Vous êtes sur la page 1sur 6

IJliS SYNTHÈSE

médecine/sciences 1 992 ; 8 : 134-9

Le transport des protéines


dans le noyau : les signaux
de localisation nucléaire
et leurs récepteurs

Les protéines nucléaires, synthétisées dans le cytoplasme


comme toutes les protéines, sont adressées au noyau
grâce à un signal de localisation nucléaire (NLS, nuclear
localisation signal) constitué d'une courte séquence d' aci­
des aminés basiques, parfois bipartite . Le NLS est
reconnu par des protéines spécifiques - dont les nucléo­
porines - et, peut-être par leur intermédiaire , se fixe
aux pores de la membrane nucléaire . En présence d'ATP,
la protéine est alors transloquée dans le noyau, peut­
être grâce aux propriétés contractiles des nucléoporines .

a diversité des réactions contrôle de la translocation nucléaire

L
V al érie Schreiber biochimiques dans le noyau des protéines au niveau de la régula­
nécessite le passage d ' un tion de la transcription génique, à
Gilbert de Murcia
grand nombre de macromo­ l'article de synthèse de M . Piechaczyk
Josiane Ménissier­ lécules à travers la mem- et P . Roux, paru dans médecine/
de Murcia brane nucléaire. Elle sépare les fonc­ sciences [ 1 ] .
tions de réplication et de transcription L'enveloppe nucléaire est constituée
de 1 'ADN, de la fonction de traduc­ d'une membrane externe, en conti­
tion des ARN en protéines. L ' avan­ nuité avec les membranes du réticu­
tage sélectif dû à la présence de la lum endoplasmique, et d 'une mem­
membrane nucléaire permet, en con­ brane interne, associée aux lamines,
trôlant l'importation de protéines, protéines présentes dans la matrice
d'obtenir de rapides et fines modifi­ nucléaire servant de points d'ancrage
cations de concentration de celles-ci. à la chromatine [2] . Ces deux mem­
Par exemple, certains facteurs protéi­ branes sont fusionnées au niveau des
ques qui existent en faible quantité pores nucléaires, structures supra­
dans la cellule, comme les facteurs de moléculaires constituées de plus d'une
régulation de la réplication et de la centaine de protéines différentes .
transcription, doivent être impérative­ L'observation des pores au micro­
ment présents dans le noyau en fonc­ scope électronique couplé au traite­
ADRESSE ------ tion de la progression du cycle cellu­ ment d'images a permis d'obtenir des
V . Schreiber : allocataire de recherche Mrt. G . laire ou en réponse à un signal exté­ clichés de haute résolution : suivant
d e Murcia : directeur de recherche a u Cnrs. rieur. Dans cette revue , nous résu­ un axe perpendiculaire à la surface
J . Ménissier-de Murcia : chargée de recherche mons les connaissances actuelles con­ de l 'enveloppe nucléaire, le pore
au Cnrs . Institut de biologie moléculaire et cernant les signaux de localisation nucléaire présente une symétrie rota­
cellulaire du Cnrs associé à l'université
Louis-Pasteur, laboratoire de biochimie I I , nucléaire et leurs récepteurs. Nous tionnelle d'ordre 8 . Il se compose de
1 5, rue René-Descartes, 67084 Strasbourg renvoyons les lecteurs désireux de deux anneaux (l'un du côté du cyto­
Cedex, France. s 'informer sur les conséquences du plasme, 1 ' autre dirigé vers 1' intérieur
1 34 mis n ° 2, vol. 8, février 92
1 1
du noyau) reliés à un corps central
par un ensemble de spicules. En
G
Cytoplasme
réponse à un signal, ces anneaux se
déformeraient et s'ouvriraient à la

�� L
Réticulum endoplasmique
manière d'un double iris de diaph­

i)
ragme [3, 4] . Le transport de macro­
molécules à travers le pore nucléaire �� �
est bidirectionnel : entrée spécifique
de protéines et sortie de sous-unités
-;::pr) Pore nucléaire

préribosomiques, de ribonucléoprotéi­ 2 A: � Membrane nucléaire


externe
nes et d' ARNt (pour une revue
Membrane nucléaire
voir [5]) (figure 1). Ces pores fonction­ interne
nent comme des tamis moléculaires :
Nucléosq uelette
ils permettent le passage par diffusion (lamines)
passive de petites molécules comme
les solvants et les ions. Théorique­
ment, les protéines de masse infé­
rieure à 40-60 kDa peuvent diffuser ions
passivement à l'intérieur du noyau . métabolites
Cependant de petites protéines, petites protéines
comme les histones dont la synthèse
et la présence dans le noyau sont
requises en phase S du cycle cellu­
laire, bénéficient d'un mécanisme de
transport facilité, ce qui accroît con­
sidérablement l 'efficacité de leur pas­
sage dans le noyau. Ce même trans­
port actif est mis en jeu lors du pas­
sage dans le noyau de protéines de
masse supérieure. Ce mécanisme est
décomposé en deux étapes : ( 1) la T �

