34440 0 0
(GSWDC). Dry 49176 49176
C.B.F.- Thara, Green 269300 269300
304.70 Rajko , Rajka Bajari, Jowar, Oat. 7.00 28.00 0 0 0 0
Ta: Kankrej Dry 350200 350200
2 Banaskantha
Ram Depot - Lucerne, Rajka Bajari, Juwar, Bajari, Green 166380 166380
55.00 Maize,Wheat, Muster Seed, Guvar. 54.00 1.00 45219 45219 0 0
Aseda Dry 52274.18 52274.18
Ram Depot- Green 6777 6777
3 Amreli 54.16 Juwar, Maize, Cotton,Onion 53.20 2.16 2834 2834 0 0
126
Chalala Dry 3055 3055
Ram Depot- Green 0 0
4 Bhavnagar 24.13 Juwar 12.00 12.31 0 0 0 0
Shihor Dry 2615 2615
C.B.F.- Bhuj. 2943.96 - 0.00 0.00 0 0 0 0 0 0 0
Ram Depot
Lucerne, Rajka Bajari, Maize, Wheat, Green 14149 14149
(a) Mankuva 33.24 Muster Seed, Groundnut, Castor. 25.00 8.24 4961 4961 0 0
Dry 0 0
5 Kachchh
Lucerne, Rajka Bajari, Wheat, Cotton , Green 53850 53850
(b) Nana layaja 89.32 Onion, Muster Seed. 85.00 4.32 19834 19834 0 0
Dry 4000 4000
Wheat, Cotton, Onion, Bajari, Muster Green 0 0
(c) Merau 23.09 Seed , Sun Flower, Guwar. 20.00 3.09 0 0 0 0
Dry 8010 8010
Green 0 0
(d) Mundra 10.00 - 9.00 1.00 20277 20277 0 0
Dry 6000 6000
Cattle Breeding P.N.B., Rajaka Bajari, Jowar SSG, Green 630975 630975 0 0 0 0
6 Surart 332.71 African Tall Maiz, Nutree Feed 30.1 26.94
Farm, Mandvi Dry 102480 102480 0 0 0 0
9.4 Conti…..
Sr. District Name and Area Main Fodder Crops Area Sown Green Quantity of Fodder Quantity of 4XDQWLW\RI5RRWV
No. Location of The (Hect.) Dry (Kg.) Fodder Seed Slips (Nos.)
of Village Farm (Kgs.)
)RGGHU6HHG (Hect.)
Production Irrgated Un Produced 'LVWULEXWHG Produced 'LVWULEXWHG Produced Distributed
Utilised Utilised 8WLOLVHG
Farms irrigated
1 2 3 4 5 6 7 8 9 10 11 12 13 14
(B) Gujarat Agriculture University
1 Junagadh C.B.F.- 184.5. Maiz, Sorghum, Marvel grass, Hybrid 90.00 16.50 Green 6123200 6123200 0 0 0 0
Junagadh Napier, Lucerne, Bajara. hect Dry 0 0
grazing
land
2 Banaskantha LRS-Sardar- 100.80 Rajka-Bajari,Jowar, Maize, Chikory, 93.58 10.00 Green 2945590 2945590 0
127
Krishinagar Lucerne, Oat, Cowpea, Others. Dry 1600 1600 0 0 0 0
0 0 0
3 Anand LRS -Anand 40.00 Sorgum, Cowpea, Maize, Oat, 40.00 0.00 Green 1767500 0 1767500 1000 15650
(Navli Fodder +\EULG1DSLHU6XQÀRZHU Dry 0 1000 0 15650 0
Farm) 0 0
4 Navsari LRS -Navsari 15.70 Hybrid Sorghum,Lucerne,Oat, 15.70 0.00 Green 1137060 0 1137060 0 0 0 5300 5300
Hybrid Napier, Maize Dry
(C) Government of India
1 Surat Central 410.22 Maiz (A.T.), P.C.23-Jowar, Oats(Kent), 40.00 120.00 Green 322300 322300 0 0 0 0
Buffalow Hamal, P.C.23+ Cowpea+Bajara, Dry 173500 173500
Breeding Lucerne, Sorghum sudan, N.B.- Grazed 349300 349300
Farm- 21, Stylo, M.P.Chari, P.C.09+
Dharmrod Cowpea+Bajara, CO-3, COFS-29, .
2 Kheda SAGP-Bidaj 231.00 Sorghum,Maize, Lucerne,Oats. 140 67 Green 567800 567800 26637 26637 0 0
Farm Hay 94200 94200
Silage 61800 61800
128
129
130
D - 8 : Estimates Of Major Livestock Products And E D P Work
The Directorate of Animal Husbandry Gujarat State is conducting Integrated
Sample Survey (ISS) since 1977-78 .This survey is conducted round the year basis to
estimate the annual production of major livestock products viz. Milk, Eggs, &Wool.
The survey (ISS) has been further strengthened since 1983-84 so as to obtain district
level estimates of major livestock products.
The survey is being conducted according to the guidelines provided by Indian
Agricultural statistics Research Institutes (IASRI), New Delhi. The survey provides
estimates of population as well as products in respect of Indigenous cow, Cross breed
Cow, Buffalo, Goat &Sheep and Deshi improved layers.
For conducting survey (ISS) the whole state has been divided into 26 Districts.
20% of villages are selected randomly every year from each stratum. From the selected
villages in each stratum, 10 villages (and 5 for each new district) are selected in each of
three seasons every year for detailed management study. The remaining selected villages
form large sample where in listing is carried out only for population part. The detailed
management study over & above population of livestock products also includes feeding
practices, dung productions& utilization, lactation/calving period etc. observed in the
selected house hold/farms during each round. The household/farms are selected as per
WKHQHZSDWWHUQSUHVFULEHGE\,$65,1HZ'HOKL7KH¿HOGZRUNLVFDUULHGRXWE\WKH
¿HOGLQYHVWLJDWRUVVSHFLDOO\WUDLQHGLQWKLVUHJDUGXQGHUWKHVXSHUYLVLRQDQGJXLGHOLQHV
RIWHFKQLFDORI¿FHUVRIWKH'LUHFWRUDWHRI$QLPDO+XVEDQGU\7KHGDWDLVFROOHFWHGLQWKH
prescribed schedules in four monthly rounds in each season. The tabulation & analysis
of data is carried by statistical and research assistants under the guidance of Research
2I¿FHU'HSXW\'LUHFWRU6XUYH\ -RLQWGLUHFWRU6WDWLVWLFV'HWDLOHGVXUYH\UHSRUW
on estimates of major livestock products is prepared & published every year by the
VWDWLVWLFDOVXUYH\EUDQFKRIWKH'LUHFWRUDWH6RPHRIWKHPDMRU¿QGLQJRIWKHVXUYH\
results is presented in the table followed.
The computer facility was provided in this department in 1988-89. Moreover,
Departmental Statistics are being computerized as under.
(1) Selection of villages for sample survey.
(2) Standard error of estimates of Major Livestock Products by using statistical
formulas.
131
(3) 3D\UROO6\VWHPRIKHDGRI¿FHHPSOR\HHV
(4) Analyzing milk yield competition at State level & National level.
(5) Monthly progress report of Epidemiology to be sent to the Central
Government.
(6) Existing equipment record.
(7) Publications like Bulletin, Telephone Directory, Location register etc,
(8) The software of technical report making online is successfully developed
and it working from 2006. All centers providing monthly Technical report
online. The Data available at District, Region and State level with 100%
accuracy.
