Vous êtes sur la page 1sur 49

25millions

de propriétaires
DOSSIER P. 14
Investir
en Pinel sans
se tromper
Louer à un p. 26

couple : quelles Réforme du droit


des contrats et
sont les règles? bail commercial
p. 29

Médiation de
l’énergie : pour
quelles requêtes ?
p. 32

Le changement
d’affectation
d’un bien
p. 35

Nº 505 www.25millionsdeproprietaires.com ISSN : 2102-0728


JE LOUE EN TOUTE TRANQUILLITÉ

Crédit photo :
39 rue Fessart 92772 Boulogne Billancourt Cedex T : 01 41 86 06 26 F : 01 41 86 06 10 N° Orias : 07 000 150 (www.orias.fr)
Q Q Q Q

SACAPP Assurances, société de courtage, est mandataire de Compagnies et Mutuelles d’Assurances.

L’IMMOBILIER est pour vous la sécurité à long terme et une garantie de revenus
Mais la GESTION devenant de plus en plus difficile, la location de logements de moins en moins rentable, vous vous interrogez
sur l’opportunité de donner congé et vendre un bien. Or, vous restez toujours attaché à la pierre quand les marchés financiers
semblent toujours fragiles. Aussi, une solution de réinvestissement, efficace, existe depuis plus de 40 ans avec
les SCPI : rendement immobilier élevé et sans soucis !
Les SCPI sont devenues un outil majeur dans la diversification du patrimoine grâce à leur ancienneté et
leur diversification entre autres nombreuses qualités incontestables et aujourd’hui reconnues et plébiscitées :
REVENUS TRIMESTRIELS élevés de 4,90 à 6,12 % par an, évolutifs (loyers commerciaux indexés), virés trimestriellement
sur votre compte, nets de tous frais de gestion et taxes foncières
Souplesse de souscription, au comptant, à crédit amortissable ou in fine, en assurance-vie
Choix et diversité des supports : immobilier de commerces, de bureaux ou d’habitation
Qualité et transparence de la gestion : information en ligne avec bulletins trimestriels et rapport annuel, listes
des adresses et locataires, valorisation sur expertises et contrôle de l’AMF
40 ans
d’expérience SCPI
Large choix des formules de souscription aux multiples objectifs : reconnue et unique
!
• PATRIMONIAUX (percevoir des revenus trimestriels réguliers, capitaliser, retraite, succession...) À VOTRE SERVICE
• FISCAUX (économies importantes d’impôts, de CSG et d’ISF), donations fiscales, démembrement.
UNPI SEPTEMBRE 2016

11, RUE ANATOLE DE LA FORGE - 75017 PARIS


TÉL. 01 55 37 26 00 - PORT. 06 17 99 63 65
CONSEIL EN GESTION DE PATRIMOINE INDÉPENDANT DEPUIS 1971
fructus@floria.fr
R.C.S. Paris 442 492 831 ORIAS : 07024307 CIF : F308
25millions
de propriétaires
ÉDITO
N° 505 / Mars 2017

25 millions de Propriétaires
11, quai Anatole-France 75007 Paris
Ce qui a changé depuis notre plainte devantlaCommissioneuropéenne
✆ 01 44 11 32 52 - Fax 01 45 56 03 17
25millionsdeproprietaires@unpi.fr Le 5 mai 2012, l’UNPI avait déposé une plainte auprès de la
šš Gérant, directeur de la publication Commission européenne contre les aides publiques octroyées
Dominique Dupréš par l’État français aux bailleurs publics, au motif qu’elles
Directeur
Paul Philippot
violent le droit de l’Union européenne.
Président du comité de rédaction Aujourd’hui, nous pouvons dire que notre action a porté ses
Jean Ferrandošš
fruits et ses objectifs étaient clairs : loger les plus pauvres

© DR
šRédaction en chef
Nadine Cazalbou dans le parc public, rétablir une concurrence loyale entre le
Jean Perrin, président de l'UNPI
nadine.cazalbou@unpi31.fr parc locatif public et le parc locatif privé.
PECI/Presse, 63, rue Alsace-Lorraine
31009 Toulouse Cedex 6 ✆ 05 62 30 15 36šš En effet, jusqu’ici l’offre de logement social repose majoritairement sur les épaules
Ont collaboré à ce numéro des bailleurs privés, les organismes HLM s’appuyant de plus en plus sur le parc
Céline Capayrou, Nadine Cazalbou, Arnaud Couvelard,
Jean Bigot, Bertrand Desjuzeur, Frédérique Polle, privé pour exercer leur mission initiale : loger les plus en difficulté face au
Anne Pronier, Mireille Sarlin, Mickael Terrom,
Pierre Benoît Vermande, Frédéric Zumbiehl logement. L’exemple le plus flagrant est la carence de l’État dans le relogement
ššSecrétariat de rédaction : PECI des locataires en situation d’expulsion. Ainsi, le risque est transféré à un seul
Abonnements (le bailleur privé) alors qu’il devrait être pris en charge par la collectivité via le
Nathalie Ramond
✆šQW
logement public.
25millionsdeproprietaires@unpi.fr L’État doit donc prendre ses responsabilités en logeant les plus démunis dans le
Éditeur parc public, sans se défausser sur les bailleurs privés indépendants, sauf à leur
La Presse immobilière
SARL au capital de 1 524,49 € - RCS B 304 455 009 octroyer les mêmes conditions et avantages que le parc HLM.
&WTȌGšCPUȃEQORVGTFWer janvier 1951
Siège social : 11 quai Anatole-France 75007 Paris Ainsi, depuis notre action, la législation française a évolué vers plus de justice
#UUQEKȌU702+ȃš et d’équité entre le parc HLM et le parc privé au travers des mesures suivantes :
Publicité
Patricia Dumons-Souverain
• Intégration de la notion de Service d’Intérêt Économique Général (SIEG) dans
PECI ✆ 05 62 30 15 39 le Code de la construction et de l’habitation ;
patricia.dumons-souverain@unpi31.fr
Iconographie :
• Séparation des comptabilités des organismes HLM entre ce qui relève du SIEG
Young couple daydreaming in their new home et ce qui relève d’autres activités ;
© gpointstudio - fotolia.com
• Pouvoir de sanction renforcé par l’ANCOLS née de la fusion de l’ANPEEC et la MIILOS
Conception graphique
Olivier Bosramier • Recentrage des constructions neuves sur les plus pauvres (PLAI) et en zones
Impression tendues (A) ;
Imprimerie Menard,
2721 La Lauragaise 31670 Labègešš • Redéfinition des critères de priorité pour l’attribution d’un logement social (ajout
Commission paritaire des personnes en situation d’expulsion) ;
N° 0717 T 81970 - ISSN : 2102-0728
Dépôt légal : mars 2017 • Prise en compte du patrimoine personnel pour les demandeurs de logements
Tarifs sociaux ;
.GPWOȌTQŻ#DQPPGOGPVCPšŻ
&QO6QOȌVTCPIGTšŻ
• Imposer 25% des attributions de logements locatifs sociaux pour les personnes
La loi du 11 mars 1957 n’autorisant, aux termes des alinéas 2 et 3 de les plus pauvres (Grand Paris) ;
NŨCTVKENGFŨWPGRCTVSWGNGUkšcopies ou reproductions strictement
réservées à l’usage privé du copiste et non destinées à une utilisation • Durcissement des conditions du droit au maintien dans les lieux (150 % des
EQNNGEVKXGšzet d’autre partkšSWGNGUCPCN[UGUGVNGUEQWTVGUEKVCVKQPU
dans un but d’exemple et d’illustrationšz VQWVG TGRTȌUGPVCVKQP QW
plafonds pendant 2 ans à l’issue d’un délai de 18 mois – auparavant 200 %,
reproduction illégale ou partielle faite sans le consentement de
l’auteur ou de ses ayants droit ou ayants cause est illicite – alinéa
2 ans, 3 ans) ;
1er de l’article 40. Cette représentation ou reproduction, par quelque
procédé que ce soit, constituerait donc une contrefaçon sanctionnée
• Réduction du champ d’application de l’article 55 de la loi SRU.
par les articles 425 et suivants du Code pénal. Selon l’article 34
de la loi du 06/01/78, tout abonné dispose d’un droit d’accès et de
Nous continuerons de nous battre par tous
TGEVKƒECVKQPRQWTVQWVGKPHQTOCVKQPNGEQPEGTPCPV.CTȌFCEVKQPFGU les moyens pour faire respecter les droits des
textes publicitaires est réalisée sous la seule responsabilité des
annonceurs et ne saurait engager 25 millions de Propriétaires. bailleurs privés selon un principe simple : à un
même locataire, les mêmes conditions et
avantages pour le bailleur (public ou privé) !

25 millions de Propriétaires - Mars 2017 3


Abonnez-vous à
2de5 millions BÉNÉFICIEZ DE LA MEILLEURE INFORMATION
EN MATIÈRE D’IMMOBILIER
propriétaires Actualités immobilières
DOSSIER Marché de
l’habitat : Dossiers thématiques
Mulhouse
Taxes foncières : p. 17

les propriétaires Louer pour Décryptages (location, copropriété,


assommés un tournage, éVFDOLW¬
un bon plan
p. 30

Fiches pratiques
La gestion
d’un bien en 25millions
de propriétaires
indivision Questions/réponses
p.34 D Marché de
l’habitat :
Mulhouse
Taxes foncières : p

les propriétaires Louer pour


Le 103 e assommés un tournage,
un bon plan
p

Congrès La gestion
d’un bien en
À Lille, la taxe foncière a augmenté
FGSWCUKOGPVšGPVTGGV de l’UNPI Découvrez la version indivision

Le 103e
p

Nº 501 www.25millionsdeproprietaires.com
ISSN : 2102-0728
p. 11
numérique À Lille, la taxe foncière a augmenté
FG SWCUKOGPV   GPVTG  GV 
Congrès
de l’UNPI p

Nº 501 www.25millionsdeproprietaires.com ISSN : 2102-0728

Offre d’abonnement réservée aux non-adhérents

Oui, LG UQWJCKVG DȌPȌƒEKGT FG NŨQHHTG FŨCDQPPGOGPV ȃ  OKNNKQPU FG 2TQRTKȌVCKTGU RQWTš


1 an (soiV  PWOȌTQU CW RTKZ FG  Ż 66%
QW  Ż 66% RQWT NGU &1/61/GVNŨȌVTCPIGT
1 an (soiV  PWOȌTQU CW RTKZ FG  Ż 66%
XGTUKQP PWOȌTKSWG
CPU
UQKVPWOȌTQU CWRTKZFGšŻ66%
QWšŻ66%RQWTNGU&1/61/GVNŨȌVTCPIGT .
%KLQKPVOQPEJȋSWGNKDGNNȌȃNŨQTFTGFG.C2TGUUG+OOQDKNKȋTG

01/š . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

2TȌPQOš. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

#FTGUUGš . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

%QFGRQUVCNš . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . šš8KNNGš . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