1
Protéine d'ancrage


reconnaissance spécifique par un
récepteur d'un signal de localisation
nucléaire (NLS * : nuclear localization
signal) présent sur la protéine à Figure 1 . Schéma illustrant les différentes étapes qui régissent les échan­
importer ; (2) la translocation à tra­ ges entre le cytoplasme et le noyau. Après synthèse dans le cytoplasme,
vers la membrane nucléaire ; cette la protéine caryophile est transportée dans le noyau. Plusieurs étapes peuvent
étape requiert une température régir son transport : la protéine peut être retenue dans le c ytoplasme par une
physiologique et consomme de protéine d'ancrage ( 1) ; après dissociation du complexe sous l'effet de facteurs
l'ATP [6] . cytoplasmiques, la protéine se lie à un récepteur-transporteur (NBP, NLS-binding
Il faut noter que la présence d'un protein) (2) ou directement aLi pore nucléaire (2'). Le récepteur se dissocie de
la protéine sur le pore nucléaire qui la transporte dans le noyau (3), ou c 'est
NLS sur la protéine caryophile est le complexe protéine-récepteur qui est entièrement transporté dans le noyau (3')
nécessaire, mais pas suffisante, pour où il se dissocie (4). Le récepteur peut être recyclé dans le cytoplasme (récep-
·
assurer son passage dans le noyau : ûwr navette) (5) ou dégradé.
en effet, le signal peut être enfoui
dans la macromolécule ou masqué
par sa fixation à une protéine (pro­
téine d'ancrage, voir figure 1). Une
modification conformationnelle de la De nombreuses expériences ont sug­ gine nucléaire, micro-injectée dans le
protéine à importer (phosphorylation, géré !'.existence des NLS. Nous don­ cytoplasme des oocytes de Xenopus lae­
liaison à un effecteur . . . ) ou de la pro­ nerons ci-dessous quelques exemples vis s'accumule dans le noyau [9] . En
téine d'ancrage rend le NLS fonction­ qui illustrent ce fait . revanche, la nucléoplasmine protéo­
nel [ 7 ] . - En 1 9 75, Bonner [ 8 ] micro-injecte lysée, tronquée de son extrémité C­
des protéines d'oocytes de Xenopus lae­ terminale, est exclue du noyau, alors
vis dans des oocytes intacts : les pro­ que ce fragment C-terminal micro­
• Abréviations. NLS : signal tÙ localisation
nucléaire ; NEP : récepteurs tÙs protéines à NLS ;
téines d'origine nucléaire sont trans­ injecté dans le cytoplasme est trans­
RPN : ribonucléoprotéines ; A/a � A ; A rg � R ; portées dans le noyau, tandis que les porté rapidement dans le noyau . Ces
A sn � N ; Asp � D ; Cys � C ; Gin � Q ; protéines d'origine cytoplasmique res­ résultats ont suggéré l 'existence d 'un
Glu � E ; Gly � G ; His � H ; Ile � I ; tent localisées dans le cytoplasme . signal de localisation nucléaire dans
Leu � L ; Lys � K ; Met � M ; Phe � F ;
Pro � P ; Ser � S ; Thr � T ; Trp � W ; - En 1 982, Dingwall montre que la l ' extrémité C-terminale de la nucléo­
Tyr � Y : Val � V nucléoplasmine, une protéine d'ori- plasmine.
mis n ° 2, vol. 8, jévriu 92 1 35
RÉFÉRENCES - Les 1 3 résidus N-terminaux de la dées de glycine ou de praline (acides
protéine de levure Mata2 suffisent, aminés permettant la formation d'un
1 . Piechaczyk M , Roux P. Le contrôle de
la translocation nucléaire des protéines : un lorsqu ' ils sont fusionnés à la {3- coude dans la séquence peptidique, ce
niveau supplémentaire de régulation de galactosidase, à cibler la protéine chi­ qui pourrait contribuer à la bonne
l'activité des gènes. médecine/sciences 1 990 ; 6 : mérique vers le noyau [ 1 0 ] . orientation du NLS vers l'extérieur
803-6 .
- Kalderon e t ses collaborateurs [ 1 1 ] de la protéine). Ils peuvent être loca­
2 . Nelson WG, Pienta KJ , Barrack ER,
ont démontré que la séquence ( 1 26) lisés à tout endroit de la protéine,
Coffey DS. The role of the nuclear matrix
in the organization and function of DNA. PKKKRKV ( 1 32) dans l'antigène T toutefois ils se situent toujours dans
Ann Rev Biophys Chem 1 986 ; 15 : 457-75. du virus SV40, fusionnée à la pyru­ des zones hydrophiles [ 1 6] et, le cas
3 . Stewart M, Whytock S, Mills A. Asso­ vate kinase permet le ciblage de la échéant, dans des régions charnières
ciation of gold-labelled nucleoplasmin with protéine recombinante dans le noyau . séparant les domaines des protéines
the centres of ring components of Xenopus De plus, la mutation de la lysine en multifonctionnelles. On admet que
oocytes nuclear pore complexes. J Mol Biol
position 1 28 abolit totalement la ces signaux sont situés à la surface de
1 990 ; 2 1 3 : 5 75-82 .
caryophilicité de la protéine [ 1 1 , 1 2 ] . la protéine nucléaire permettant ainsi