(9) Employment Record entry has also started online.
(10) E-governance based applications, formats of Agriculture and Animal
Husbandry related for the people, to submit their online application for
any subsidy scheme of Animal Husbandry will be started shortly.
Besides Computerization, EDP Cell is providing statistical data of Animal
Husbandry & Dairying Statistics through Annual Bulletin. A Web-site of “Animal
Husbandry-Gujarat State” is also launched through “GUJARAT INFORMATICS
LIMITED-GANDHINAGAR.”
--------------
132
10.1 Estimates No. of Productive Animals,yield and Milk Production.
Sr. No. Year Estimated No. of Productive Animals (In ‘00 Nos.)
Cow Buffaloes Goat
Idigenous Cross-bred In-milk Milch In Milk Milch
In-milk Milch In-milk Milch
1 2 3 4 5 6 7 8 9 10
1 2000-01 13053 21682 960 1390 23916 37612 17531 30203
2 2001-02 13330 21786 1243 1625 26342 41545 17131 29038
3 2002-03 13741 21787 1292 1709 26909 41039 17249 29803
4 2003-04 13959 22037 1426 1887 27557 42038 17416 30191
5 2004-05 14008 21952 1596 2151 28240 42428 18024 30200
6 2005-06 14270 21906 1699 2294 28614 43341 18204 30053
7 2006-07 14469 22739 2797 3766 29405 44522 17875 28849
8 2007-08 14524 22630 3178 4300 30232 45058 17454 28069
9 2008-09 13952 21922 3912 5338 31186 47388 16013 26143
10 2009-10 14233 22878 4589 6256 32113 48928 15776 27011
11 2010-11 14455 23153 5095 7004 32982 50657 15978 27181
12 2011-12 14630 23528 5640 7843 33322 52068 15874 27264
13 2012-13 15109 24532 6205 8697 33832 52693 15605 26379
14 2013-14 15974 25924 7047 10037 34772 54328 16226 27574
15 2014-15 16443 26256 7491 10511 35468 55199 16378 27999
16 2015-16 18463 29973 8065 11669 36208 56689 17768 29663
17 2016-17 19002 30928 8773 12641 37012 57440 18444 31902
18 2017-18(P) 19459 31261 9734 14267 37830 58585 18593 31336
10.1 Conti….
Sr. No. Overall Average Daily Yield per Animals(Kgs.) Estimated Milk Production (in Lakh Kg.)
In-milk Cow In-milk In-milk In-milk Cow In-milk In-milk Total
Indigenous C. B. Buffalo Goat Indigenous C. B. Buffalo Goat
1 11 12 13 14 15 16 17 18 19
1 3.011 7.351 3.886 0.355 14347 2577 33976 2273 53173
2 3.068 7.935 3.948 0.364 14929 3600 37961 2270 58760
3 3.153 8.015 3.968 0.370 15812 3779 38976 2327 60894
4 3.196 8.223 4.081 0.381 16330 4292 41159 2426 64207
5 3.308 8.183 4.193 0.388 16913 4767 43223 2551 67454
6 3.344 8.324 4.256 0.387 17415 5162 44452 2571 69600
7 3.401 8.057 4.343 0.388 17961 8227 46610 2533 75331
8 3.480 8.230 4.389 0.388 18499 9572 48565 2481 79117
9 3.634 8.350 4.489 0.400 18508 11923 51102 2339 83872
10 3.680 8.449 4.509 0.402 19117 14152 52847 2312 88428
11 3.750 8.567 4.580 0.404 19785 15931 55136 2356 93208
12 3.845 8.668 4.696 0.415 20588 17894 57272 2411 98165
13 3.947 8.811 4.778 0.425 21766 19957 59001 2421 103146
14 4.073 8.937 4.869 0.438 23748 22989 61796 2594 111127
15 4.192 9.084 4.964 0.445 25159 24835 64239 2673 116906
16 4.162 8.973 4.914 0.444 28127 26487 65120 2890 122624
17 4.220 8.959 4.947 0.454 28685 29268 66829 3059 127841
18 4.334 9.129 5.021 0.463 30785 32432 69331 3143 135691
P=Provisional
133
10.2 Estimates of No. of Layers, yield and Egg Production.
Sr. No Year Estimated No. of Layers Average No. of Eggs Production
(Lakh Nos.) Eggs Yield Per Year (Lakhs Nos.)
1 2 3 4 5 6 7 8 9 10
P=Provisional
134
10.3 Estimates No. of Sheep, yield and Wool Production.
Sr. No Year Estimated No.of Sheep $YHUDJH:RRO<LHOG Total Wool Production
(Lakh) <HDU6KHHS*UDP (Lakh Kg)
1 2 3 4 5
P=Provisional
135
10.4 Estimates of Major Livestock Product and Growth Rate (%), Base year 2000-2001.
Sr. No Year Estimated Growth Estimated Growth Estimated Growth
Milk of Milk Egg of Eggs Wool of Wool
production Production production Production production Production
(in lakh kg.) (%) (in lakh nos.) (%) (in lakh kg.) (%)