6ȌNš . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . šš/CKNš . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
$WNNGVKPȃEQORNȌVGTGVȃTGVQWTPGTKORȌTCVKXGOGPVCEEQORCIPȌFGXQVTGTȋINGOGPVȃNŨCFTGUUGUWKXCPVGOKNNKQPUFG
2TQRTKȌVCKTGU5GTXKEGCDQPPGOGPVUSWCK#PCVQNG(TCPEG2#4+5
#VVGPVKQPEGDWNNGVKPPGEQPEGTPGRCUNGUCFJȌTGPVUȃWPGEJCODTGFGRTQRTKȌVCKTGUGVEQRTQRTKȌVCKTGU+NPGRGWVGPCWEWPECUUGTXKTFGDWNNGVKPFGTȌCDQPPGOGPV2QWTNGUCFJȌTGPVUȃ
WPGEJCODTG702+EQPVCEVG\FKTGEVGOGPVXQVTGEJCODTG%QQTFQPPȌGUUWTYYYWPRKQTI
25millions
de propriétaires
SOMMAIRE
N° 505 / Mars 2017

6š • Investir en Pinel
L’UNPI et les médias sans se tromper
Par Anne Pronier Par Mireille Sarlin

Actualités 9
• Réforme du droit des contrats : les premiers
• Fixation annuelle des seuils de la taxe Apparu sur les
micrologements - Fin de la trêve hivernale
impacts en matière de baux commerciaux
Par Pierre Benoît Vermande
• Dépannages à domicile : des prix plus clairs
• Plateforme de mise en relation par voie électronique - Pas de
taxation des loyers fictifs - Taxe d’habitation des résidences Décryptage 32š
secondaires à Paris
• Contenu de la fiche synthétique de la copropriété • Médiation de l’énergie : pour quelles requêtes ?
• Bilan 2016 de l’Anah - Anah : quoi de neuf en 2017 ? Par Céline Capayrou
• Vers des petites annonces plus claires ? Avec l’interview de • Le changement d’affectation d’un bien
Frédéric Pélissolo, président de l’UNPI Paris Par Bertrand Desjuzeur

LE DOSSIER 14š Questions/réponses 38


• Copropriété :
- Mise en concurrence des contrats de syndic
- Changement d’usage d’un lot et modification de la
répartition des charges
• Bail d’habitation :
- Bail conclu par une SCI familiale
- Congé par une personne morale
Par Arnaud Couvelard

Jurisprudence 40š
Louer à un couple : • Copropriété
Par Mireille Sarlin
quelles sont les règles ?
Par Frédérique Polle
ÉCO-ÉNERGIE Copropriété FICHE N° 5 41š
Tribune libre 20š • Le diagnostic technique global (DTG)
Par Mickael Terrom
• Un siècle d’oppression législative et fiscale
Par Jean Bigot
Petites annonces 43š
Analyse 23
• La loi «Égalité et citoyenneté» après passage au Les indices 44š
Conseil constitutionnel
Par Frédéric Zumbiehl • Le tableau de bord du propriétaire

25 millions de Propriétaires - Mars 2017 5


L’UNPI & LES MÉDIAS Anne Pronier

1er février 3 février VTȋU KORQTVCPV z TGPEJȌTKV NG RTȌUKFGPV FG


NŨ702+  k Les propriétaires doivent pouvoir
Hauts-de-France ȍVTG UțT SWG NG RTKZ RC[Ȍ GUV EGNWK FW OCTEJȌ
et pas autre chose z
Annonces immobilières : Voir sur ce sujet l’interview de Frédéric
une réforme qui divise Pélissolo, président de l’UNPI Paris, en p. 12.
Lille adopte
l’encadrement des loyers Dès le 1 er avril 2017, un nouveau mode
FŨCHHKEJCIG QDNKIGTC NGU RTQHGUUKQPPGNU ȃ 2 février
%GFKURQUKVKHCRRNKSWȌȃ2CTKUFGRWKUNGer signaler sur les annonces de nouvelles infor-
CQțVRTȌXQKVSWŨȃNCUKIPCVWTGFŨWP mations sur la composition des honoraires
nouveau bail ou lors d’un renouvellement, ou le décompte des charges en location. Un
le loyer d’un logement ne peut dépasser de
šWPNQ[GTFGTȌHȌTGPEGƒZȌRCTCTTȍVȌ
arrêté, publié en janvier dernier, contraint les ISF : comment Macron
RTQHGUUKQPPGNU ȃ KPUȌTGT FCPU NGWTU CPPQPEGU compte taxer la « rente
préfectoral - selon le nombre de pièces et trois nouvelles données.
la période de construction du logement - ni La première porte sur la publication obliga-
immobilière »
NWKȍVTGKPHȌTKGWTFGšUCWHGZEGRVKQPU toire, sur les sites des agences, du barème À l’instar des économistes de gauche, Emma-
DȌPȌƒEKCPVFŨWPkšEQORNȌOGPVFGNQ[GTšz des prix des prestations qu’ils proposent. nuel Macron semble avoir la dent dure contre
Le président de l’UNPI Nord de France, Jean- .C UGEQPFG QDNKIG NGU CIGPVU ȃ RTȌEKUGT UWT NGU RTQRTKȌVCKTGU 6QWT ȃ VQWT 6JQOCU 2KMGVV[
Pierre Berlinet, avait critiqué ce dispositif les annonces de vente « U[UVȌOCVKSWGOGPV le Conseil d’analyse économique, l’OFCE ou
GPFȌEGODTGFGTPKGTškšC’est beaucoup de NG RTKZ FG XGPVG FW DKGP GV ȃ SWK KPEQODG NG encore France Stratégie ont réclamé, pour
VTCXCKNRQWTRGWFGTȌUWNVCVUšzGVEGNCXCkšHCKTG paiement des honoraires de l’intermédiaire z TȌVCDNKT UGNQP GWZ WPG HQTOG FŨȌSWKVȌ ƒUECNG
fuir certains investisseurs (...) et peut-être 'PƒP NC FGTPKȋTG EQPEGTPG NC NQECVKQP GV de surtaxer les propriétaires qui n’ont ni
décourager des propriétaires bailleurs déjà impose aux professionnels d’avertir les futurs ETȌFKV PK NQ[GT ȃ RC[GT .ŨCPEKGP OKPKUVTG FG
CUUQOOȌURCTNGUVCZGUOWNVKRNGUGVSWK locataires du montant du loyer mensuel « VQWV l’Économie et des Finances, lui, veut taxer
pourraient donc vendrešz EQORTKU z OCKU ȌICNGOGPV k des modalités de la rente immobilière.
2QWTTCRRGNǡNŨ702+0QTFFG(TCPEGCUUQEKȌG FȌEQORVG FGU EJCTIGU NQECVKXGU FG NC UWTHCEG « 6CZGT NGU RTQRTKȌVCKTGU FG TGPVKGTU GUV RTQHQP
ȃNŨ7PKQPFGUU[PFKECVUFGNŨKOOQDKNKGTGVȃ GV FG NC EQOOWPG FW DKGP CƒP PQVCOOGPV FG FȌOGPV EJQSWCPV z TȌCIKV ,GCP 2GTTKP NC
la Fédération nationale de l’immobilier, a NGWT RGTOGVVTG FG XȌTKƒGT NG TGURGEV FW RNCHQP fédération qui représente les propriétaires et
déposé en référé une demande de suspension nement des honoraires de location créé par la qui réclame la suppression pure et simple de
de l’arrêté préfectoral. Deux procédures de loi ALUR z RTȌEKUG NŨCTTȍVȌ .ŨCTIWOGPV CXCPEȌ NŨ+5( k Les propriétaires occupants n’ont rien
contestation sur le fond sont par ailleurs par le ministère est avant tout de permettre demandé à personne pour le devenir. Quant aux
FȌLȃGPEQWTU de mieux informer l’acquéreur potentiel ou DCKNNGWTU NC IGUVKQP NQECVKXG GUV WPG CEVKXKVȌ
NG NQECVCKTG UWT EG SWŨKN RCKG XTCKOGPV k C’est GV PQP RCU WPG TGPVG /CETQP SWK ȌVCKV EGPUȌ

Journal
Télévisé
Encadrement des loyers
- Focus sur Paris
Reportage sur le système de fonctionnement
d’une commission de conciliation qui doit faire
respecter cet encadrement des loyers.Depuis
août 2015, date de sa mise en œuvre, seules
RNCKPVGUTGNGXȌGUȃ2CTKUUWTšDCWZ
de relocation. Quelle sera la conséquence de
NŨGPECFTGOGPVFGUNQ[GTUš!5GNQP;XGU$TWP
UEJYKEMRTȌUKFGPVFGNŨ702+ȃ$QWNQIPGš
kš2QWTNGURTQRTKȌVCKTGUNŨGPECFTGOGPVFGU
© PlanetEarthPictures

NQ[GTUXCGPIGPFTGTOQKPUFGTGXGPWUFQPE
moins de travaux et d’entretien des biens et
une dégradation du parc locatifšz