1 leur reconnaissance par un récepteur.


4. Akey CW. Visualization of transport­
related configurations of the nuclear porc
transporter. Biophys j 1 990 ; 58 : 34 1 -55. Les signaux De plus, la présence d'un site
hydrolysé par la trypsine au cœur de
5 . Goldfarb D, Michaud N . Pathways for de localisation nucléaire
the nuclcar transport of protcins and RNAs. la séquence du NLS de la poly(ADP­
Trends Cel! Biol 1 99 1 ; 1 : 20-4. Pour caractériser un NLS, deux ribose )polymérase (lysine 223) con­
6. Newmeyer DD, Forbcs DJ . Nuclear approches complémentaires ont été firme la localisation de ce NLS à la
import can be separated into distinct steps
développées. La première est une surface de la protéine (Schreiber et
in vitro : nuclcar pore binding and trans­
location. Cel! 1 988 ; 52 : 64 1 -53. approche << sous trac t ive " •dans al. , en préparation). Enfin, les NLS,
7 . Hunt T. Cytoplasmic anchoring protcins laquelle le NLS hypothétique est soit à la d i fférence des peptides
and the control of nuclear localization. Cel! délété, soit muté ponctuellement afin N H2-terminaux existant dans les
1 989 ; 59 : 949-5 1 . de montrer qu ' il est nécessaire à la séquences des protéines à excréter, ne
8 . Banner WM. Protein migration into localisation nucléaire de la protéine . sont pas clivés suite à la localisation
nuclei. I I . Frog oocyte nuclei accumulate a La seconde approche est dite addi­ << nucléaire de la protéine .
class of microinjectcd oocyte nuclear proteins
and excludc a class of microinjccted cyto­ tive , : elle consiste à coupler le NLS Bien que la fonction de ciblage et de
plasmic protcins. J Cel! Biol 1 975 ; 64 : putatif à une protéine indicatrice translocation des protéines puisse être
43 1 - 7 . cytoplasmique afin de montrer qu ' il assurée par un seul signal, ressem­
9 . Dingwall C , Sharnick S V , Laskey RA. est suffisant pour 1 'adressage de la blant au NLS de l ' antigène T de
A polypeptide domain that specifies migra­ protéine dans le noyau. Ce couplage SV40 (Tableau lA), certaines protéines
tion of nucleoplasmin into the nucleus. Cel!
1 982 ; 30 : 449-58.
peut être effectué soit par greffage nucléaires contiennent plusieurs NLS
10. Hall MN, Hereford L, Herskowitz I.
chimique d'un peptide synthétique (Tableau lB). Par exemple, l ' anti­
Targeting of E. coli /J-galactosidase to the correspondant au NLS putatif sur la gène T du virus du polyome possède
nucleus in yeast. Cel! 1 984 ; 36 : 105 7-65 . protéine indicatrice, soit par fusion de deux NLS qui coopèrent pour per­
1 1 . Kalderon D, Richardson WD, Mark­ la séquence oligonucléotidique corres­ mettre l'entrée de la protéine dans le
ham AF, Smith AE. Sequence requirements pondante, avec le gène codant pour noyau [ 1 7] ; la caryophilicité de la
for nuclear location of simian virus 40 (arge­ la protéine indicatrice. Ces construc­ protéine n'est abolie qu' après muta­
T antigen. Nature 1 984 ; 3 1 1 : 499-509.
tions sont alors introduites dans les tion simultanée des deux signaux.
1 2 . Lanford RE, Butel JS. Construction