1 2 3 4 5 6 7 8
1 2000-01 53173 - 3460 - 27.40 -
P=Provisional
136
10.5 Per Capita Availability of Livestock Products, Gujarat State.
Sr. No. Year Products Total Quantity Produced Average per Capita
Unit Quantity Availability
1 2 3 4 5 6
Milk Lakh Kg. 60894 321 gms/day
1 2002-03 Eggs Lakh No. 3848 7.40 nos./year
Wool Lakh Kg. 27.11 52 gms/year
Milk Lakh Kg. 64207 333 gms/day
2 2003-04 Eggs Lakh No. 4423 8.38 nos./year
Wool Lakh Kg. 27.80 53 gms/year
Milk Lakh Kg. 67454 344 gms/day
3 2004-05 Eggs Lakh No. 5031 9.37 nos./year
Wool Lakh Kg. 29.50 55 gms/year
Milk Lakh Kg. 69600 350 gms/day
4 2005-06 Eggs Lakh No. 5775 10.60 nos./year
Wool Lakh Kg. 31.23 57 gms/year
Milk Lakh Kg. 75331 373 gms/day
5 2006-07 Eggs Lakh No. 7757 14.03 nos./year
Wool Lakh Kg. 29.62 54 gms/year
Milk Lakh Kg. 79117 386 gms/day
6 2007-08 Eggs Lakh No. 8256 14.72 nos./year
Wool Lakh Kg. 29.96 53 gms/year
Milk Lakh Kg. 83872 403 gms/day
7 2008-09 Eggs Lakh No. 12675 22.22 nos./year
Wool Lakh Kg. 28.54 50 gms/year
Milk Lakh Kg. 88428 421 gms/day
8 2009-10 Eggs Lakh No. 12762 22.16 nos./year
Wool Lakh Kg. 29.19 51 gms/year
Milk Lakh Kg. 93208 437 gms/day
9 2010-11 Eggs Lakh No. 13269 22.73 nos./year
Wool Lakh Kg. 29.18 50 gms/year
Milk Lakh Kg. 98165 436 gms/day
10 2011-12 Eggs Lakh No. 14269 22.73 nos./year
Wool Lakh Kg. 28.19 45 gms/year
Milk Lakh Kg. 103146 453 gms/day
11 2012-13 Eggs Lakh No. 14558 23.22 nos./year
Wool Lakh Kg. 26.64 43 gms/year
Milk Lakh Kg. 111127 476 gms/day
12 2013-14 Eggs Lakh No. 15550 24.00 nos./year
Wool Lakh Kg. 25.78 40 gms/year
Milk Lakh Kg. 116906 492 gms/day
13 2014-15 Eggs Lakh No. 16565 25.00 nos./year
Wool Lakh Kg. 25.77 40 gms/year
Milk Lakh Kg. 122624 506 gms/day
14 2015-16 Eggs Lakh No. 17216 26.00 nos./year
Wool Lakh Kg. 22.83 34 gms/year
Milk Lakh Kg. 127841 517 gms/day
15 2016-17 Eggs Lakh No. 17940 27.00 nos./year
Wool Lakh Kg. 22.67 33 gms/year
Milk Lakh Kg. 135691 564 gms/day
16 2017-18 (P) Eggs Lakh No. 17868 27.00 nos./year
Wool Lakh Kg. 22.95 35 gms/year
P=Provisional
137
10.6 Districtwise Estimation of Milk, Egg and Wool Production, 2017-18(P).
Sr. No. District Milk (‘000 Rank Eggs (Lakhs Rank Wool (‘000 Rank
tonnes) No.) Kgs.)
1 2 3 4 5 6 7 8
1 Ahmedabad 455.16 15 1255.12 3 18.92 13
138
139
140
D - 9 : Sale Management & Marketing
Preservation of Milch Animals Scheme
Keeping milk and milk product availability in adequate amount and reasonable
price of milk in Gujarat, local breed Transportation of cattle of Gujarat should not
reached to the other state without permission. Under sanction 4 of the Gujarat essential
commodities and cattle control act. 2005 the Gujarat Government put ban on the export
of cattle of Gujarat and strictly the implementation is carried out under this scheme.
In Year 2017-18 this Scheme is closed as per Gujarat Govt. Resolution, Agriculture,
Co-Operation and Farmers Welfare Dept. Resolu. No. AHS-112017-1207-P1
Dt.25/07/2017. Hence the following Data is up to August-2017.
From Gujarat mainly in Maharastra state and in Mumbai the salvage buffalo is
exported.
The year 2017-18 schematic work for Animal Export :
141
Import of buffalo :
For Import of Salvage Buffalo total 11 permit issued in year 2017-18. From
import Rs 6600/- revenue income to Govt. of Gujarat had occurred in year 2017-18.
At check post the three livestock inspector are doing the job 24×7 hours & strictly
monitoring Govt. of Gujarat import & export proceeding.
From Zadeshvar , Dist. Bharuch check post total 4653 buffaloes are exported
through 523 trucks & no Buffaloes are imported in any Truck.
From Bhilad, Dist. Valasad check post total 2826 buffaloes exported through
316 trucks and total 4081 buffaloes are imported through 462 trucks.
From Songadh, Dist. Tapi check post there is no import and export buffaloes
through any Trucks.
Govt. of Gujarat got total revenue income `12000/- from import and export
salvage buffaloes.
In above scheme during the Year: 2017-18 `32.53 lakhs expenditure occurred.
-------------
142
11.1 Import and Export of Animals-Gujarat State 2017 - 18.
Sr.No. Category Item Import Export
1 2 3 4 5
(i) Gir 0 161
(ii) Kankrej 0 0
1 Cattle
(iii) Other (H.F.Cross) 0 0
(i) Salvage 66 54
Total Buffaloes 66 54
143
11.2 Milk Sale Prices of Co-operatives Dairies 2017-18.
Sr.No. District Type of Milk Apr-17 May-17 Jun-17 Jul-17 Aug-17 Sep-17 Oct-17 Nov-17 Dec-17 Jan-18 Feb-18 Mar-18