6 25 millions de Propriétaires - Mars 2017


L’UNPI & LES MÉDIAS
NKDȌTGTNŨȌEQPQOKGCRRNKSWGFGUXKGKNNGUKFȌGU OKNNKQPUȃNCECRKVCNG sur les résidences secondaires se traduira par
sectaires pour tuer le marché immobilieršz %GVVGHQKUNGUOCKTGUFGUšEQOOWPGUGP WPVCWZFGšEŨGUVOQKPUSWGNCOQ[GPPG
Aujourd’hui, l’ISF rapporte un peu plus de 5 zones tendues se voient ouvrir la possibilité nationalešz&CPUUCEQOOWPKECVKQPNCOCKTKG
OKNNKCTFUFŨGWTQUȃNŨDZVCV6QWVRCTVKEWNKGTQW FGRQWUUGTNCOCLQTCVKQPGPVTGGVš%ŨGUV reconnaît que la première majoration de 2015
HQ[GTƒUECNGUVEQPEGTPȌRCTNŨKORȖVUWTNC ȃPQWXGCWNCOCKTKGFG2CTKUSWKCEQPXCKPEW PŨCXCKVRCUUWHƒRQWTKPEKVGTFGUTGXGPVGU
fortune si la valeur de son patrimoine excède le gouvernement et le Parlement d’adopter espérant cette fois un taux plus dissuasif.
OKNNKQPFŨGWTQU'POQ[GPPGNGUš cette mesure qui pourrait lui rapporter 43 L’UNPI s’indigne, elle, de cette surenchère
(TCPȊCKUCUUWLGVVKUȃNŨKORȖVFGUQNKFCTKVȌUWT millions d’euros. ƒUECNGškšCertains propriétaires doivent déjà
la fortune s’acquittent d’un montant moyen La maire de la capitale, Anne Hidalgo, a relati- XGTUGTCWVKVTGFGNCVCZGHQPEKȋTGLWUSWŨȃVTQKU
FGššŻ XKUȌNŨKORCEVƒUECNškšLe produit cumulé du taux OQKUFGNQ[GTšz
kš6QWUNGURTQRTKȌVCKTGUPGUQPVRCUPȌEGUUCK de la taxe d’habitation et celui de la majoration
rement rentiersšzTGEQPPCKUUGPVNGUGZRGTVU
d’En Marche! Surtout, il n’est pas question
FŨCWIOGPVGTNCƒUECNKVȌUWTNŨKOOQDKNKGT.G
barème et le taux resteraient les mêmes,
l’abattement sur la résidence présidence 20 janvier 'VFGEQPENWTGǡkǡ.GURTQRTKȌVCKTGUFGDKGPU
principale serait maintenu mais l’assiette en montagne sont confrontés aux charges
UGTCKVRNWUHCKDNG.GOCPSWGȃICIPGTRQWT SWKRȋUGPVUWTFGUDKGPUNQWȌUFGOCPKȋTG
NŨDZVCV UGTCKV FG FGWZ OKNNKCTFU FŨGWTQU ȃ saisonnière. Souvent l’entretien de ce logement
EQWTVVGTOG5KNCSWGUVKQPFGNCƒUECNKVȌFG Interview de Daniel Droguet, représente une grande partie des dépenses.
l’immobilier est très sensible, c’est aussi et Président de l’UNPI Savoie Le taux de remplissage est lié à la santé de
surtout que les Français aiment la pierre et « Créée en 1926 sous la forme d’une association NŨȌEQPQOKGFWRC[UCWZEQPFKVKQPUENKOCVKSWGU
SWGNŨKOOQDKNKGTGUVFȌLȃWPFGUCEVKHUNGU NQKNCEJCODTGU[PFKECNGFGURTQRTKȌVCKTGU /CNITȌEGNCNGUEJCTIGUTGUVGPVȌNGXȌGUǡz
plus taxés. et copropriétaires de la Savoie est membre de
NCHȌFȌTCVKQP702+GVCRRGNȌGCWUUK702+ǡ
Des bénévoles et un personnel assurent l’acti- 31 janvier
30 janvier
vité et la pérennité de l’association. Acteur du
NQIGOGPVPQVTGCUUQEKCVKQPGUVRTȌUGPVGȃ
FKXGTUGUEQOOKUUKQPU
EQPEKNKCVKQPCEEGUUK
DKNKVȌEQOOKUUKQPFGNŨ#IGPEGPCVKQPCNGRQWT Location immobilière : quelques
Résidences secondaires : NŨCOȌNKQTCVKQPFGNŨJCDKVCVGVE Ų%GSWKOŨCPKOG conseils de l’UNPI Lorraine
Paris vote la surtaxe, les GVOGFQPPGGPXKGFGOŨGPICIGTEŨGUVNGUQWEK
La section lorraine de l’UNPI a réuni ses adhé-
autres villes sont plus FŨCKFGTCWVCPVSWGRQUUKDNGNGURTQRTKȌVCKTGUGV
copropriétaires dans le domaine de l’habitat et rents sur le thème « Choisir son locataire ».
prudentes Interview de Yvan Mansuy délégué départe-
FWNQIGOGPVPQVCOOGPVFGXCPVNCEQORNGZKVȌ
FGUVGZVGUGVNGUFKHHKEWNVȌUHTȌSWGPVGUFG mental UNPI 55 Nancy
Le Conseil de Paris a voté la majoration de
šFGNCVCZGFŨJCDKVCVKQPFGURKGFȃVGTTG communication entre les différents acteurs de kǡ&ŨCDQTFSWŨWPOCZKOWOFGRTQRTKȌVCKTGUUQKV
7PGUWTGPEJȋTGƒUECNGSWGFȌPQPEGPVNGU l’immobilier en général. Étant un professionnel à jour au niveau des connaissances indispen-
associations de propriétaires. FGNŨKOOQDKNKGTȃNCTGVTCKVGEGVVGCEVKXKVȌOG UCDNGURQWTRQWXQKTNQWGTWPDKGPOCKUCWUUK
Trouver de nouvelles recettes, libérer des tient à cœur. On intervient également dans ȌEJCPIGTFGUKPHQTOCVKQPUXȌTKƒGTNGUDQPPGU
logements pour les Parisiens, le tout sans l’accomplissement de toutes les démarches RTCVKSWGUGVCRRTQHQPFKTNGURQKPVUNKVKIKGWZ&GU
grever leurs impôts. C’est l’équation qu’a RQWXCPVKPVȌTGUUGTNCRTQRTKȌVȌKOOQDKNKȋTG VJȋOGUFKHHȌTGPVUUQPVCDQTFȌUȃEJCSWGHQKU
fait valoir le Conseil de Paris pour voter PQVCOOGPVCWRTȋUFGURQWXQKTURWDNKEUFGU kNGUKORC[ȌUFGNQ[GTzGVkNGEQPXGPVKQPPG
une nouvelle surtaxe d’habitation sur les RCTNGOGPVCKTGUFGUCWVQTKVȌUFGVQWVGPCVWTG OGPVz%JQKUKTUQPOQFGFGIGUVKQPKPFKTGEVG
résidences secondaire. Pour la deuxième GVFGUCFOKPKUVTCVKQPURWDNKSWGUQWRTKXȌGUŲ (par agence) ou directe (par soi-même). Bien
fois en trois ans, les parlementaires ont .ŨCUUQEKCVKQPRQTVGȌICNGOGPVCUUKUVCPEGFCPU VTCXCKNNGTNCTȌFCEVKQPFGNŨCPPQPEG
EQPVGPW
FQPPȌFCPUNCNQKFGƒPCPEGUNCRQUUKDKNKVȌ WPKPVȌTȍVEQOOWPȃWPQWRNWUKGWTUCFJȌTGPVU UWRRQTVUEQPFKVKQPU GVUQKIPGTNGUXKUKVGU
aux maires de doper les taxes des résidents dans les instances judiciaires ou administratives (moment-clé pour apprécier). S’assurer au
KPVGTOKVVGPVU7PUWTETQȑVFGšCXCKVFȌLȃ UQWNGXCPVFGUSWGUVKQPUFGRTKPEKRG1PCKFG VTCXGTUFGUFQEWOGPVUHQWTPKUSWGNGVCWZ
ȌVȌXQVȌƒPEQPXCKPECPVWPGEGPVCKPG à la rédaction de baux et on assure la vente d’effort maximum n’est pas dépassé. Réfléchir
de communes de tous bords politiques de d’imprimés en vigueur et on fait de la formation ȃNCRGTVKPGPEGFŨWPGCUUWTCPEGRQWTKORC[ȌU
l’adopter. Il avait rapporté une quinzaine de XKCFGUTȌWPKQPUOGPUWGNNGUFCPUPQUNQECWZǡz RTQEȌFWTGQWFȌITCFCVKQPUǡz

25 millions de Propriétaires - Mars 2017 7


Des baux pour louer
NOUVEAU
en toute sécurité KIT K32
Les juristes de l’UNPI vous proposent des BAUX POUR LES
LOCATIONS
et IMPRIMÉS (mis à jour de la loi ALUR) MEUBLÉES
qui vous assurent une fiabilité de premier ordre
Connectez-vous sur notre site www.unpi.org
POUR COMMANDER Rubrique LA BOUTIQUE
ou contactez votre Chambre syndicale
3 SOLUTIONS ou remplissez le bon de commande ci-dessous

B O N D E C O M M A N D E
À nous retourner ACCOMPAGNÉ DE VOTRE RÈGLEMENT PAR CHÈQUE (à l’ordre de La Presse immobilière) :
La Presse immobilière - 11 quai Anatole France - 75007 PARIS
Jeu de 2 exemplaires Jeu de 3 exemplaires
À l’unité TTC*
Référence Désignation TTC* TTC* TOTAL
Prix Quantité Prix Quantité Prix Quantité
Kit du propriétaire logement nu (3 baux réf. 80, 2 actes de caution
K 31 solidaire, 1 état des lieux, ƒEJGRQWTECPFKFCVNQECVCKTGNKUVGFGU šŻ šŻ šŻ
TȌRCTCVKQPUGVFGUEJCTIGUNQECVKXGU
-KVFWRTQRTKȌVCKTGNQIGOGPVOGWDNȌ
DCWZTȌHCXGEKPXGPVCKTGFW
K 32 OQDKNKGTCEVGUFGECWVKQPUQNKFCKTGȌVCVFGUNKGWZƒEJGRQWTNG šŻ šŻ šŻ
ECPFKFCVNQECVCKTGNKUVGFGUTȌRCTCVKQPUGVFGUEJCTIGUNQECVKXGU
80 $CKNFGCPUQWRNWU
NQECWZXCECPVUNQECVKQPQWEQNQECVKQP šŻ šŻ

80 A #XGPCPVCWDCKNTȌHȌTGPEG
ȃTGORNKTGPECUFGFȌRCTVFŨWPEQNQECVCKTG šŻ

103 $CKNOGWDNȌ KPXGPVCKTGFWOQDKNKGT šŻ šŻ

AC #EVGFGECWVKQPUQNKFCKTG
RQWTNGUDCWZTȌHȌTGPEGUGV šŻ

101 $CKNFGTȌUKFGPEGUGEQPFCKTG
NQECWZPWU šŻ šŻ

102 Bail professionnel šŻ šŻ

104 $CKNFGICTCIG
NQWȌUȌRCTȌOGPVFŨWPGNQECVKQPFŨJCDKVCVKQP šŻ šŻ

105 $CKNFGNQECVKQPUCKUQPPKȋTGCXGEȌVCVFGUETKRVKH
U[UVȋOGCWVQEQRKCPV šŻ

49 Bail commercial šŻ

FR 01 (KEJGRQWTECPFKFCVNQECVCKTG šŻ š

47 %CTPGVFGSWKVVCPEGUFGNQ[GTUCPUCXKUFŨȌEJȌCPEG šŻ

EL DZVCVFGUNKGWZ
CWVQEQRKCPVGZRTQRTKȌVCKTG GZNQECVCKTG šŻ

67 .KUVGFGUTȌRCTCVKQPUNQECVKXGUGVEJCTIGUTȌEWRȌTCDNGU šŻ

Nom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
T O TA L
š(TCKUFGRQTVKPENWU

Prénom ........................................................................................................................................... La loi du 21 juillet 1994 prévoit que la personne se portant caution doit
impérativement recevoir un exemplaire du bail
Adresse . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Code postal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Ville . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .

Tél. .......................................................................................... E-mail . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .


ACTUALITÉS

Location Fiscalité
Fixation annuelle des seuils de Plateforme de mise en relation par voie
la taxe Apparu sur les micro- électronique
logements .ŨCTVKENGFGNCNQKFGƒPCPEGURQWTCKPUVCWTȌRQWTNGURNCVG
En 2017, les fourchettes de loyers pour l’application diffé- HQTOGUFGOKUGGPTGNCVKQPRCTXQKGȌNGEVTQPKSWG
#KT$P$Ų WPGQDNK
TGPEKȌGFGNCVCZG#RRCTWUQPVKFGPVKSWGUȃEGNNGUFG ICVKQPFŨKPHQTOCVKQPFGNGWTUWVKNKUCVGWTUUWTNGUQDNKICVKQPUƒUECNGU
Depuis 2012, dans les zones où le marché locatif est tendu, et sociales incombant aux personnes qui réalisent des transactions
les bailleurs de logements loués nus ou meublés, ayant une commerciales par leur intermédiaire. Les conditions d’application de
UWTHCEGJCDKVCDNGKPHȌTKGWTGQWȌICNGȃšO2 sont soumis cette obligation ont été précisées par décret. Ainsi ces plateformes sont
ȃWPGVCZGUKNGOQPVCPVFWNQ[GTOGPUWGNEJCTIGUPQP tenues de communiquer lors de chaque transaction les informations
EQORTKUGUGZEȋFGWPEGTVCKPOQPVCPVƒZȌRCTFȌETGV
%)+ TGNCVKXGUCWZTȌIKOGUƒUECWZGVȃNCTȌINGOGPVCVKQPUQEKCNGCRRNKECDNGU
CTV 'PEGOQPVCPVSWKGUVKFGPVKSWGȃEGNWKFG aux recettes et aux revenus tirés de ces opérations. Ces informations
RGWVȍVTGEQORTKUGPVTGšŻGVšŻ portent également sur les obligations déclaratives et de paiement
Le loyer mensuel de référence pour la détermination des CWRTȋUFGNŨCFOKPKUVTCVKQPƒUECNGGVFGUQTICPKUOGUFGTGEQWXTGOGPV
VCWZFGNCVCZGCȌVȌƒZȌȃšŻ des cotisations sociales. Les plateformes sont également tenues de
OGVVTGȃFKURQUKVKQPFGNGWTUWVKNKUCVGWTUWPNKGPȌNGEVTQPKSWGXGTUNGU
UKVGUFGUCFOKPKUVTCVKQPUEQPEGTPȌGU
QDNKICVKQPKORȌTCVKXGȃEQORVGT
Fin de la trêve hivernale
du 1er mars 2017). De plus, chaque année, les plateformes adressent
La trêve hivernale, qui s’étend du 1er novembre au 31 mars, PQTOCNGOGPVCXCPVNGLCPXKGT
WPGVQNȌTCPEGCFOKPKUVTCVKXGRQTVGEG
GUVNCRȌTKQFGFWTCPVNCSWGNNGKNGUVKPVGTFKVFGRTQEȌFGTȃ FȌNCKCWšOCTURQWTNŨCPPȌG ȃNGWTUWVKNKUCVGWTUWPFQEWOGPV
NŨGZRWNUKQPFWNQECVCKTGEŨGUVȃFKTGȃUCUQTVKGKORQUȌGFW EQPVGPCPVFKXGTUGUKPHQTOCVKQPUUWTNŨCPPȌGȌEQWNȌG
FCVGFŨȌOKUUKQPFW
NQIGOGPVRCTHQKUCXGENGTGEQWTUȃNCHQTEGRWDNKSWG/CKU document, coordonnées de la plateforme, coordonnées de l’utilisateur,
si la trêve hivernale interdit d’expulser le locataire, elle PQODTGFGVTCPUCEVKQPUTȌCNKUȌGUOQPVCPVVQVCNFGUUQOOGURGTȊWGUŲ 
PŨKPVGTFKVRCUCWDCKNNGWTFŨGPICIGTNCRTQEȌFWTGSWKCDQWVKTCȃ 5QWTEGǡFȌETGVPoFWHȌXTKGT
l’expulsion. En location vide comme en meublé, la procédure
de résiliation du bail et d’expulsion est très encadrée par la Pas de taxation des loyers fictifs
NQK&WRTGOKGTKPEKFGPVFGRCKGOGPVȃNCUQTVKGFȌƒPKVKXGFW
locataire, de nombreux mois sont nécessaires pour récupérer Jusqu’en 1965, la législation française taxait sur la base d’un revenu
le logement. À compter du 1erCXTKNNCƒPFGNCVTȍXG ƒEVKHNGRTQRTKȌVCKTGSWKUGTȌUGTXCKVNCLQWKUUCPEGFŨWPNQIGOGPV
permet de procéder aux expulsions. %GVVGOGUWTGCȌVȌUWRRTKOȌGRCTNCNQKFGƒPCPEGURQWT.C
TWOGWTFGNŨKPUVCWTCVKQPRCTNG)QWXGTPGOGPVFŨWPGUQTVGFGNQ[GT
ƒEVKHRQWTNGURTQRTKȌVCKTGUC[CPVUQNFȌNGRTȍVFŨCESWKUKVKQPFGNGWT
Consommation FQOKEKNGTGUUWTIKUUCPVFGRWKURNWUKGWTUOQKU(TCPEKU*KNNOG[GT
7&+
*CWV4JKP CKPVGTTQIȌNGOKPKUVTGFGNŨ+PVȌTKGWTSWKCȌVȌENCKTškšIl
Dépannages à domicile : des prix PŨGUVRCUGPXKUCIȌFGTGUVCWTGTWPVGNFKURQUKVKHȃRNWUHQTVGTCKUQP
plus clairs dans un contexte où le Gouvernement relance l’accession à la propriété
RQWTNGURGTUQPPGUCWZTGXGPWUOQFGUVGUšz
Dès le 1er avril 2017, les artisans intervenant au domicile des
5QWTEGǡ4ȌRQPUGOKPKUVȌTKGNNG,1#0PoLCPXKGT
particuliers devront, avant toute intervention, remettre au
consommateur un document mentionnant des informations
concernant notamment leur taux horaire de main-d’œuvre, Taxe d’habitation des résidences
les modalités de décompte du temps estimé, les prix des
prestations forfaitaires, les frais de déplacement ou encore
secondaires à Paris
le caractère gratuit ou payant du devis. Ces informations %QOOGNŨCWVQTKUGNCNQKFGƒPCPEGURQWT
CTVKENG NG%QPUGKN
FGXTQPVȍVTGCEEGUUKDNGUUWTNGWTUKVGKPVGTPGVGVXKUKDNGȃ FG2CTKUCFȌEKFȌFŨCRRNKSWGTNGVCWZOCZKOCNFGOCLQTCVKQPFGǡ
NŨKPVȌTKGWTQWȃNŨGZVȌTKGWTFGNGWTUNQECWZ.GEQPUQOOCVGWT sur le montant de la taxe d’habitation des résidences secondaires dès
doit également indiquer sur le devis qu’il a été informé de la 2017. La municipalité épargne toutefois les personnes qui disposent
possibilité qu’il a de conserver les pièces, les éléments ou FŨWPGTȌUKFGPEGUGEQPFCKTGFCPUNCECRKVCNGRQWTNGUDGUQKPUNKȌUȃNGWT
appareils remplacés. activité professionnelle, celles-ci pouvant obtenir le dégrèvement de
5QWTEGǡCTTȍVȌFWLCPXKGTTGNCVKHȃNCRWDNKEKVȌFGURTKZFGU
RTGUVCVKQPUFGFȌRCPPCIGFGTȌRCTCVKQPGVFŨGPVTGVKGPFCPUNGUGEVGWT
EGVVGOCLQTCVKQPUWTUKORNGTȌENCOCVKQPCWRTȋUFGUUGTXKEGUƒUECWZ
FWDȅVKOGPVGVFGNŨȌSWKRGOGPVFGNCOCKUQP 5QWTEGǡ&ȌNKDȌTCVKQPFW%QPUGKNFG2CTKUPo&(#FWLCPXKGT

25 millions de Propriétaires - Mars 2017 9


Toutes les associations locales au service des propriétaires
UNPI 01 AIN 04 74 42 92 45 UNPI 39 LONS-LE-SAUNIER JURA 03 84 47 15 59 STRASBOURG
UNPI 67 BAS-RHIN 03 88 24 24 99
UNPI 02 AISNE 03 23 56 23 05 UNPI 40 DAX LANDES 05 58 74 17 70
COLMAR CENTRE
UNPI 03 ALLIER 04 73 35 06 50 UNPI 41 BLOIS 02 47 38 68 90 UNPI 68 ALSACE 03 89 41 14 88
UNPI 04 DIGNE 04 92 31 01 01 ROANNE - ST-ETIENNE UNPI 68 MULHOUSE 03 89 56 13 37
UNPI 42 LOIRE ET HAUTE-LOIRE 04 77 32 78 54
UNPI 05 GAP 04 92 51 87 05 UNPI 69 LYON ET RHONE 04 72 77 88 90
UNPI 42 ST ETIENNE 04 77 32 78 54
UNPI 06 CANNES 04 93 39 05 39 UNPI 70
BESANCON
03 81 83 10 03
CLERMONT-FERRAND HAUTE-SAONE
UNPI 06 NICE 04 93 80 00 73 UNPI 43 HAUTE-LOIRE 04 73 350 360
UNPI 71 MACON 03 85 38 77 51
UNPI 07 ARDECHE 04 75 56 04 66 NANTES
UNPI 44 LOIRE-ATLANTIQUE 02 40 48 76 32 UNPI 71 CHALON-SUR-SAONE 03 85 48 01 61
UNPI 09 ARIEGE 05 62 30 15 30
UNPI 45 ORLEANS LOIRET 02 38 53 59 81 UNPI 71 LE CREUSOT 03 85 80 86 89
UNPI 10 AUBE 03 25 73 01 19
UNPI 45 MONTAR 06 82 89 61 28 LE MANS SARTHE 02 43 77 95 63
UNPI 11 AUDE 04 68 25 79 73
UNPI 46 CAHORS LOT 05 65 35 21 44 CHAMBERY SAVOIE 04 79 33 40 14
UNPI 12 AVEYRON 05 65 68 18 07
AGEN ANNECY
MARSEILLE & UNPI 47 LOT-ET-GARONNE 05 53 48 02 22 06 81 40 58 61
UNPI 13 BOUCHES-DU-RHONE 04
VILLENEUVE-SUR-LOT 01 44 11 32 42
UNPI 14 CAEN 02
MENDE LOZERE 62 ROUEN 02 35 70 01 58
AL
52 LE HAVRE 58
INE-ET-LOIRE
FONTAINEBLEAU
CHE 20 SEINE-ET-MARNE 01 64 22 38 64