and characterization of an SV40 mutant cellules soit par micro-injection, soit Dans ce cas, la présence de deux
defective in nuclear transport of T antigen. par transfection de l'ADN recombi­ signaux fonctionnels permet à la pro­
Cel! 1 984 ; 3 7 : 80 1 - 1 3 . nant. La localisation de la protéine téine virale de rentrer plus rapide­
1 3 . Silver P , Goodson H . Nuclear protein recombinante mi cro- i nj ectée ou ment dans le noyau . Par ailleurs, il
transport . Gril Rev Biochem Mol Biol 1 989 ; synthétisée in vivo peut être détectée avait déjà été montré par greffage
24 : 4 1 9-35.
par immunolluorescence, par une chimique de NLS sur une protéine
14. Roberts B . Nuclear location signal­
mediated protein transport. Biochim Biophys
réaction histochimique, par micro­ indicatrice, que la vitesse d ' accumu­
Acta 1 989 ; 1 008 : 263-80. scopie électronique ou encore par lation dans le noyau est proportion­
1 5 . Garcia-Bustos J , Heitman J, Hall M N . fractionnement subcellulaire . Un nelle au nombre de peptides greffés
Nuclear protein localization. Biochim Biophys exemple d'approche additive est illus­ [ 18] . Enfin, la réitération d'un signal,
Acta 1 99 1 ; 1 0 7 1 : 83- 1 0 1 . tré figure 2, p. 138. même partiellement défectueux dans
1 6 . Roberts B L , R ichardson W D ,
Depuis 1 984, de nombreux N LS ont le transport, peut être suffisante pour
Smith AE. The effect o f protein context on
nuclear location signal function. Cel! 1 987 ; été étudiés (pour une revue voir [ 1 3 , promouvoir l'accumulation de la pro­
50 : 465-75. 1 4 , 1 5]). Leurs séquences peptidiques téine dans le noyau [ 16]. Ces résul­
1 7 . R ichardson W D , Roberts B L , sont rassemblées dans le Tableau /. tats indiquent que la multiplication
Smith A E . Nuclear location signais in Aucune séquence consensus n'émerge de N LS faiblement actifs sur une
polyoma virus large-T. Cel! 1 986 ; 44 : de la comparaison de ces différents protéine peut avoir un effet positif
77-85.
NLS. Cependant, en règle générale, dans le routage des protéines dans le
18. Lanford RE, Kanda P , Kennedy P .
les NLS sont constitués de séquences noyau .
Induction of nuclear transport with a synthe­
tic peptide homologous to the SV40 antigen basiques (riches en lysine et arginine) D'autres protéines possèdent plusieurs
transport signal. Cel! 1 986 ; 46 : 57 5-82 . de 5 à 8 résidus, fréquemment bor- NLS non équivalents. Ainsi, d'après
1 36 mis n ° 2, vol. 8, jévriir 92 .
Tableau 1

LES SIGNAUX DE LOCALISATION N U C LÉAI RE

A. Protéines possédant un NLS unique Références

SV 40 antigène-T ( 1 23) STPPKKKRKVEDP [ 1 5]


Adénovirus E 1 A (279) PLDLSCKRPRP-(COOH) [ 1 5]
h . lamine A ( 4 1 2) GGGSVTKKRKLEST [ 1 5]
SV40 VP1 (1 ) (NH2)-APTKRKGSCPGAAP [ 1 5]
h . PDGF chaîne A ( 1 92) DTG RPRESGKKRKRKRLKPT-(COOH) [ 1 5]
Adénovirus pTP ( 3 1 7) FVDRLPVRRRRRRVPPPP [ 1 5]
d . sryo ( 1 78) KSSDG EDRPTKKRVKQECTT [ 341
1 . histone 28 ( 24) STSTDGKKRSKARKE [ 1 5]

B. Protéines possédant 2 NLS

1. protéine ribosomique L29 (1 ) ( NH2)-PSRFTKTRKHRGH ( 1 4) KGRIG KHRKHPGG [ 1 5]