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
T 40 40 40 40 40 40 40 40 40 40 40 40
ST 46 46 46 46 46 46 46 46 46 46 46 46
1 Ahmedabad W 50 50 50 50 50 50 50 50 50 50 50 50
SM 48 48 48 48 48 48 48 48 48 48 48 48
DT 46 46 46 46 46 46 46 46 46 46 46 46
W 48 48 49 49 49 49 49 49 49 49 48 48
T 37 37 38 38 38 38 38 38 38 37 37 37
2 Amareli
ST 44 44 45 45 45 45 45 45 45 45 44 44
DT 36 36 36 36 36 36 36 36 36 36 35 35
T 32.63 32.14 32.73 33.13 32.47 32.14 32.14 32.14 31.15 30.49 29.17 29.17
ST 48 48 48 48 48 48 48 48 48 48 48 48
3 Banaskatha W 44.95 44.27 45.08 45.63 44.72 44.27 44.27 44.27 42.9 41.99 40.18 40.18
SM 29 29 29 29 29 29 29 29 28 27 26 26
DT 23 22 23 23 23 22 21 21 20 18 16 16
T 40 40 40 40 40 40 40 40 40 40 40 40
ST 48 48 48 48 48 48 48 48 48 48 48 48
4 Bharuch W 52 52 52 52 52 52 52 52 52 52 52 52
DT 40 40 40 40 40 40 40 40 40 40 40 40
SM - - - - - - - - - - - -
T 37 37 37 37 37 37 37 37 37 37 37 37
DT 33 33 33 33 33 33 33 33 33 35 35 35
144
5 Bhavanagar ST 44 45 45 45 45 45 45 45 45 44 44 44
W 48 48 49 49 49 49 49 49 49 48 48 48
SM 31 31 32 32 32 32 32 32 32 32 32 32
T 0 0 0 0 0 0 0 0 0 0 0 0
6 Botad
W 0 0 0 0 0 0 0 0 0 0 0 0
T 0 0 0 0 0 0 0 0 0 0 0 0
ST 0 0 0 0 0 0 0 0 0 0 0 0
7 Gandhinagar
W 0 0 0 0 0 0 0 0 0 0 0 0
SM 0 0 0 0 0 0 0 0 0 0 0 0
W 47 46 45 47 46 46 46 46 47 45 43 42
T 37 37 37 38 38 38 38 38 38 37 37 37
8 Kachchh
ST 44 44 43 45 45 45 45 45 45 44 44 44
DT - - - - - - - - - - - -
T 39 39 39 39 39 39 39 39 39 39 39 39
ST 48 48 48 48 48 48 48 48 48 48 48 48
9 Kheda W 52 52 52 52 52 52 52 52 52 52 52 52
DT 38 38 38 38 38 38 38 38 38 38 38 38
SM - - - - - - - - - - - -
T-Tonned Milk W-Whole Milk ST-Standard Milk SM-Skim Milk DT- Dobble Tonned Milk
11.2 Conti.....
Sr.No. District
Type of Apr-17 May-17 Jun-17 Jul-17 Aug-17 Sep-17 Oct-17 Nov-17 Dec-17 Jan-18 Feb-18 Mar-18
Milk
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15
10 Junagadh T 0 0 0 0 0 0 0 0 0 0 0 0
T 40.28 40.28 40.28 40.28 40.28 40.28 40.28 40.28 40.28 40.28 40.28 40.28
11 Mahesana ST 47.38 47.38 47.38 47.38 47.38 47.38 47.38 47.38 47.38 47.38 47.38 47.38
W 49.97 49.92 50.07 49.83 49.87 50.07 50.02 50.07 50.06 50.06 50.07 50.06
12 Morbi ST 0 0 0 0 0 0 0 0 0 0 0 0
T 40 40 40 40 40 40 40 40 40 40 40 40
ST 48 48 48 48 48 48 48 48 48 48 48 48
13 Panchmahals W 52 52 52 52 52 52 52 52 52 52 52 52
SM - - - - - - - - - - - -
DT 38 38 38 38 38 38 38 38 38 36 36 36
T 40 40 40 40 40 40 40 40 40 40 40 40
ST 48 48 48 48 48 48 48 48 48 48 48 48
14 Rajkot
W 52 52 52 52 52 52 52 52 52 52 52 52
SM NA NA NA NA NA NA NA NA NA NA NA NA
T 33 32 33 33 32 32 32 32 31 30 29 29
ST 48 48 48 48 48 48 48 48 48 48 48 48
145
15 Sabarkatha W 45 44 45 46 45 44 44 44 43 42 40 40
DT 29 29 29 29 29 29 29 29 28 27 26 26
SM 23 22 23 23 23 22 21 21 20 18 16 16
T 40 40 40 40 40 40 40 40 40 40 40 40
ST 50 50 50 50 50 50 50 50 50 50 50 50
16 Surat W 56 56 56 56 56 56 56 56 56 56 56 56
DT 38 38 38 38 38 38 38 38 38 38 38 38
SM 26 26 26 26 26 26 26 26 26 26 26 26
17 Surendranagar W 0 0 0 0 0 0 0 0 0 0 0 0
T 44 44 44 44 44 44 44 44 44 44 44 44
ST 48 48 48 48 48 48 48 48 48 48 48 48
18 Vadodara W 52 52 52 52 52 52 52 52 52 52 52 52
SM 0 0 0 0 0 0 0 0 0 0 0 0
DT 40 40 40 40 40 40 40 40 40 40 40 40
T 0 0 0 0 0 0 0 0 0 0 0 0
DT 0 0 0 0 0 0 0 0 0 0 0 0
19 Valsad ST 0 0 0 0 0 0 0 0 0 0 0 0
W 0 0 0 0 0 0 0 0 0 0 0 0
CM 0 0 0 0 0 0 0 0 0 0 0 0
T-Tonned Milk W-Whole Milk S-Standard Milk SM-Skim Milk DT- Dobble Tonned Milk
11.3 Districtwise Meat Prices 2017 - 18.
Sr. Districts April’17 May-’17 Jun’-17 Jul-’17 Aug.-’17 Sept.-’17
No.
G S G S G S G S G S G S
1 2 3 4 5 6 7 8 9 10 11 12 13 14
1 Ahmedabad 390 285 400 280 400 280 400 290 400 300 400 300
2 Amreli 350 300 350 300 350 300 350 300 350 300 350 300
3 Anand 400 400 415 415 415 415 420 420 410 410 400 400
4 Aravalli 420 340 420 340 450 340 400 330 400 330 410 350
5 Banaskantha 450 200 450 200 450 200 400 190 380 180 360 180
6 Bharuch 450 N.A. 450 N.A. 460 N.A. 460 N.A. 460 N.A. 460 N.A.
7 Bhavnagar 280 200 300 200 300 200 290 190 290 190 290 190
8 Botad 380 N.A. 380 N.A. 400 N.A. 380 N.A. 350 N.A. 350 N.A.
9 Chhota Udepur 380 330 380 330 370 340 370 340 360 340 360 350
10 Dahod 300 280 300 280 300 280 300 280 300 280 300 280
11 Dang 375 N.A. 375 N.A. 400 N.A. 400 N.A. 400 N.A. 400 N.A.
12 Devbhumi Dwarka N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A.
13 Gandhinagar 360 360 360 360 360 360 360 360 360 360 360 360
14 Gir Somanath 350 320 350 320 380 330 380 330 380 330 390 340
15 Jamnagar 350 323 350 300 350 350 350 350 350 350 350 350
16 Junagadh 350 300 350 300 350 300 350 300 365 317.5 380 330
17 Kachchh 350 330 350 340 350 340 350 320 360 330 362.5 332.5
18 Kheda 350 350 350 350 350 350 350 350 350 350 350 350
19 Mahesana 350 350 380 365 380 380 380 380 320 320 320 320
20 Mahisagar 320 285 322.5 285 360 290 390 295 385 325 385 340
21 Morbi 385 400 385 400 390 400 390 400 390 400 390 400
22 Narmada 370 N.A. 360 N.A. 360 N.A. 360 N.A. 360 N.A. 360 N.A.
23 Navsari 440 N.A. 440 N.A. 440 N.A. 380 N.A. 380 N.A. 350 N.A.
24 Panchmahala 350 240 350 240 350 290 350 340 350 340 350 340
25 Patan 350 342.5 350 340 350 340 350 340 350 340 350 340
26 Porbandar 300 300 300 300 300 300 300 300 300 300 300 300
27 Rajkot 400 400 400 400 400 400 400 400 400 400 400 400
28 Sabarkantha 400 360 400 360 420 360 400 360 400 360 400 360
29 Surat 415 N.A. 370 N.A. 360 N.A. 390 N.A. 410 N.A. 420 N.A.
30 Surendranagar 315 330 320 335 322 340 318 315 321 320 315 330
31 Tapi 350 320 350 340 340 320 360 350 360 350 360 350
32 Vadodara 380 370 380 370 380 370 380 370 380 370 380 370
33 Valsad 375 375 355 355 345 345 325 325 350 350 375 375
Rounded to nearest value G = Goat Meat S = Sheep Meat N.A. = Not Available
146
11.3 Conti...
Sr. Districts Oct.-’17 Nov.-’17 Dec.-’17 Jan.-’18 Feb.-’18 Mar-’18
No.