01 39 50 74 01
CHAUMONT NIORT DEUX-SEVRES 05 49 28 25 72
UNPI 18 BLOIS CHER 21 UNPI 52 HAUTE-MARNE 03 25 03 40 64
AMIENS SOMME 03 20 57 42 38
UNPI 18 VIERZ 00 LAVAL MAYENNE 02 99
ALBI 05 63 54 89 62
UNION 19 BRIVE CORREZE 06 24
MEURTHE-ET-MOSELLE TARN 05 63 59 53 03
UNPI 21 COTE-D’OR 03
ST BRIEUC TARN-ET-GARONNE 05 63 91 51 15
UNPI 22 COTES-D’ARMOR 02
UNPI 56 LORIE 02 97 21 18 23
GUERET CREUSE
04 91 00 34 90
UNPI 23 05 UNPI 3 87 75 19 19
DORDOGNE
04 90 85 53 19
UNPI 24 05 56 52 57 07 UNPI 57 T 03 82 53 31 29
LA ROCHE-SUR-YON
UNPI 25 BESANÇON 03 81 83 10 03 03 87 95 00 23 UNPI 85 VENDEE 02 51 62 04 58
UNPI 26 DROME 04 75 56 04 66 03 87 96 01 62 UNPI 86 POITIERS VIENNE 05 49 41 46 48
UNPI 27 EURE 06 O LIMOGES
UNPI 87 HAUTE-VIENNE 05 55 34 36 31
UNPI 28 EURE-ET-LOIR 02
MERLEBACH UNPI 88 VOSGES 03 83 32 93 10
UNPI 29 BREST FINISTERE 06 63 14 94 20
RE 03 12
UNPI 30 NIMES GARD 04 66 21 07 13
RD DE FRANCE 03 83
UNPI 31 TOULOUSE 05 62 30 15 30
CHANTILLY OIS 03 01 64 96 06 64
UNPI 32 AUCH GERS 05 62 05 37 66
FLERS ORNE 09 52 61 91 32
UNPI 33 BORDEAUX GIRONDE 05 56 52 57 07
PAS-DE-CALAIS UNPI 92 09 52 61 91 32
UNPI 34 MONTPELLIER HERAULT 04 NORD DE FRANCE 38
UNPI 34 BEZIERS 04 UNPI 93 SEINE ST DENIS 01 44 11 32 42
ND
UNPI 63 AUVERGNE 04 73 35 06 50 SAINT
UNPI 35
RENNES
02 UNPI 94 VAL-DE-MARNE 01 42 83 92 22
ILLE-ET-VILAINE UNPI 64 BAYONNE 87
VILLENEUVE-SAINT-
UNPI 36 CHATEAUROUX INDRE 02 54 07 28 28 TARBES UNPI 94 GEORGES 01 43 89 46 12
UNPI 65 HAUTES-PYRENEES 31
UNPI 37 TOURS INDRE-ET-LOIRE 02 47 38 68 90 UNPI 94 VINCENNES 01 43 28 22 80
PERPIGNAN
UNPI 38 VIENNE 04 74 31 59 05 UNPI 66 PYRENEES-ORIENTALES 04 68 34 45 30 UNPI 95 VAL-D’OISE 01 44 11 32 42
UNPI 38 GRENOBLE ISERE 04 76 96 63 95 UNPI 66 04 68 34 45 30 UNPI 2A/2B 04 91 00 34 90
PYRENEES-ORIENTALES
ACTUALITÉS

Copropriété Rénovation
Contenu de la fiche synthétique Bilan 2016 de l’Anah
.CNQK#.74CKPUȌTȌFCPUNCNQKFWLWKNNGV
UWTNGUVCVWVFG NC
EQRTQRTKȌVȌ WPPQWXGNCTVKENGCWZVGTOGUFWSWGNVQWVkšU[PFKE #XGE RTȋU FG š NQIGOGPVU
ȌVCDNKVWPGƒEJGU[PVJȌVKSWGFGNCEQRTQRTKȌVȌTGITQWRCPVNGUFQPPȌGU rénovés, l’activité globale de l’Agence reste soutenue
ƒPCPEKȋTGUGVVGEJPKSWGUGUUGPVKGNNGUTGNCVKXGUȃNCEQRTQRTKȌVȌGVȃUQP en 2016.
DȅVKFQPVNGEQPVGPWGUVFȌƒPKRCTFȌETGVšz 4CRRGNFGUQDLGEVKHU RCTCZGFŨKPVGTXGPVKQPǡ
.CƒEJGU[PVJȌVKSWGUŨKORQUGFCPUVQWUNGUKOOGWDNGUGPEQRTQRTKȌVȌ •šš.WVVGTEQPVTGNŨJCDKVCVKPFKIPGGVVTȋUFȌITCFȌǡ
ȃWUCIGVQVCNQWRCTVKGNFŨJCDKVCVKQP5QPEQPVGPWCȌVȌRTȌEKUȌRCT 1DLGEVKHǡǡ4ȌCNKUȌǡǡ
NGFȌETGVPošFWFȌEGODTG
RWDNKȌCW,1FW  •šš.WVVGTEQPVTGNCRTȌECTKVȌȌPGTIȌVKSWGǡ
décembre 2016). 1DLGEVKHǡǡRQTVȌȃǡRWKUȃǡ
.CƒEJGU[PVJȌVKSWGFQKVȍVTGOKUGȃLQWTRCTNGU[PFKEEJCSWGCPPȌG 4ȌCNKUȌǡǡ
GPRTKPEKRGFCPUNGUkšFGWZOQKUUWKXCPVNCPQVKƒECVKQPFWRTQEȋUXGTDCN
•šš#KFGTCWTGFTGUUGOGPVFGUEQRTQRTKȌVȌUFȌITCFȌGUǡ
FGNŨCUUGODNȌGIȌPȌTCNGCWEQWTUFGNCSWGNNGNGUEQORVGUFGNŨGZGTEKEG
1DLGEVKHǡǡ4ȌCNKUȌǡǡ
ENQUQPVȌVȌCRRTQWXȌUšz
CTVKENG 
La loi ALUR entend sanctionner fortement les syndics non réactifs.
•šš#FCRVGTNGUNQIGOGPVUȃNCRGTVGFŨCWVQPQOKGGV
CWZJCPFKECRUǡ
#KPUKkšNGFȌHCWVFGTȌCNKUCVKQPFGNCƒEJGU[PVJȌVKSWGGUVWPOQVKH FG
1DLGEVKHǡǡ4ȌCNKUȌǡǡ
TȌXQECVKQPFWU[PFKEšz
CTVKENGFGNCNQKFG &GOȍOGk les
EQPVTCVUFGU[PFKERTȌXQKGPVQDNKICVQKTGOGPVWPGRȌPCNKVȌƒPCPEKȋTG •šš&ȌXGNQRRGTNŨCEEȋUCWNQIGOGPVFGURGTUQPPGU
HQTHCKVCKTGCWVQOCVKSWGȃNŨGPEQPVTGFWU[PFKEEJCSWGHQKUSWGEGNWKEK modestes par la production d’un parc de loge-
PGOGVRCUNCƒEJGU[PVJȌVKSWGȃFKURQUKVKQPFŨWPEQRTQRTKȌVCKTGFCPU OGPVUȃXQECVKQPUQEKCNGǡ
WPFȌNCKFGSWKP\GLQWTUȃEQORVGTFGNCFGOCPFG%GVVGRȌPCNKVȌGUV 1DLGEVKHǡǡRQTVȌȃǡ4ȌCNKUȌǡǡ
*En nombre de logements rénovés
FȌFWKVGFGNCTȌOWPȌTCVKQPFWU[PFKENQTUFWFGTPKGTCRRGNFGEJCTIGU
de l’exercicešz
Toutefois, un calendrier d’entrée en vigueur de ces dispositions est Anah : quoi de neuf en 2017 ?
RTȌXW%GNNGUEKUQPVFŨQTGUGVFȌLȃCRRNKECDNGUFGRWKUNGer janvier
2017 pour les syndicats de copropriétaires comportant plus de 200
• Pour les propriétaires bailleurs
Lancement le 1er février 2017 du dispositif « .QWGT CDQTFCDNG z
lots. Elles le seront le 1er janvier 2018 pour les syndicats de coproprié-

GP TGORNCEGOGPV FW $QTNQQ CPEKGP SWK OQFKƒG NGU CXCPVCIGU
taires comportant plus de 50 lots et le 1er janvier 2019 pour les autres
ƒUECWZ  FȌFWEVKQP RQUUKDNG GPVTG  GV   FGU NQ[GTU RGTȊWU
syndicats de copropriétaires.
FCPU NG ECFTG FŨWP EQPXGPVKQPPGOGPV CXGE NŨ#PCJ   FG
4CRRGNQPUSWGEGVVGƒEJGU[PVJȌVKSWGFGNCEQRTQRTKȌVȌKPVȌTGUUGTCVCPV
FȌFWEVKQP FCPU NG ECFTG FŨWP TGEQWTU ȃ NŨKPVGTOȌFKCVKQP NQEC
les copropriétaires que les acquéreurs de lots de copropriété. Comme
VKXG 1DLGEVKH FW )QWXGTPGOGPV  TGOGVVTG   NQIGOGPVU
le précise l’article L. 721-2 du Code de la construction et de l’habitation
vacants sur le marché en 3 ans.

ETȌȌRCTNCNQK#.74 EGUFGTPKGTUFQKXGPVGPGHHGVUGXQKTTGOGVVTG NC
ƒEJGU[PVJȌVKSWGFGNCEQRTQRTKȌVȌRTȌCNCDNGOGPVȃNCRTQOGUUG FG • Pour les syndics et syndicats de copropriétaires
vente. En cas d’acte de vente non précédé d’une promesse, elle est Depuis le 1er janvier, inscription obligatoire sur le registre
LQKPVGȃNŨCEVGCWVJGPVKSWG FŨKOOCVTKEWNCVKQP FGU EQRTQRTKȌVȌU CXCPV NC ƒP FG NŨCPPȌG
des copropriétés de plus de 50 lots. L’inscription au registre
se fait en ligne.
Et l’Anah étend son offre Habiter Mieux aux copropriétés
HTCIKNGU +N UŨCIKV FŨWPG CKFG EQNNGEVKXG RQWT ƒPCPEGT NŨCUUKU
VCPEG ȃ OCȑVTKUG FŨQWXTCIG GV NGU VTCXCWZ FG TȌPQXCVKQP
ȌPGTIȌVKSWG FCPU NGU RCTVKGU EQOOWPGU LWUSWŨȃ   Ż
par logement.
• Pour les propriétaires occupants
.GU RNCHQPFU FG TGUUQWTEGU  RQWT DȌPȌƒEKGT FGU CKFGU
FG NŨ#PCJ QPV ȌVȌ OKU ȃ LQWT GV UQPV EQPUWNVCDNGU UWT NG UKVG
de l’Agence.
.ŨCUUKUVCPEG ȃ OCȑVTKUG FŨQWXTCIG FCPU NG ECFTG FŨWP RTQLGV
© photo 5000

FG TȌPQXCVKQP RGWV ȌICNGOGPV ȍVTG RTKUG GP EJCTIG


OQPVCPV
entre 475 et 821 € selon la nature des travaux entrepris).

25 millions de Propriétaires - Mars 2017 11


ACTUALITÉS

Vers des petites annonces


plus claires ?
Paru au Journal Officiel du 18 janvier 2017, un arrêté(1) découlant de la loi ALUR impose
de nouvelles obligations aux professionnels qui mettent en relation acquéreurs ou
locataires et vendeurs ou bailleurs de biens immobiliers.