1 . MATa2 (1 ) ( NH2)-M N KIPIKDLLNPQ ( 1 40) VRILESWFA K N I [ 1 5]
h. c-MYC ( 3 1 7) KDYPAAKRVKLDSV (36 1 ) VLERORRN ELKRSF [ 1 5]
virus du polyome antigène-T ( 1 86) RTPVSRKRPRPAGA (277) ATPPKKAR E D PAP [ 1 5]

C. Protéines possédant un NLS bipartite

x . nucléoplasmine ( 1 49 ) SPPKAVKRPAATKKAGQAKKKKLDKEDES [ 1 51
x. N 1 ( 528) SH LVRKKRKTEEESPLKDKDAKKSKQEPV [ 1 5]
h . poly(ADP-ribose) polymérase ( 20 1 ) GVKSEGKRKGDEVDGVDEVAKKKSKKE K D K DS [x]
m . KI N 1 7 ( 234) GSAASGKRKESSQSSAQPAKKKKSALD E I M E L [ 23]
* m . p53 ( 2 9 6) LPPGSAKRALPTCTSASPPQKKKPLDGEY [21]
* h . p53 (299) LPPGSTKRALPNNTSSSPQPKKKPLDGEY [21 1
* m . c-ABL ( 58 7 ) RLLPRDRKTN LFSALIKKKKKMAPTPPKRS [ 1 5]
* x . N038 ( 1 36) PSPKNAKRIAPDSASKVPRKKTRLEEEEE [2 1 ]
* la . récepteur des progestérones ( 620) CPACRLRKCCQAGMVLGGRKFKKFNKVRV [ 1 5]
* r. récepteur des glucocorticoïdes (492) CPACRYRKCLQAGMNLEARKTKKKIKGIQQATAG [ 1 5]

Abréviations : m : murin ; r : rat ; 1 : levure ; h : humain ; la : lapin ; d : drosophile ; x : xénope.


Les motifs basiques sont représentés en gras. Les séquences soulignées suffisent à promouvoir l'accumulation dans le noyau d'une protéine traceur.
Il n 'a pas été montré que les protéines marquées d'un ( *) possèdent un NLS bipartite, mais leur séquence primaire le suggère.
/x] : Schreiber et a l . , en préparation.
Les chiffres entre parenthèses indiquent la position dans la protéine de la séquence donnée.

les travaux récents de Hall et al. [ 19], localisé entre les domaines de fixation basiques diminue, mais n ' abolit pas
la protéine Matcâ, déjà citée, con­ à l'ADN (domaine C) et de liaison à complètement, la localisation nucléaire
tiendrait deux NLS : une séquence l'hormone (domaine E), est fonction­ de la protéine : en revanche, la muta­
N-terminale, initialement décrite, per­ nel dans un récepteur dont le tion simultanée des deux motifs rend
mettant la fixation à la membrane domaine E a été délété. Cette pro­ la protéine cytoplasmique. Le NLS
nucléaire et une séquence localisée téine mutée est toujours nucléaire, de la protéine N1 de Xenopus laevis est
entre les résidus 1 40 et 1 5 1 , fonction­ même en absence d 'hormone. également bipartite ; sa séquence est :
nelle en l'absence de la première, res­ Enfin, une nouvelle classe de NLS a (532) RKKRK-X1 2 -KKSK ( 5 5 2 ) .
ponsable de la translocation de la été récemment définie : les NLS L a mutation d e l a lysine 5 3 4 o u 549
protéine dans le noyau. Un autre bipartites ( 2 1 ] (Tableau IC). II s' agit abolit la fonction du signal de locali­
exemple est illustré par les récepteurs de signaux constitués de deux motifs sation nucléaire [ 2 2 ] . Autre exemple,
des hormones glucocorticoïdes qui basiques interdépendants. Ces motifs celui de la poly(ADP-ribose)polymé­
possèdent un NLS inductible et un de deux à six résidus sont séparés par rase humaine, enzyme associée aux
autre constitutif. Le signal inductible une dizaine d'acides aminés. De mécanismes de réparation de l 'ADN ,
est localisé dans le domaine de fixa­ courtes insertions ou délétions dans la dans laquelle les deux séquences basi­
tion de l'hormone [20] . En absence région séparant ces motifs basiques ques ( 2 06) KRK-X1 1 -KKKSKK
de glucocorticoïdes, le récepteur est peuvent être tolérées. Mais aucune (226) sont également requises pour le
cytoplasmique ; la fixation de l ' hor­ des deux régions prises séparément ciblage de la protéine dans le noyau
mone impose une modification con­ n'est capable d'assurer le transport de et incapables de fonctionner séparé­
formationnelle telle que le NLS la protéine dans le noyau . Dans la ment. Dans cette enzyme, les résidus
dépendant de l'hormone démasqué nucléoplasmine de Xenopus laevis, la basiques 207, 208 et 222 sont impor­
devient fonctionnel et que le com­ séquence du NLS est : ( 1 55) KR­ tants pour le fonctionnement du NLS
plexe récepteur-glucocorticoïde migre X10 -KKKK ( 1 70). Une mutation (Schreiber et al. , en préparation) . La
dans le noyau . Le NLS constitutif, ponctuelle dans chacun des motifs protéine KIN 1 7 , protéine murine ---•