G S G S G S G S G S G S
1 2 15 16 17 18 19 20 21 22 23 24 25 26
1 Ahmedabad 400 300 400 320 400 320 400 300 400 300 400 300
2 Amreli 350 300 350 300 350 300 360 310 370 320 370 320
3 Anand 400 400 400 400 400 400 400 400 400 400 400 400
4 Aravalli 410 350 410 350 420 360 420 350 410 355 420 350
5 Banaskantha 360 190 380 190 450 180 425 180 450 180 450 140
6 Bharuch 460 N.A. 450 N.A. 450 N.A. 430 N.A. 430 N.A. 432.5 N.A.
7 Bhavnagar 290 190 290 190 290 190 290 190 290 190 290 190
8 Botad 375 N.A. 375 N.A. 350 N.A. 350 N.A. 350 N.A. 350 N.A.
9 Chhota Udepur 360 350 360 350 360 350 360 350 360 350 360 350
10 Dahod 300 280 300 280 300 280 300 280 340 280 340 280
11 Dang 300 N.A. 400 N.A. 400 N.A. 400 N.A. 400 N.A. 400 N.A.
12 Devbhumi Dwarka N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A. N.A.
13 Gandhinagar 360 360 360 360 360 360 360 360 360 360 360 350
14 Gir Somanath 400 350 400 350 400 350 400 350 400 350 400 350
15 Jamnagar 350 350 350 350 350 350 350 350 350 350 350 350
16 Junagadh 385 330 390 350 390 355 400 400 400 400 400 400
17 Kachchh 370 340 370 340 375 345 370 340 370 340 270 270
18 Kheda 350 350 350 350 350 350 350 350 350 350 350 350
19 Mahesana 320 320 350 350 400 400 400 400 400 400 400 400
20 Mahisagar 392.5 352.5 400 375 400 390 390 370 390 380 395 375
21 Morbi 390 400 410 385 380 360 350 340 355 340 350 340
22 Narmada 360 N.A. 360 N.A. 360 N.A. 360 N.A. 360 N.A. 360 N.A.
23 Navsari 380 N.A. 365 N.A. 370 N.A. 345 N.A. 340 N.A. 265 N.A.
24 Panchmahala 350 320 350 320 350 320 350 320 350 320 350 320
25 Patan 360 380 360 380 360 380 360 380 360 380 370 390
26 Porbandar 300 300 300 300 300 300 300 300 300 300 300 300
27 Rajkot 400 400 400 450 400 450 400 450 400 450 400 400
28 Sabarkantha 410 360 420 360 420 360 420 350 410 355 420 350
29 Surat 425 N.A. 430 N.A. 430 N.A. 430 N.A. 420 N.A. 385 N.A.
30 Surendranagar 320 325 322 320 330 330 335 335 330 340 267.5 262.5
31 Tapi 360 350 370 360 370 360 380 360 380 365 380 350
32 Vadodara 435 350 440 355 450 380 455 380 440 380 445 380
33 Valsad 360 360 335 335 325 325 335 335 330 330 330 330
Rounded to nearest value G = Goat Meat S = Sheep Meat N.A. = Not Available
147
148
149
150
12.1 1RRI$QLPDOV8QLWV6XEVLGLVHGXQGHU,QGLYLGXDO%HQH¿FLDU\6FKHPHV3URJUDPPHV
Sr. District Under Dept.of A. H. (units) GSCDC Cows & Buffaloes (Nos.)
No. Duck Rabbit Goat Unit Bankable Project N.S.F.D.C. Total
Unit Unit (Nos.) Project (Nos.)
1 2 3 4 5 6 7 8
1 Ahmedabad 0 0 12 200000 346000 546000
2 Amreli 0 0 12 0 300000 300000
3 Anand 0 0 9 460000 1080000 1540000
4 Aravalli 0 0 47 901000 2385000 3286000
5 Banaskantha 0 0 29 1470000 5760000 7230000
6 Bharuch 0 0 11 0 0 0
7 Bhavnagar 0 0 147 0 0 0
8 Botad 0 0 5 0 150000 150000
9 Chhoto-Udepur 0 0 6 100000 90000 190000
10 Dahod 0 0 11 0 540000 540000
11 Dangs 0 0 1 0 0 0
12 Devbhoomi Dwarka 0 0 12 0 200000 200000
13 Gandhinagar 0 0 12 460000 945000 1405000
14 Gir-Somanath 0 0 13 0 0 0
15 Jamnagar 0 0 74 0 600000 600000
16 Junagadh 0 0 4 0 585000 585000
17 Kachchh 0 0 76 90000 2700000 2790000
18 Kheda 0 0 12 125000 630000 755000
19 Mahesana 0 0 12 270000 3735000 4005000
20 Mahi-Sagar 0 0 11 40000 2025000 2065000
21 Morbi 0 0 83 0 100000 100000
22 Narmada 0 0 15 0 0 0
23 Navsari 0 0 11 0 0 0
24 Panchmahal 0 0 68 0 810000 810000
25 Patan 0 0 16 350000 2745000 3095000
26 Porbandar 0 0 10 0 0 0
27 Rajkot 0 0 56 0 150000 150000
28 Sabarkantha 0 0 11 740000 3150000 3890000
29 Surat 0 0 13 0 0 0
30 Surendranagar 0 0 51 0 765000 765000
31 Tapi 0 0 12 0 0 0
32 Vadodara 0 0 12 1510000 1080000 2590000
33 Valsad 0 0 59 0 0 0
Total 0 0 933 6716000 30871000 37587000
G S C E D C = Gujarat Scheduled Caste Development Corporation
N.S.F.D.C. = National Scheduled Caste Finance Development Corporation
151
12.2 1XPEHURI3RXOWU\8QLWV6XEVLGLVHG,QGLYLGXDO%HQH¿FLDU\6FKHPH3URJUDPPHRI$+
152
153
154
D - 10 : Animal Husbandry Extension
LIVESTOCK EXHIBITION:-
A State level exhibition and competition of livestock show was organized during
year 2017-18 in which pedigreed elite animals participated in various events and prizes were
given to winners. From 24/8/2017 to 26/8/2017, exhibition and competition of livestock
was organized at “Tarnetar”, in which 187 animals were participated and 37 prizes were
distributed.
Banni – Livestock Exhibition fair was organized at Hodka during Date 30/12/2017 to
31/12/2017.
----------
156
13.1 Work done by Exhibition Unit under Department of Animal Husbandry.
Sr. No. Period No. Of Broadcasts No. of T.V. No. of No. of Video Show
delivered on Technical Programme Exhibition held Organised
Subjects, Akashvani
1 2 3 4 5 6
1 2002-2003 64 58 13 48
2 2003-2004 59 61 494 52
3 2004-2005 62 64 475 29
4 2005-2006 63 66 556 16
13 2014-2015 32 35 556 -
14 2015-2016 36 37 308 -
15 2016-2017 25 40 305 -
16 2017-2018 16 45 327 -
157
13.2 Work done by Extension Unit and Exhibition Unit under Department of Animal Husbandry.
Sr. Activitiey Year
No.
2009-10 2010-11 2011-12 2012-13 2013-14 2014-15 2015-16 2016-17 2017-18
1 2 6 7 8 9 10 11 12 13 14
No. of Broadcasts delivered on
1 59 56 31 30 32 32 36 25 16
Technical Subjects, Akashvani.
No. of Broadcasts delivered through
2 - - - - - - - - 4
BISAG
3 No. of TV Programme 61 57 38 51 30 35 37 40 45
4 No. of Exhibition held 796 558 347 851 577 556 308 305 327
9 No. of Books and Booklets printed 270000 540000 540000 540000 540000 5413150 540000 780000 545000
No. of Posters and Pamphlets
10 - 1204000 1104000 808000 1195000 4974000 655665 84500 416500
Distributed
11 No. of Calandars - - - - - - - 40000 3000
Livestock
17 - - - - - - - - 1
No. Of Inspectors
Training
18 Collaborative 9HW2I¿FHUV - - - - - - - - 1
Training with
Livestock
19 EEI Anand - - - - - - - - 30
No. Of Inspectors
Trainees
20 9HW2I¿FHUV - - - - - - - - 30
158
159
160
14.1 Information regarding Gazetted, Non-Gazetted Posts sanctioned, In-position and vacant under
Animal Husbandry Department in Gujarat State as on 31-3-2018.
Sr. Service Cader and Class No. of Posts
No.