À compter du 1er avril 2017, les agents kštout comprisšzEŨGUVȃFKTGNGRTKZFWNQ[GT En plus de ces obligations, le barème
immobiliers mettant en relation des ache- pour un mois augmenté le cas échéant du des prix des prestations proposées par
teurs ou des locataires avec un propriétaire complément de loyers et des charges récu- un professionnel de l’immobilier devra
UGTQPVUQWOKUȃFCXCPVCIGFGEQPVTCKPVGU RȌTCDNGUUWKXKFGNCOGPVKQPkšpar moisšz obligatoirement être affiché en vitrine
lors de la publication de leurs annonces. GVUŨKN[CNKGWFGNCOGPVKQPkšcharges mais aussi sur son site internet.
Les annonces de vente devront EQORTKUGUšz'NNGURTȌEKUGTQPVȌICNGOGPV
systématiquement préciser le prix de le montant total TTC des honoraires du
cession du bien, ainsi que la commission RTQHGUUKQPPGNOKUȃNCEJCTIGFWNQECVCKTG
FGNŨCIGPVGVȃSWKKPEQODGNGRCKGOGPVFG notamment ceux facturés pour l’état des Point de vue
ses honoraires. Ces prix seront indiqués lieux. La surface habitable exprimée en m²
VQWVGUVCZGUEQORTKUGU
66% GVNCVCKNNG GVNGNKGWFGUKVWCVKQPFWDKGP
EQOOWPG 
des caractères du prix du bien mentionné seront également mentionnés, dans le
«šJQPQTCKTGUKPENWUšzUGTCRNWUKORQTVCPVG but de permettre aux futurs locataires
que celle du prix du bien hors honoraires. GVKPXGUVKUUGWTUFGXȌTKƒGTNGTGURGEVFW
À noter également l’obligation qui est plafonnement des honoraires de location
HCKVGCWZRTQHGUUKQPPGNUFGNŨKOOQDKNKGTš créé par la loi ALUR. Pour les biens situés
kšLe prix de vente ne peut en aucun cas en zone tendue, la mention du montant
inclure les part des honoraires à la charge du complément de loyer exigé et celui du
du vendeuršz dépôt de garantie éventuellement réclamé
Les annonces de location devront ainsi que le caractère meublé de la location
comprendre le montant du loyer mensuel devront être précisés.
3 questions à Frédéric
Pélissolo, président de
l’UNPI Paris
Comment analysez-vous ce
PQWXGCWVGZVGǡ!

Si je me place du côté du vendeur d’un


DKGPKOOQDKNKGTOCRTGOKȋTGTȌCEVKQPGUV
FGFKTGSWGNCTȌINGOGPVCVKQPPGFQKVRCU
UGTGVQWTPGTEQPVTGNŨCURGEVkšEQOOGTEKCNšz
FŨWPGXGPVGCWUGPUPQDNGFWVGTOG
© philippe Devanne

1TEGVVGPQWXGNNGTȌINGOGPVCVKQPSWKHCKV
UWKVGȃWPGRNWUCPEKGPPGKUUWGPQVCOOGPV
de la loi ALURNCSWGNNGRTȌXQ[CKVFȌLȃWP

12 25 millions de Propriétaires - Mars 2017


ACTUALITÉS
EGTVCKPPQODTGFŨKPHQTOCVKQPUEQORNGZKƒG CXGEFGUJQPQTCKTGUFGššŻȃNCEJCTIG recours contre les propriétaires. C’est un
les choses et va à l’encontre de la relation FWXGPFGWTEGNWKEKRC[GTCššŻȃNŨCIGPV DQWNGVFGRNWUȃNGWTRKGFšБ+NOGUGODNG
commerciale. l’immobilier (le prix net vendeur est donc de SWŨWPGCPPQPEGFGOKUGGPNQECVKQPGUV
#WLQWTFŨJWKEJCEWPUCKVSWGRQWTFGUDKGPU ššŻ %ŨGUVENCKTšБ/CKUUKNŨQPPGRGWVNG avant tout une première approche simpli-
RCTVKEWNKGTUFKVUFŨGZEGRVKQPXQKTGFŨWPGVTȋU OGPVKQPPGTFCPUNŨCPPQPEGNGRTKZCPPQPEȌ ƒȌG
NQECNKUCVKQPFWDKGPECTCEVȌTKUVKSWGU
ITCPFGXCNGWTNGRTQRTKȌVCKTGGVUQPOCPFC- FGššŻGUVCNQTUGTTQPȌEGPŨGUVRNWU RTKPEKRCNGUŲ FŨWPUWLGVSWKUGFȌXGNQRRG
taire ne mentionnaient pas le prix mais le prix de vente. Les organisations profes- ultérieurement (si le potentiel candidat à la
KPFKSWCKGPVkš2TKZšPQWUEQPUWNVGTšz7PG sionnelles se sont donc réunies pour un NQECVKQPGUVKPVȌTGUUȌ ȃVTCXGTUWPGƒEJG
EGTVCKPGEQPƒFGPVKCNKVȌȌVCKVUQWJCKVȌGSWG recours en Conseil d’État car une précision VGEJPKSWGRTȌEKUG
PGRGTOGVRNWUNŨCTTȍVȌQDNKIGCPVNŨCPPQPEGWT GUVPȌEGUUCKTG%GTVCKPUFKUGPVSWŨKNHCWFTC (KPCNGOGPVEGVGZVGUŨKNGUVRGWVȍVTGRQUKVKH
à mentionner le prix. KPUȌTGTFGWZRTKZFCPUNŨCPPQPEGOCKUNȃWP pour l’information des candidats à l’acces-
2CTCKNNGWTUNGVGZVGPŨJQOQIȌPȌKUGRCUNC PQWXGCWRTQDNȋOGUWTIKVšUKNGUJQPQTCKTGU sion à la propriété constitue tout de même
notion de surface des annonces de vente UQPVȃNCEJCTIGFWXGPFGWTQPXCEQOOW- WPGPQWXGNNGFȌTKXGTȌINGOGPVCKTG'VRNWU
(loi Carrez) et de location (loi Boutin). On PKSWGTȃNŨCESWȌTGWTWPGKPHQTOCVKQPSWŨKNPŨC ITCXGKNXCEQPFWKTGȃNŨWPKHQTOKUCVKQPFGU
CWTCKVGURȌTȌWPGUKORNKƒECVKQPŲ RCUȃEQPPCȑVTGŲ%ŨGUVWPGKPFKUETȌVKQPCW annonces immobilières sans permettre la
TGICTFFWEQPVTCVSWKNKGNGURCTVKGUšБ XCNQTKUCVKQPFGUFKHHȌTGPEGUFGUDKGPUŲEG
Selon vous présente-t-il des SWGFGXTCKVRGTOGVVTGNGECTCEVȋTGEQOOGT-
KPEQJȌTGPEGUVGEJPKSWGUǡ! Et s’agissant des annonces de EKCNFGUCPPQPEGUšБ
7PGRJTCUGFGNŨCTTȍVȌGUVKPEQORTȌJGPUKDNG NQECVKQPǡ!
EGSWKGUVGZVTȍOGOGPVGPPW[GWZškš.GRTKZ %ȖVȌNQECVKQPQPRGWVUŨȌVQPPGTFGXQKT
de vente ne peut en aucun cas inclure la part l’insertion obligatoire de la mention d’un
ššš#TTȍVȌFWLCPXKGTTGNCVKHȃNŨKPHQTOCVKQPFGUEQPUQO-
FGUJQPQTCKTGUȃNCEJCTIGFWXGPFGWTšz ȌXGPVWGNEQORNȌOGPVFGNQ[GTŲȃOQKPU mateurs par les professionnels intervenant dans une transaction
'PGHHGVUKWPDKGPGUVXGPFWššŻ de vouloir faciliter encore davantage les KOOQDKNKȋTG
014ǡ'%(%#

Investissement locatif :
le business juteux de la cave et des surfaces de stockage !
Alors que l’immobilier locatif « classique » peu de travaux, charges quasi-inexistantes et
plafonne péniblement à 4 % de rendement, la taux de vacance extrêmement faible.
location de surfaces destinées au stockage - Surfant sur cette tendance, le site Inter net
cave, garage ou petit entrepôt - atteint, elle, Jestocke.com a développé un service simple
plus de 10 % par an. Treize fois plus que le e t e ff i c a c e p o u r l o u e r c e s p r é c i e u x m 2 e n
rendement du Livret A ! toute sécurité. Gratuit pour les propriétaires,
Si le business de la location de petites surfaces il offre toutes les garanties nécessaires :
de stockage se porte si bien, c’est qu’il est contrats de location adaptés, assurance à la
tiré par une demande croissante. En effet, un c h a r g e d e s l o c a t a i re s e t l o y e r s v e r s é s s a n s
Français sur deux manque de place et le taux frais. Jestocke.com propose également
de mobilité locative est en hausse constante. une estimation gratuite de la rentabilité du
Résultat : les Français ont besoin d’une pièce bien quelle que soit la surface ou zone
en plus pour stocker leurs affaires. Cette forte géographique.
demande fait logiquement grimper les loyers.
PUBLI-RÉDACTIONNEL

Autre atout considérable pour le propriétaire : Pour toute information


louer ce type de surfaces est bien moins risqué Tél. 01 76 42 00 01
que de louer un studio ou un appartement. Une contact@jestocke.com
législation bien moins contraignante, pas ou Site internet : www.jestocke.com

25 millions de Propriétaires - Mars 2017 13


DOSSIER

Nombreuses sont les interrogations des propriétaires bailleurs lors de la conclusion du bail
d’habitation, en cours d’exécution et en fin de contrat, lorsqu’ils louent à un couple. Mais
qu’entend-on par couple ? Une définition s’impose pour mesurer les incidences sur le bail
lorsque, par exemple, le couple se crée postérieurement à la signature du contrat ou en cas de
séparation du couple en cours de bail… Quelles sont les obligations du propriétaire bailleur
en termes de congé ? Qui est redevable du loyer en cas de séparation ?
Notre étude sera essentiellement centrée sur le bail d’habitation relevant de la loi du 6 juillet
1989, cadre juridique le plus courant pour assurer le logement de la famille.

Me Frédérique Polle
avocat au Barreau d’Agen, ancien Bâtonnier

Louer à un couple :
quelles sont
les règles ?