mis n ° 2, vol. 8, jivrier 92 1 37


RÉFÉRENCES
1 9 . Hall M N , Craik C , Hiraoka Y .
Homeodomain o f yeast repressor a2 con­
tains a nuclear localization signal. Proc Nat{
Acad Sei USA 1 990 ; 87 : 6954-8.
20. Picard D, Yamamoto KR. Two signais
mediate hormone-dependent nuclear locali­
zation of the glucocorticoid receptor. EMBO
J 1 987 ; 6 : 3333-40.
2 1 . Robbins J, Dilworth SM, Laskey RA,
Dingwall C . Two interdependent basic
domains in nucleoplasmin nuclear targeting
sequence : identification of a class of bipar­
tite nuclear targeting sequence. Cel/ 1 99 1 ;
64 : 6 1 5-23.
22. Kleinschmidt JA, Seiter A . Identifica­
tion of domains involved in nuclear uptake
and histone binding of prote in N 1 of Xena­
pus laevis oocytes. J Biol Chem 1 988 ; 7 :
1 605- 1 4 .
2 3 . Angulo JF, Rouer E , Mazin A , e t al.
Identification and expression of the eDNA
of KIN 1 7 , a zinc-fin ger gene located on
mouse chromosome 2, encoding a new
DNA-binding protein. Nue/tic Acids Res
1 99 1 ; 19 : 5 1 1 7-23 .
2 4 . Shaulsky G, Goldfinger N, Ben­
Ze'ev A, Rotter V. Nuclear accumulation of Figure 2 . Mise en évidence d'un signal de localisation nucléaire par appro­
p53 protein is mediated by severa! nuclear che additive. La séquence nucléotidique codant pour le NLS de l'antigène T
localization signais and plays a role in
de S V40 [( 1 25)PPKKKRKVEDP( 1 35)J a été clonée en phase avec le gène
tumorigenesis. Mol Cel/ Biol 1 990 ; 10 :
6565-7 7 . codant pour la /3-galactosidase, dans le vecteur d'expression eucaryotique
25. Diller L, Kassel J , Nelson C E , e t al. pCH 1 1 0 (Pharmacia). Des cellules Hela ont été transfectées, soit par le vec­
p53 functions as a. cell cycle control protein teur pCH 1 1 0, soit par le vecteur recombinant appelé pCH SV NLS. La locali­
in osteosarcomas. Mol Cel/ Biol 1 990 ; 10 : sation de la /3-galactosidase est révélée par son activité enzymatique, en utili­
5772-8 1 . sant le X-gal comme substrat, ce qui engendre une coloration bleue. La /3-
26. Rihs HP, Jans DA, Fan H , Peters R . galactosidase est localisée dans le cytoplasme des cellules transfectées par
The rate o f nuclear cytoplasmic transport i s le vecteur pCH 1 1 0 (figure 2A). La protéine chimérique a été ciblée dans le
determined b y the casein kinase II site flan­
noyau des cellules transfectées par pCH S V NLS (figure 2 8 ) .
king the nuclear localization sequence of the
SV40 T-antigen. EMBO J 1 99 1 ; 1 0 : 633-9.
27. Adam SA, Lob! TJ , Mitchell M ,
Gerace L . Identification o f specifie binding
proteins for a nuclear location sequence.
Nature 1 989 ; 337 : 276-9.
28. Adam SA, ·Gerace L. Cytosolic proteins
that specifically bind nuclear location signais sérologiquement reliée à la protéine à 39 résidus en amont de la première