Sanction In Vacant
Position
1 2 3 4 5
Super Class-I Director (131100-216600-Level-13A) 1 1 0
Senior Duty Class - I Addi. Director (118500-214100-Level-13) 1 0 1
A
Gujarat A.M. Services Joint Director (78800-209200-Level-12) 9 7 2
Sub Total (A) 11 8 3
Guj.A.H.Services (67700-208700-Level-11) 95 45 50
Guj.General Services (53100-167800-Level-9) 2 0 2
B Class - I Guj.Statistical Services (53100-167800-Level-9) 2 1 1
Guj. Account Services (67700-208700-Level-11) 1 1 0
Sub Total (B) 100 47 53
Guj.A.H.Services 162 93 69
Guj.General Services 18 6 12
C Class - II Guj.Statistical Services 9 8 1
Guj. Account Services 2 0 2
Sub Total (C) 191 107 84
Guj.A.H.Services (VO)
(i) A.H.Services (VO) 198 152 46
D Class - II
(ii) Under Panchayat 663 339 324
Sub Total (D) 861 491 370
2I¿FHUVHPSOR\HHVRQ'HSXWDWLRQWR3DQFKD\DW2WKHU'HSDUWPHQWRU*RYWXQGHUWDNLQJV*XM$+
Services
(i) Super Class-I (78800-209200-Level-12) 3 2 1
(ii) Class-I (67700-208700-Level-11) 6 2 4
(iii) (a) Class-II
(53100-167800-Level-9) 7 3 4
( under Panchayat)
(b) Class-II
E (53100-167800-Level-9) 0 0 0
(under Dep./Corp.)
(iv) Class-II (44900-142400-Level-8) 0 0 0
(v) Class-III (39900-126600-Level-7) 0 0 0
(29200-92300-Level-3) 0 0 0
(iv) Class-III
(25500-81100-Level-4) 0 0 0
Sub Total (E) 16 7 9
F Class-III Employees 2401 1266 1135
G Class-IV Employees 475 181 294
GRAND TOTAL (A) TO (G) 4055 2107 1948
161
14.2 Information regarding post sanctioned under Panchayats for Animal Husbandry and
Dairy Development 2017-18.
Sr. No. District Dy. Dir Asstt. V. O. Live stock Senior Junior Driver 'UHVVHU Peon Total
(A.H.) Dir. Class- Inspector &OHUN &OHUN Compounder
class-l (A.H.) ll Senior Clerk
class-ll Asstt. cum
Typist
1 2 3 4 5 6 7 8 9 10 11 12
1 Ahmedabad 1 1 26 17 1 3 0 16 42 107
2 Amreli 1 1 33 24 2 2 0 15 46 124
3 Anand 1 0 21 19 1 3 0 12 36 93
4 Aravalli 1 1 16 16 2 3 0 8 43 90
5 Banaskantha 1 1 59 26 1 1 0 11 45 145
6 Bharuch 1 1 20 22 2 3 0 9 53 111
7 Bhavnagar 1 1 27 19 1 0 1 3 12 65
8 Botad 1 1 10 6 2 3 4 20 49 96
g Chhoto-Udepur 1 1 12 14 2 3 1 17 47 98
10 Dahod 1 0 15 20 1 3 2 19 71 132
11 Dang 0 1 6 9 1 2 0 12 36 67
12 Devbhumi Dwarka 1 1 13 5 1 0 1 8 37 67
13 Gandhinagar 0 1 23 13 2 2 0 7 28 76
14 Gir-Somanath 1 1 19 4 2 3 0 6 38 74
15 Jamnagar 1 1 19 17 2 3 0 8 36 87
16 Junagadh 1 1 27 11 1 1 0 9 30 81
17 Kachchh 1 1 36 29 2 3 0 14 57 143
18 Kheda 1 1 16 18 1 1 2 7 27 74
19 Mahesana 1 1 31 22 2 3 1 12 50 123
20 Mahi-Sagar 1 1 13 17 2 3 0 8 39 84
21 Morbi 1 1 10 10 1 1 2 3 17 46
22 Narmada 1 0 17 13 1 2 2 8 38 82
23 Navsari 1 0 13 14 1 1 2 5 25 62
24 Panchmahal 1 1 22 21 2 3 1 4 21 76
25 Patan 1 0 31 15 2 1 0 8 24 82
26 Porbandar 1 0 11 8 0 2 0 1 12 35
27 Rajkot 1 1 27 18 0 0 0 0 0 47
28 Sabarkantha 1 1 21 20 0 0 0 0 0 43
29 Surat 1 1 15 25 0 0 0 0 0 42
30 Surendranagar 1 1 22 17 0 0 0 0 0 41
31 Tapi 1 1 9 22 0 0 0 0 0 33
32 Vadodara 1 1 15 17 0 0 0 0 0 34
33 Valsad 1 1 6 16 0 0 0 0 0 24
Gujarat 31 27 661 544 38 55 19 250 959 2584
162
14.3 9HWHULQDU\ ,QVWLWXWHV DQG &HQWUHV6XEFHQWUHV XQGHU YDULRXV $QLPDO +XVEDQGU\
Development Schemes 2017 -18.
Sr. District Veterinary Institutes &HQWUHV6XE&HQWUHVXQGHU
No. Poly- 9' MADLAV MVD FAVC RPVHC ADIO ICDP KVS
clinic BVD cum VD (Per 10
Villages)
1 2 3 4 5 6 7 8 9 10 11
1 Ahmedabad 1 27 4 9 17 6 1 45 0
2 Amreli 1 33 5 10 24 11 1 59 0
3 Anand 1 20 4 8 20 3 0 19 2
4 Aravalli 1 21 4 12 15 7 0 29 0
5 Banaskantha 1 62 9 18 27 27 1 50 0
6 Bharuch 1 19 6 14 25 3 1 78 1
7 Bhavnagar 1 27 5 18 19 2 1 29 0
8 Botad 1 10 1 10 6 0 0 18 0
9 Chhota Udepur 1 10 4 12 14 9 0 25 0
10 Dahod 1 19 6 9 23 6 1 20 0
11 Dang 1 6 2 5 9 3 0 0 0
12 Devbhumi Dwarka 1 13 1 10 6 3 0 9 0
13 Gandhinagar 1 23 4 3 13 3 0 77 1
14 Gir-Somanath 1 19 2 8 5 1 0 6 0
15 Jamnagar 1 20 3 11 17 1 1 11 0
16 Junagadh 1 30 4 10 7 3 1 52 0
17 Kachchh 1 32 3 18 29 11 1 50 0
18 Kheda 1 17 4 11 18 6 0 20 1
19 Mahesana 1 33 3 5 20 3 1 75 6
20 Mahi Sagar 1 19 2 11 17 2 0 5 3
21 Morbi 1 15 2 8 8 5 0 23 2
22 Narmada 1 14 5 12 16 0 0 27 1
23 Navsari 1 17 2 11 15 6 1 47 2
24 Panchmahal 1 23 4 7 21 0 0 20 6
25 Patan 1 29 5 12 15 1 1 50 1
26 Porbandar 1 11 1 5 7 9 0 9 0
27 Rajkot 1 28 4 14 18 0 1 54 0
28 Sabarkantha 1 24 5 11 22 5 1 53 0
29 Surat 1 18 5 10 25 7 1 71 0
30 Surendranagar 1 28 4 11 14 22 1 34 1
31 Tapi 1 10 3 11 26 8 0 29 0
32 Vadodara 1 15 2 10 17 0 1 44 0
33 Valsad 1 10 2 11 17 5 1 18 0
34 Hitech Poly.-Porbandar 1 0 0 340 0 0 0 0 0
Gujarat 34 702 120 345 552 178 18 1156 27
KVS= Key Village Scheme ICDP= Intensive Cattle Development Project
$',2 $QLPDO'LVHDVH,QYHVWLJDWLRQ2I¿FH VD= Veterinary Dispensaries
FAVC= First Aid Veterinary Centres BVD= Branch Veterinary Dispensaries
163
14.3 Conti…..
Sr. District 6KHHS*RDW6HUYLFH&HQWUHV &HQWUHV Mobile Unit Total No. Of
No. Sub R.P.