© goodluz

14 25 millions de Propriétaires - Mars 2017


DOSSIER

3WGNEQWRNGǡ! dissolution du pacte civil de solidarité, l’un

Être un couple, vivre en couple, c’est être


des partenaires peut saisir le juge compé-
VGPVGPOCVKȋTGFGDCKNCWZƒPUFGUGXQKT
Qu’en
FGWZXKXTGȃFGWZ#XGENCTGEQPPCKUUCPEG
législative du mariage pour tous, le couple du
attribuer le droit au bail du local, qui sert
GHHGEVKXGOGPVȃNŨJCDKVCVKQPFGUFGWZRCTVG-
est-il des
XXIèmeUKȋENGRQWTTCKVRCTCȑVTGRTQVȌKHQTOGš
en réalité, il n’en est rien, car peu importe
naires, sous réserve des créances ou droits
ȃKPFGOPKVȌCWRTQƒVFGNŨCWVTGRCTVGPCKTG
concubins ?
le sexe des époux ou des partenaires liés .GDCKNNGWTGUVCRRGNȌȃNŨKPUVCPEG.GLWIG 4CRRGNQPUNCFȌƒPKVKQPFWEQPEWDK-
par un pacte civil de solidarité, les principes apprécie la demande en considération des PCIGVGNSWGRTȌXWȃNŨCTVKENG
demeurent. intérêts sociaux et familiaux des parties. FW%QFGEKXKNšKNUŨCIKVFŨWPGWPKQPFG
Au sens du Code civil et de la loi du 6 juillet .CNQKFKVGkšMacronšzGUVȌICNGOGPVXGPWG fait, caractérisée par une vie commune
NGEQWRNGUGFȌƒPKVȃNCNWOKȋTGFWRTKP- préciser que les nouvelles règles relatives présentant un caractère de stabilité et
cipe de co-titularité et de ses conséquences ȃNŨGZVGPUKQPFGNCEQVKVWNCTKVȌNȌICNGCWZ de continuité, entre deux personnes,
sur le contrat de bail. Ainsi, la distinction doit RCTVGPCKTGURCEUȌUȃNŨCVVTKDWVKQPLWFKEKCKTG de sexe différent ou de même sexe,
être faite, d’une part, entre le couple uni par FWDCKNUWKVGȃWPGTWRVWTGFW2CEUQW qui vivent en couple.
le mariage ou par un PACS, et d’autre part, encore au droit exclusif du partenaire pacsé .GVGTOGFGkšEQWRNGšzGUVDKGPTGRTKU
les concubins et les colocataires. survivant, s’appliquent aux baux en cours s’agissant du concubinage, puisque
S’agissant du mariage, nous rappellerons à compter du 8 août 2015. EGNCTGEQWXTGWPGXKGȃFGWZ
UKORNGOGPVSWŨKNGUVEQFKƒȌCWZCTVKENGU Pourtant, malgré la stabilité et la
ȃFW%QFGEKXKN.G2#%5GUVFȌƒPK Ces textes instaurent ainsi une véritable continuité de leur vie commune, les
ȃNŨCTVKENGFGEGOȍOGEQFGǡEŨGUV EQVKVWNCTKVȌNȌICNGCWDȌPȌƒEGFWEQWRNG concubins se trouvent exclus de la
un contrat conclu par deux personnes marié ou pacsé. cotitularité légale par les textes et
physiques majeures, de sexe différent notamment l’article 1751 du Code civil.
ou de même sexe, pour organiser leur vie Les concernant, la cotitularité ne peut
commune. ȍVTGSWGEQPXGPVKQPPGNNGEŨGUVȃFKTG
.ŨCTVKENGFW%QFGEKXKNOQFKƒȌRCTNC expressément prévue au contrat de
NQK#.74FWOCTUFKURQUGSWGkšle La vie du couple bail.
FTQKVCWDCKNFWNQECNUCPUECTCEVȋTGRTQHGU-
UKQPPGNQWEQOOGTEKCNSWKUGTVGHHGEVKXGOGPV ou faire et défaire… 0ȌCPOQKPUNGEQPEWDKPkšPQVQKTGšz
EŨGUVȃFKTGEGNWKSWKRGWVLWUVKHKGT
à l’habitation de deux épouxSWGNSWGUQKV Nous examinerons successivement l’union,
avoir vécu avec le locataire pendant
leur régime matrimonial et nonobstant toute puis la désunion, lors de la conclusion et en
CWOQKPUWPCPDȌPȌƒEKGFŨWPGFQWDNG
convention contraire et même si le bail a été EQWTUFGDCKNRWKUGPƒPFGDCKN
RTQVGEVKQPš
EQPENWCXCPVNGOCTKCIGQWde deux parte-
naires liés par un pacte civil de solidaritéFȋU ššGP ECU FŨCDCPFQP FW NQIGOGPV
NQTUSWGNGURCTVGPCKTGUGPHQPVNCFGOCPFG L’union par son concubin, le contrat de bail
EQPLQKPVGOGPVGUVTȌRWVȌCRRCTVGPKTȃNŨWP EQPVKPWGȃUQPRTQƒV
Lors de la conclusion du contrat et en
et à l’autre des époux ou partenaires liés par ššGPECUFGFȌEȋUFGUQPEQPEWDKPNG
cours de bail
un pacte civil de solidarité. contrat de bail lui est transféré.
'PECUFGFKXQTEGQWFGUȌRCTCVKQPFGEQTRU 'PRTȌUGPEGFŨWPEQWRNGFȌLȃOCTKȌCXCPV Quant aux colocataires, la cotitularité
EGFTQKVRQWTTCȍVTGCVVTKDWȌGPEQPUKFȌTCVKQP la signature du contrat de bail, peu importe GUVGZENWUKXGOGPVEQPXGPVKQPPGNNGǡGV
FGUKPVȌTȍVUUQEKCWZGVHCOKNKCWZGPECWUGRCT que le contrat soit signé par un seul époux FȌUQTOCKUNCEQNQECVKQPGUVEQFKƒȌG
la juridiction saisie de la demande en divorce ou par les deux. ȃNŨCTVKENGFGNCNQKFWLWKNNGV
QWGPUȌRCTCVKQPFGEQTRUȃNŨWPFGUȌRQWZ En effet, le conjoint non signataire du bail de sorte que nous n’aborderons pas
sous réserve des droits à récompense ou à est de facto titulaire du bail car il acquiert de cette situation particulière.
KPFGOPKVȌCWRTQƒVFGNŨCWVTGȌRQWZ manière automatique la qualité de locataire
En cas de décès d’un des époux ou d’un des par l’effet de l’article 1751 du Code civil.
RCTVGPCKTGUNKȌURCTWPRCEVGEKXKNFGUQNKFCTKVȌ Par l’effet de ce même article, en cas de soit leur régime matrimonial et nonobstant
le conjoint ou le partenaire lié par un pacte mariage intervenant en cours de bail, le toute convention contraire et même si le bail
civil de solidarité survivant cotitulaire du bail conjoint n’ayant pas signé le contrat de CȌVȌEQPENWCXCPVNGOCTKCIG
Ų GUVTȌRWVȌ
dispose d’un droit exclusif sur celui-ci sauf location devient titulaire du bail, par le CRRCTVGPKTȃNŨWPGVȃNŨCWVTGFGUȌRQWZšz
UŨKN[TGPQPEGGZRTGUUȌOGPVšz UKORNGGHHGVFWOCTKCIGš Il en est de même pour le couple lié par
La loi du 24 mars 2014 a créé un article kš.GFTQKVCWDCKNFWNQECN
Ų SWKUGTVGHHGEVK- WP2#%5ȃNCEQPFKVKQPVQWVGHQKUSWGNGU
1751-1 au Code civil, stipulant qu’en cas de XGOGPVȃNŨJCDKVCVKQPFGFGWZȌRQWZSWGNSWG partenaires fassent une demande conjointe

25 millions de Propriétaires - Mars 2017 15


DOSSIER
auprès du bailleur pour que le logement pacsé dont il ignore l’existence. NQECVCKTG C ȌVȌ FȌENCTȌG QRRQUCDNG ȃ UQP
UQKVTȌRWVȌCRRCTVGPKTȃNŨWPGVȃNŨCWVTG Or, en pratique, ce défaut d’information pour- EQPLQKPV
%CUU%KXème 29 octobre 2013 -
des partenaires liés par un pacte civil de rait être préjudiciable au bailleur, s’agissant n°12-231-38).
solidarité. FGU PQVKƒECVKQPU SWŨKN RGWV ȍVTG COGPȌ ȃ
À noter que le bailleur ne peut pas s’opposer effectuer en cours de bail. Dans le même sens, la Cour d’appel de Lyon,
ȃEGVVGFGOCPFGGVGPVQWVȌVCVFGECWUG Aussi, pour éviter que le bailleur ne subisse dans un arrêt du 2 juillet 2015, a jugé que
n’y a pas intérêt. les conséquences d’une cotitularité qu’il le fait que les quittances de loyer aient
Rappelons que les dispositions de l’article KIPQTG OCKU SWK UŨKORQUG ȃ NWK FG RNGKP FTQKV été établies en cours de bail au nom du
1751 du Code civil ne sont pas applicables en vertu de l’article 1751 du Code civil, la locataire et de son épouse, ne démontrait
aux concubins. loi du 6 juillet 1989 comporte un article pas l’existence d’une démarche positive
Si les concubins ont signé conjointement 9-1 depuis la loi du 13 décembre 2000, du mari pour informer le bailleur de son
NGDCKNKNUDȌPȌƒEKGPVVQWUFGWZFWEQPVTCV UGNQP NGSWGN  mariage. De ce fait, le commandement de
de location et chacun est réputé locataire, k .GU PQVKƒECVKQPU QW UKIPKƒECVKQPU HCKVG RCT payer délivré au seul mari a été déclaré
avec tous les droits et obligations qui en le bailleur sont de plein droit opposables au QRRQUCDNG ȃ NŨȌRQWUG
%# .[QP  ème ch.
FȌEQWNGPVXKUȃXKUFWDCKNNGWT RCTVGPCKTG NKȌ RCT WP 2#%5 CW NQECVCKTG QW  LWKNNGV  Po  
À défaut de signature conjointe du bail, CW EQPLQKPV FW NQECVCKTG UK NŨGZKUVGPEG FG L’ article 9-1 de la loi du 6 juillet 1989
seul le concubin signataire a la qualité de ce partenaire ou de ce conjoint n’a pas été GUV ƒPCNGOGPV RTQVGEVGWT FGU KPVȌTȍVU FW
NQECVCKTGšNŨCWVTGEQPEWDKPPŨCCWEWPFTQKV préalablement portée à la connaissance du bailleur, lequel pourra mettre en échec les
PKCWEWPGQDNKICVKQPXKUȃXKUFWDCKNNGWT bailleur z tentatives des locataires de soulever des
lequel ne pourra pas invoquer une solidarité Ainsi, si le bailleur a été informé de l’exis- nullités de procédure au motif que les noti-
en cas d’impayés. tence d’un conjoint, il doit respecter la ƒECVKQPU PŨCWTCKGPV RCU ȌVȌ HCKVGU CWZ FGWZ
FQWDNG PQVKƒECVKQP CWZ ȌRQWZ époux... si le locataire est dans l’incapacité
Quelles sont les conséquences d’un
S’il n’a pas été informé de l’existence de de rapporter la preuve d’une démarche
défaut d’information du bailleur par le
EG EQPLQKPV NGU PQVKƒECVKQPU
QW UKIPKƒ- positive d’information du bailleur.
locataire nouvellement marié ou
cations) faites au seul locataire connu du Ainsi que nous le rappelions plus haut,
RCEUȌǡGPEQWTUFGDCKN!
propriétaire sont de plein droit opposables ces principes s’appliquent aussi bien aux
La cotitularité de l’article 1751 du Code civil ȃ UQP EQPLQKPV époux mariés qu’aux partenaires liés par
s’impose au bailleur, même tenu par son un PACS.
.C RTGWXG FG NŨKPHQTOCVKQP  RCT SWK GV
locataire dans l’ignorance du changement
EQOOGPV ! Les obligations du couple en cours de
FGUCUKVWCVKQPHCOKNKCNG
OCTKCIGQW2#%5 
DCKNǡSWKRCKGSWQKǡ!
En effet, le locataire n’est tenu d’aucune C’est au locataire qu’il incombe de rapporter
obligation d’information sur sa situation NC RTGWXG FG NŨKPHQTOCVKQP FQPPȌG ȃ UQP En vertu de l’article 220 du Code civil,
matrimoniale et il n’appartient pas au bail- bailleur, de son mariage ou de son PACS chacun des époux a pouvoir pour passer
leur d’enquêter sur ses locataires, d’autant en cours de bail. seul les contrats qui ont pour objet l’entre-
SWŨKNCWTCFGITCPFGUFKHƒEWNVȌUȃUŨKPHQTOGT Selon la jurisprudence, l’information du tien du ménage ou l’éducation des enfants,
sur l’identité d’un conjoint ou d’un partenaire bailleur doit résulter d’une démarche posi- et toute dette ainsi contractée par l’un
tive du locataire. oblige l’autre solidairement, sauf si les
'P RTCVKSWG QP GPVGPF RCT k démarche dépenses sont manifestement excessives.
RQUKVKXG z NŨGPXQK FŨWPG NGVVTG NCSWGNNG UGTC Ainsi, et comme nous l’avons vu, un seul
de préférence sous la forme recommandée époux peut signer le bail.
avec avis de réception. Pour autant, chaque époux est respon-
Ainsi, le fait que les loyers soient payés par UCDNGPQVCOOGPVXKUȃXKUFWDCKNNGWTFW
EJȋSWGU DCPECKTGU CW PQO FG NŨȌRQWUG k ce paiement des loyers et charges.
SWG PG RQWXCKV RCU KIPQTGT NG DCKNNGWT z GUV Les époux étant tenus solidairement par
KPUWHƒUCPV ȃ ECTCEVȌTKUGT WPG FȌOCTEJG la loi, le bailleur n’a aucune obligation
positive. de poursuivre les deux époux et peut, au
Dans cette hypothèse, le bailleur n’ayant pas contraire, solliciter la condamnation de
été informé directement par le locataire de NŨWPSWGNEQPSWGFGUȌRQWZȃNŨGZENWUKQP
son changement de situation matrimoniale, de l’autre.
et le locataire étant dans l’incapacité d’en Le régime juridique est le même pour les
© Antonioguillem