are receptors for nuclear import. Cel/ 1991 ; bactérienne RecA, possède également mutation. Ce dernier changement
66 : 837-47. n'ayant probablement pas d'effet sur
29. Yoneda Y , lmamoto-Sonobe N , Mat­
un NLS calqué sur ce modèle [ 23 ] .
suoka Y, lwamoto R, Kiho Y, Uchida T . A posteriori, i l apparaît maintenant le phénotype de la protéine mutée,
Antibodies t o Asp-Asp-Glu-Asp can inhibit que de nombreux signaux de locali­ les protéines p53 seraient donc poten­
transport of nuclear proteins into the sation nucléaire , précédemment tiellement des protéines à NLS bipar­
nucleus. Science 1 988 ; 242 : 2 75-8. tite.
30. Finlay DR, Forbes DJ . Reconstitution décrits comme étant constitués d 'un
of biochemically altered nuclear pores : seul motif basique rappelant le NLS Des études cinétiques ont été effec­
transport can be eliminated and restorcd. de l'antigène T de SV40, possèdent tuées pour le NLS de 1' antigène T de
Cel/ 1 990 ; 60 : 1 7-2 7 . en fait un NLS bipartite. Ainsi, le SV40 [26] . L'accumulation dans le
3 1 . Dingwall C . Transport across the
nuclear envelope : enigmas and explana­ suppresseur de tumeur p53 de souris noyau, d'une protéine chimérique
tions. BioEssays 1991 ; 1 3 : 2 1 3-8. possède un signal en position 3 1 3-3 18 comportant ce NLS (résidus 1 26- 1 34)
32 . Nehrbass U , Kern H, Mutvei A, indispensable à la localisation passe de 1 5 heures à 8- 1 0 minutes
Horstmann H , Marshallsay B , Hurt EC. nucléaire de la protéine [ 24] . Dans lorsque le NLS est flanqué de sa
NSP 1 : a yeast nuclear envelope protcin
localized at the nuclear pores exerts its cette séquence, la lysine 3 1 6 est région N-terminale, c'est-à-dire des
essential function by its carboxy-terminal essentielle à cette fonction. Dans la résidus 1 1 1 à 1 25 . Cette région com­
domain . Cel/ 1 990 ; 61 : 979-89. protéine humaine de séquence très porte quatre sites de phosphorylation .
33. Starr C M , Hanover JA. A common proche, une double mutation rend la C 'est la phosphorylation par la
structural motif in nuclear pore proteins
(nucleoporins). BioEssays 1 9 9 1 ; 13 : 1 45-6. protéine mutée cytoplasmique [25] ; caséine kinase II des sérines 1 1 1 et
34. Noselli S , Vincent A . A Drosophila l 'une des mutations porte sur une 1 1 2 qui entraîne une augmentation de
nuclear localization signal included in a lysine située en position - 1 2 par la vitesse de transport. On peut cons­
1 8 amino acid fragment from the sercndi­ rapport au motif basique principal, tater dans le Tableau 1 que les NLS
pity o zinc linger protein . FEBS Lett 1 99 1
280 : 1 67-70. l'autre concerne une glycine localisée possèdent généralement des résidus
1 38 mis n° 2, vol. 8, février 92
susceptibles d'être phosphorylés à nelles, ne sont plus capables d'assu­
proximité de leurs séquences basiques. rer le transport de protéines [30] . Ces Summary