Centers
Centres
,6'3 LSSBF DEO Migratory Goat IPDP- Under Under
SEC Centres Flocks Breeding DPEC Dist. I.C.D.P.
Panchayat
1 2 12 13 14 15 16 17 18 19 20 21
1 Ahmedabad 0 0 0 1 0 2 1 0 113 6
2 Amreli 0 7 7 0 0 1 0 0 158 3
3 Anand 0 0 0 0 0 2 0 0 78 3
4 Aravalli 0 0 0 1 0 4 3 1 96 4
5 Banaskantha 21 5 0 0 1 6 3 0 230 0
6 Bharuch 0 0 0 0 1 4 1 0 153 0
7 Bhavnagar 0 0 0 0 0 2 1 0 104 0
8 Botad 0 1 0 0 0 0 0 0 46 0
9 Chhota Udepur 10 0 0 0 0 4 4 0 92 5
10 Dahod 10 1 0 0 0 5 3 0 103 1
11 Dang 0 0 0 0 0 3 1 0 29 0
12 Devbhumi
0 0 0 0 0 1 0 0 43 1
Dwarka
13 Gandhinagar 0 1 0 0 0 2 0 0 127 1
14 Gir-Somanath 0 0 0 0 0 3 1 0 45 1
15 Jamnagar 0 0 0 0 0 3 0 0 67 0
16 Junagadh 0 2 0 0 0 1 0 0 110 2
17 Kachchh 0 0 0 0 1 4 6 0 155 7
18 Kheda 0 3 0 0 0 3 0 0 83 1
19 Mahesana 0 1 0 0 0 1 0 0 149 2
20 Mahi Sagar 0 0 0 0 0 0 1 0 61 2
21 Morbi 0 4 9 0 2 1 0 0 80 2
22 Narmada 0 0 0 0 0 2 4 0 82 0
23 Navsari 0 0 0 0 0 6 2 0 110 1
24 Panchmahal 0 0 0 0 0 1 1 0 84 0
25 Patan 0 2 0 0 0 1 2 0 120 0
26 Porbandar 0 1 8 0 0 1 1 0 54 1
27 Rajkot 0 9 0 0 0 2 0 0 131 0
28 Sabarkantha 0 2 0 0 0 2 4 0 130 4
29 Surat 0 0 0 0 0 7 2 0 147 0
30 Surendranagar 0 6 7 0 0 2 0 0 131 13
31 Tapi 0 0 0 0 0 3 2 0 93 5
32 Vadodara 0 0 0 0 0 2 0 1 92 0
33 Valsad 0 0 0 0 0 4 2 0 71 1
34 Hitech Poly.-
0 0 0 0 0 0 0 0 341 0
Porbandar
Gujarat 41 45 31 2 5 85 45 2 3386 66
MADLAV = Mobile Animal Disease Diagnostic Laboratory Ambulance Van
RPVHC= Rural Primary Veterinary Heath Care Centres
164
14.4 Information of Court Cases related with the Department 2008-09 to 2017-18.
Sr. Year Details of the Cases Cases related to the courts Total
No. Supereme Gujarat District Labour Tribunal Accident Cases
Court High Courts Court Court Court
Court
1 2 3 4 5 6 7 8 9 10
1 2008-2009 Opening in the year 2 59 9 49 3 2 124
New Cases of the year 1 11 1 2 0 0 15
Cases Settled in the year 1 17 0 4 0 0 22
Pending at the end of the year 2 53 10 47 3 2 117
2 2009-2010 Opening in the year 2 53 10 47 3 2 117
New Cases of the year 1 7 2 2 2 0 14
Cases Settled in the year 0 5 1 10 0 0 16
Pending at the end of the year 3 55 11 39 5 2 115
3 2010-2011 Opening in the year 3 55 11 39 5 2 115
New Cases of the year 0 19 1 4 0 0 24
Cases Settled in the year 1 15 0 19 0 0 35
Pending at the end of the year 2 59 12 24 5 2 104
4 2011-2012 Opening in the year 2 59 12 24 5 2 104
New Cases of the year 1 6 0 1 0 1 9
Cases Settled in the year 2 16 1 7 0 1 27
Pending at the end of the year 1 49 11 18 5 2 86
5 2012-2013 Opening in the year 1 49 11 18 5 2 86
New Cases of the year - 18 1 2 0 - 21
Cases Settled in the year - 14 - - 0 - 14
Pending at the end of the year 1 53 12 20 5 2 93
6 2013-2014 Opening in the year 1 53 12 20 5 2 93
New Cases of the year - 14 2 2 - 2 20
Cases Settled in the year 1 14 1 5 2 - 23
Pending at the end of the year - 53 13 17 3 4 90
7 2014-2015 Opening in the year - 53 13 17 3 4 90
New Cases of the year - 16 - - - - 16
Cases Settled in the year - 8 - 2 - - 10
Pending at the end of the year - 61 13 15 3 4 96
8 2015-2016 Opening in the year - 61 13 15 3 4 96
New Cases of the year - 11 - - - - 11
Cases Settled in the year - 16 - 2 - 1 19
Pending at the end of the year - 56 13 13 3 3 88
9 2016-2017 Opening in the year - 56 13 13 3 3 88
New Cases of the year - 11 - - 1 - 12
Cases Settled in the year - 22 - - 3 - 25
Pending at the end of the year - 45 13 13 1 3 75
10 2017-2018 Opening in the year - 45 13 13 1 3 75
New Cases of the year - 2 - - - - 2
Cases Settled in the year - 9 - 1 - - 10
Pending at the end of the year - 38 13 12 1 3 67
165
166
167
168
15.1 Outlay and Expenditure on Animal Husbandry and Dairy Development in Gujarat State.
(Rs. In Lakhs)
1 2 3 4 5 6 7 8
1 Fourth Five Year Plan 675.00 175.00 850.00 432.48 96.31 528.79
1969 to 1974
2 Fifth Five Year Plan 755.00 247.00 1002.00 304.57 244.97 549.54
1974 to 1978
3 Annual Plan 514.00 116.00 630.00 496.14 355.10 851.24
1978-79 to 1979-80
4 Sixth Five Year Plan 1770.00 205.00 1975.00 1432.76 219.70 1652.46
1980-1985
5 Seventh Five Year Plan 1820.00 127.00 1947.00 1875.85 121.29 1997.14
1985-1990
6 Eighth Five 2610.00 270.00 2880.00 2745.02 191.51 2936.53
Year Plan
1990-95 Border Area 110.00 55.00 165.00 108.55 50.00 158.55
9 Ninth Five Year Paln 7450.00 530.00 7980.00 7655.58 437.81 8093.39
1997-98 to 2001-02
10 Tenth Five Year Plan 14339.84 848.92 15188.76 12635.53 813.72 13449.25
2002-03 to 2006-07
11 Eleventh Five Year Plan 51898.13 17200.00 69098.13 43556.56 17110.64 60667.20
2007-08 to 2011-12
(49426.33) (18513.59) (67939.92)
170
15.3 Provision and Expenditure on various programme on Animal Husbandry and Dairy
Development in Gujarat State (Revenue) : 2017-18 (Demand No.4 & 2 )
(Rs. In Lakh)
Sr. No. Programme Provision (Final Expenditure
Grant)
1 2 3 4
Total (C) 0 0
171
15.4 Rastriya Krushi Vikas Yojna (Animal Husbandry & Dairy Development).
(Rs. In Lakh)
Perticular 2012-13 2013-14 2014-15 2015-16 2016-17 2017-18 Total
Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure
Released Incurred Released Incurred Released Incurred Released Incurred Released Incurred Released Incurred Released Incurred
1 2 3 4 5 6 7 8 16 9 10 11 12 13 14
State 250.00 0.00 0.00 149.59 1639.23 1609.97 1701.51 1701.51 0.00 0.00 294.33 294.33 3885.07 3755.40
District 3016.00 2999.22 0.00 0.00 7765.88 4888.91 2805.67 2043.67 1046.00 1046.00 1862.20 1614.61 16495.75 12592.41
Total 3266.00 2999.22 0.00 149.59 9405.11 6498.88 4507.18 3745.18 1046.00 1046.00 2156.53 1908.94 20380.82 16347.81
172
(Rs. In Lakh)
Year 2012-13 Year 2013-14 Year 2014-15 Year 2015-16 2016-17 2017-18 Total
Perticular Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure Grant Expenditure
Released Incurred Released Incurred Released Incurred Released Incurred Released Incurred Released Incurred Released Incurred
1 2 3 4 5 6 7 8 16 9 10 11 12 13 14
State 322.98 210.34 392.21 365.89 480.63 393.49 692.06 692.06 1017.50 1053.42 1180.66 1180.66 4086.04 3895.86
Central 3730.79 2915.86 2416.30 2150.50 3961.08 2566.11 1048.39 2582.71 2980.28 2363.79 4153.83 2677.34 18290.67 15256.31
Total 4053.77 3126.20 2808.51 2516.39 4441.71 2959.60 1740.45 3274.77 3997.78 3417.21 5334.49 3858.00 22376.71 19152.17
173
174
16.1 Enrolment, In-take and no. of students Graduated in Veterinary Science
and Animal Husbandry, Gujarat State 2017-18.
Sr. No. Name of the college In-take Capacity No. of Students No. of Students
Gujarat State 15, enrolled during graduated
Candidates Payment the year during the
Seat year
1 2 3 4 5 6
1 College of Veterinary Science and
66
Animal Husbandry, A.A.U., Anand 59+7*+2#=68 0 68
(July-2017)
2 College of Veterinary Science and
Animal Husbandry, Sardar Krishinagar, 45
65+15%* 0 71
Dantiwada (July-2017)
3 Vanbandhu College of Veterinary
48
Science and Animal Husbandry, NAU , 65+12* = 77 0 72+4*+2#=78
(July-2017)
Navsari
4 College of Veterinary Science and
Animal Husbandry, Junagadh 35
51+9*+2#=60 0 236
(July-2017)
* Included Veterinary Council of India-New Delhi (VCI) seats for students of other state.
# Jammu & Kashmir Seats for their students.
175
16.3 No. of Students Turn-out in Post Graduate 2017-18.
Sr. No. Description No. of Students Passed
M.V.Sc. Ph. D.
1 2 3 4
2 Veterinary Microbiology 4 0
3 Animal Nutrition 4 0
7 Veterinary Pathology 8 3
12 Animal Bio-Technology 1 0
13 Poultry Science 0 0
15 Veterinary Parasitology 0 0
16 Veterinary Physiology 1 0
Total 74 4
176
177
178
A-1 Human Population Census-2011 & Livestock Products : 2017-18(P) of
Gujarat State Comparision with India 2011
Sr. Particulars Unit Gujarat India % Share
No. of State
1 2 3 4 5 6
AREA
I
1.1 AREA [As per Census - 2001] Sq. Km. 196024 3287263 5.96
POPULATION CENSUS - 2011
2.1 Total Population ‘000 60439 1210570 4.99
(a) Males ‘’ 31491 623122 5.05
(b) Female ‘’ 28948 587448 4.93
(c ) Rural ‘’ 34695 833463 4.16
(d) Urban ‘’ 25745 377106 6.83
(e) % of Rural Population ‘’ 57.4 68.8 -
(f) % of Urban population ‘’ 42.6 31.2 -
2.2 Decadal Growth Rate 2001-11 (P)
(a) Total % 19.3 17.7 -
(b) Rural ‘’ 9.3 12.3 -
(c ) Urban ‘’ 36.0 31.8 -
II
2.3 Districts Nos. 26 640 4.06
2.4 Talukas ‘’ 225 5924 3.80
2.5 Towns
(a) Statutory Towns Nos. 195 4041 4.83
(b) Census Towns ‘’ 153 3892 3.93
(c ) Villages (includes uninhabilated villages) ‘’ 18225 640930 2.84
2.6 Density of Population ‘’ 308 382 -
2.7 Sex ratio - Females per 1000 Males
(a) Total Nos. 919 943 -
(b) Rural ‘’ 949 949 -
(c ) Urban ‘’ 880 929 -
(d) Child Population in the Age Group (0-6 Yr.) ‘’ 890 919 -
Livestock Products : 2017-18(P)
179
A-2 Veterinary Institutions 2013 - 2014.
Sr. No. District Polyclinic 9'%9' FAVC MVD Total Total Livestock Units ADIO
Veterinary
Per Live stock Per Vet.
Institutions
Census-2012(P) Institutions
1 2 3 4 5 6 7 8 9 10
1 Ahmedabad 1 31 19 1 52 666024 12808 1
2 Amreli 1 33 24 0 58 868264 14970 1
3 Anand 1 20 20 0 41 755287 18422 0
4 Banaskantha 1 62 27 3 93 2177406 23413 1
5 Bharuch 1 19 25 1 46 278014 6044 1
6 Bhavnagar 1 33 23 1 58 852147 14692 1
7 Dahod 1 19 23 3 46 1132483 24619 1
8 Dang 0 6 9 1 16 107960 6748 0
9 Gandhinagar 1 23 13 0 37 504800 13643 0
10 Jamnagar 1 34 23 0 58 711329 12264 1
11 Junagadh 1 49 12 1 63 1081527 17167 1
12 Kachchh 1 32 29 6 68 1065885 15675 1
13 Kheda 1 21 21 0 43 1088174 25306 0
14 Mahesana 1 33 20 0 54 841950 15592 1
15 Narmada 0 14 16 4 34 264933 7792 0
16 Navsari 1 17 15 2 35 365499 10443 1
17 Panchmahal 1 38 35 2 76 1474657 19403 0
18 Patan 1 29 15 2 47 519813 11060 0
19 Porbandar 1 11 7 1 20 231005 11550 0
20 Rajkot 1 37 25 0 63 1055172 16749 1
21 Sabarkantha 1 45 37 7 90 1495335 16615 1
22 Surandranagar 1 33 15 0 49 616203 12576 1
23 Surat 1 18 25 2 46 1005788 21865 1
24 Tapi 0 10 26 2 38 421849 11101 0
25 Vadodara 1 25 31 4 61 1349224 22118 1
26 Valsad 1 10 17 2 30 344058 11469 1
Total 23 702 552 45 1322 21274785 16093 17
th th
N.B. : Column no. 8 & 9 are based on 19 livestock census-2012 (P) and 19 livestock census has been
conducted in old 26-Districts of Gujarat State. So , information of veterinary institutions year
: 2013-14 has been indicated in this table.
---------------------
GOVERNMENT CENTRAL PRESS, GANDHINAGAR
180
!"#
$
% &
'