1 Les récepteurs
des protéines nucléaires
expériences illustrent bien le rôle
déterminant des nucléoporines dans
ce processus. Récemment, les ADNe
Nuclear protein transport :
nuclear localization signais and
their receptors
codant pour trois nucléoporines ont
La caractérisation biochimique et été clonés chez le rat (nucléo­
fonctionnelle des récepteurs des NLS porine p62) et chez la levure (NUP1 Nuclear pore complexes provide
(NBP* : NLS-binding proteins) est une et NSP 1) (pour une revue voir [ 3 1 ]). the route by which nuclear pro­
des clés majeures du mécanisme qui Ces protéines sont organisées en dif­ teins travel from the cytoplasm to
régit le transport des protéines dans férents domaines dont l'un est proba­ the nucleus of a cell. Proteins are
le noyau . Le modèle le plus simple blement structuré en hélice a . Des translocated to nucleus because
prévoyait que les NBP étaient associés études de mutants de NSP1 ont mon­ they contain one or more short se­
aux pores nucléaires, mais de nom­ tré que cette région en hélice a est quences of basic amino acids
breux travaux récents ont montré que essentielle pour assurer la transloca­ which act as nuclear location sig­
les récepteurs sont des protéines tion des protéines dans le noyau [32]. nal (NLS). In this paper we
navettes que l'on peut détecter dans Ce domaine porte des motifs répétés describe the partition of the NLS­
le cytosol et dans des extraits nucléai­ particuliers, caractéristiques des pro­ containing proteins into three
res [27, 28] . Le transport s 'effectue­ téines filamenteuses ; en effet, des different classes - (i) the SV
rait en plusieurs étapes ; la première motifs similaires de sept résidus sont large T-like proteins, (ii) proteins
consisterait en la fixation de la pro­ présents dans des régions en hélice a having two or more independent
téine à importer sur un récepteur de la myosine, de la tropomyosine et targeting signais and (iii) those
cytoplasmique (voir figure 1). Le com­ containing a bipartite NLS. Pro­
de la kératine. Les protéines assurant
plexe récepteur-protéine serait alors teins to be imported into the
le transfert des protéines dans le
reconnu par un système assurant le nucleus associate with the nuclear
noyau pourraient donc également
transport, localisé au centre du pore pore complexes, possibly via NLS­
adopter une structure filamenteuse.
nucléaire et responsable de la trans­ binding proteins (NBP) . NBPs
Cette observation est en faveur de
location du complexe dans le noyau. comprise a class of glycoproteins :
1 ' idée que les protéines nucléaires
Le complexe serait alors dissocié et le the nucleoporins and, to date, the
récepteur libre pourrait être recyclé seraient transloquées dans le noyau
par un mécanisme mettant en jeu la cDNAs of three such proteins have
dans le cytoplasme ou dégradé. been cloned and each shown to
contraction consommant de l 'énergie
Initialement, les NBP potentiels ont (comme dans le cas de la myosine) have a common structural motif
été détectés par l'utilisation des de ces protéines filamenteuses [33]. containing heptad repeat unit. In
méthodes d'affinité : addition we address the possible
- marquage par des peptides de
synthèse portant des séquences NLS
1 Conclusion function and organization of the
NBP-like proteins in the nuclear
documentées [27] ; Les signaux de localisation nucléaire pore complexes of the ceU..
- immunodétection par un anticorps portés par la protéine à importer
dirigé contre la séquence DDDED dans le noyau ont été découverts et
[29] supposée portée par le récepteur leurs séquences abondamment décri­
reconnaissant le NLS de l'antigène T tes. Mais il reste, aujourd'hui, diffi­
de SV40 (KKKRK). cile de comprendre, sur la simple
De cette façon, plusieurs NBP ont été base des données de la séquence pep­
décrits et caractérisé s . Certains tidique, comment un (ou des) récep­
devraient joUer un rôle dans la trans­ teur(s) protéique(s) reconnaissent une
location des protéines ; en particulier, si grande variété de NLS. L'étude
la famille des nucléoporines, glyco­ structurale fine de ces séquences Remerciements
protéines portant des groupements N­ devrait nous renseigner sur leur con­
acétylglucosamine. En effet, le trans­ formation. Plusieurs hypothèses sont Les auteurs tiennent à remercier le pro­
port dans le noyau des protéines à 1 'étude : existe-t-il un motif struc­ fesseur G. Dirheimer pour son encoura­
nucléaires peut être inhibé par des tural partagé par tous ces signaux gement constant. Ce travail a été subven­
tionné par l ' Association pour la recher­
anticorps monoclonaux dirigés contre malgré les diversités de séquences ?
che contre le cancer et par la Fédération
les nucléoporines ainsi que par Dans le cas contraire, les récepteurs nationale des ligues contre le cancer et la
l 'agglutinine de germe de blé , une peuvent-ils s'adapter à différentes Ligue nationale contre le cancer (comité
lectine qui se fixe sur la partie glu­ structures de NLS ou se sont-ils départemental du Haut-Rhin).
cosidique de la glycoprotéine [6] . De « spécialisés '' pour reconnaître certai­

plus, dans un système de reconstitu­ nes classes de NLS ? Cette dernière


tion in vitro de noyaux, des pores phase dans 1 'étude du ciblage de pro­
nucléaires traités à l' agglutinine de téines dans le noyau devrait permet­ TIRÉS A PART
germe de blé, et par conséquent tre d'élucider le mécanisme molécu­
dépourvus de nucléoporines fonction- laire qui régit ce transport • J. Ménissier-de Murcia.
mis n° 2, vol. 8, février 92 1 39