rapporter la preuve par la production d’un partenaires liés par un PACS, lesquels sont
EQWTTKGT CFTGUUȌ ȃ UQP DCKNNGWT NC RTQEȌ- également solidairement responsables
FWTG FŨGZRWNUKQP GPICIȌG ȃ NŨGPEQPVTG FW des dettes contractées par l’un d’eux pour

16 25 millions de Propriétaires - Mars 2017


DOSSIER
NGUDGUQKPUFGNCXKGEQWTCPVG
GVFQPE
des loyers et charges) par application de …Et les partenaires pacsés ?
l’article 515-4 du Code civil.
Qu’ils soient cotitulaires ou non, les partenaires pacsés sont solidairement tenus du
S’agissant des concubins, quand bien
RCKGOGPVFGUNQ[GTUGVEJCTIGUSWCNKƒȌUFGFȌRGPUGUFGNCXKGEQWTCPVG
même ils auraient signé tous les deux le
.CUQNKFCTKVȌEGUUGGPECUFGTWRVWTGFW2#%5OCKUȌICNGOGPVNQTUSWGNGDCKNRTGPFƒP
DCKNEJCEWPTGUVGVGPWȃVKVTGRGTUQPPGN
RCTNŨGHHGVFŨWPEQPIȌFQPPȌRCTNGUFGWZRCTVGPCKTGUQWUWKVGȃWPGTȌUKNKCVKQPFWDCKN
sauf si le contrat de bail contient une
clause de solidarité. L’attribution du logement du couple pacsé, en cas de séparation, est désormais prévue
Le bailleur aura tout de suite compris la ȃNŨCTVKENGFW%QFGEKXKNETȌȌRCTNCNQK#.74FWOCTU
nécessité de prévoir une telle clause de 5WKVGȃNCTWRVWTGFW2#%5NŨWPFGURCTVGPCKTGURGWVFȌUQTOCKUUQNNKEKVGTNŨCVVTKDWVKQP
UQNKFCTKVȌNQTUSWŨKNNQWGTCȃFGUEQPEWDKPUŲ LWFKEKCKTGȃUQPRTQƒVFWFTQKVCWDCKNFWNQIGOGPV
.GLWIGEQORȌVGPVGUVEGNWKFWDCKNEŨGUVȃFKTGNGVTKDWPCNFŨKPUVCPEGGVNGDCKNNGWT
FQKVȍVTGCRRGNȌȃNŨKPUVCPEG
.G EQWRNG GV NC ƒP FW DCKN
Comme pour le divorce, le juge tient compte des intérêts sociaux et familiaux, et
notamment le lieu de résidence des enfants communs.
.CƒPFWDCKNRCTNCFȌNKXTCPEGFŨWP
congé .GDCKNNGWTȌVCPVCRRGNȌȃNCRTQEȌFWTGCVQWVKPVȌTȍVȃȍVTGRTȌUGPV
QWTGRTȌUGPVȌ ȃ
l’audience pour faire valoir sa position.
•šš2CTNGNQECVCKTG 'PGHHGVUQWUTȌUGTXGFGNŨCRRTȌEKCVKQPUQWXGTCKPGFWLWIGKNRGWVUŨQRRQUGTȃNŨCVVTK-
Pour être valable, le congé doit être donné
DWVKQPLWFKEKCKTGFWFTQKVCWDCKNCWRTQƒVFGNŨWPFGURCTVGPCKTGUUŨKNUŨCXȋTGSWGUC
par chacun des époux ou partenaires
UQNXCDKNKVȌGUVKPUWHƒUCPVGRQWTICTCPVKTNGRCKGOGPVFWNQ[GTQWDKGPFGOCPFGTSWG
pacsés.
cette attribution judiciaire soit assortie d’un engagement de caution.
Concrètement, chaque époux ou partenaire
pacsé doit adresser une lettre de congé
au bailleur. manière décalée, c’est le deuxième congé vrer congé par acte d’huissier. En effet,
Le congé donné par un seul des époux n’a PQVKƒȌGPEQOOWPSWKEQPUVKVWGTCNGRQKPV FCPUEGECUNGEQPIȌUGTCDKGPUKIPKƒȌȃ
CWEWPGHHGVȃNŨȌICTFFGNŨCWVTGNGSWGNTGUVG de départ du délai de préavis. chaque époux, selon les règles applicables
titulaire du bail par l’effet de la cotitularité. aux actes d’huissier.
Ainsi, le congé délivré par l’épouse ne met •šš2CTNGDCKNNGWT 6QWVGHQKU KN EQPXKGPV FŨCXQKT ȃ NŨGURTKV
RCUƒPCWDCKNVCPVSWGNGOCTKPŨCRCU 6QWVCEVGSWŨWPDCKNNGWTRGWVȍVTGȃOȍOG les dispositions de l’article 9-1 de la loi
lui-même donné congé, même s’il n’habite FŨCFTGUUGTȃUQPNQECVCKTGFQKVȍVTGPQVKƒȌ du 6 juillet 1989 qui limitent l’obligation
plus les lieux. aux deux époux ou partenaires pacsés, FGFQWDNGPQVKƒECVKQPUKNGDCKNNGWTCȌVȌ
Dans l’hypothèse où les époux ou les parte- compte tenu de la cotitularité. tenu dans l’ignorance de l’existence d’un
naires pacsés donnent chacun congé de +NGPGUVCKPUKFWEQPIȌ
SWGNSWŨGPUQKV conjoint ou d’un partenaire pacsé, en
le motif). cours de bail.
Le bailleur qui entend donner congé, doit le Sont visées, toutes les notifications et
PQVKƒGTRCTFGUNGVVTGUFKUVKPEVGUCFTGUUȌGU UKIPKƒECVKQPUHCKVGUGPCRRNKECVKQPFGNCNQK
ȃEJCSWGȌRQWZQWȃEJCSWGRCTVGPCKTG FWLWKNNGVȃUCXQKTNGUEQPIȌUNGU
pacsé. offres de renouvellement, les sommations
À défaut, le congé est inopposable au
FGRC[GTFGLWUVKƒGTFGNŨCUUWTCPEGŲ NGU
conjoint ou au partenaire pacsé qui ne EQOOCPFGOGPVU FG RC[GTŲ
l’a pas reçu.
.CƒPFWDCKNRCTNŨGHHGVFGNCTȌUKNKCVKQP
Dans le même sens, est nul le congé
judiciaire
XKUCPV k /QPUKGWT QW /CFCOG z RWKUSWŨKN
ne concerne pas les deux époux, mais soit Rappelons brièvement que le bail d’habi-
l’un, soit l’autre. VCVKQPRGWVȍVTGTȌUKNKȌȃNCUWKVGFŨWPG
De même, le bailleur doit être vigilant s’il décision de justice, par l’effet de la clause
donne congé par lettre recommandée, résolutoire en cas de non paiement des
laquelle doit impérativement être signée loyers ou de défaut d’assurance, ou pour
par son destinataire. manquements aux obligations du locataire,
Un accusé de réception signé par le conjoint par exemple en cas de défaut de jouissance
ne peut pas engager le destinataire de la paisible.
© goodluz

lettre et le congé lui sera inopposable. 2CTHQKUȌICNGOGPVUKȃNCUWKVGFŨWPEQPIȌ


.G DCKNNGWT C FQPE VQWV KPVȌTȍV ȃ HCKTG FȌNK- FȌNKXTȌRCTNGDCKNNGWT
EQPIȌRQWTXGPFTG

25 millions de Propriétaires - Mars 2017 17


DOSSIER
et d’une manière plus générale, de toutes
NGUQDNKICVKQPUEQPVTCEVWGNNGUȃEQORVGT
de cette transcription.
Il en est de même en cas de jugement de
séparation de corps, l’époux séparé de
corps qui n’occupe plus le logement, n’est
plus tenu au paiement des loyers afférents
au logement commun.
En matière de divorce ou de séparation de
corps, la question du sort du logement de
la famille se pose au stade de l’audience
de conciliation et au stade de la procédure
CWZƒPUFGRTQPQPEȌFWFKXQTEG

.ŨCWFKGPEGFGEQPEKNKCVKQPǡNGUOGUWTGU
provisoires
Il s’agit de la première étape de la procé-

© lenets_tan
dure de divorce, lorsque l’un des époux a
déposé une requête en divorce, demandant
la convocation de son conjoint.
EQPIȌCWZƒPUFGTGRTKUGRQWTJCDKVGT  pacsés se maintient dans les lieux après Lors de cette audience, le juge autorise
les locataires restent en place, le bail- la résiliation du bail, la cotitularité ayant NGUȌRQWZȃTȌUKFGTUȌRCTȌOGPVGVUVCVWG
NGWTRGWVUCKUKTNGVTKDWPCNFŨKPUVCPEGȃ cessé au terme du bail, seul celui qui se UWTNŨCVVTKDWVKQPȃNŨWPQWNŨCWVTGFGUȌRQWZ
l’effet d’obtenir une décision constatant maintient dans les lieux reste tenu du du logement commun, et notamment du
la résiliation du bail par l’effet du congé paiement des indemnités d’occupation, logement loué.
et ordonnant l’expulsion des locataires. en tant qu’occupant effectif. Il s’agit d’une mesure provisoire, destinée
Dans tous les cas, le bailleur ayant l’ini- Actionné par son bailleur en paiement des ȃQTICPKUGTNCXKGFGNCHCOKNNGRGPFCPVNC
tiative de la procédure, doit, s’il connaît indemnités d’occupation nées de son seul procédure de divorce.
l’existence des deux époux ou des deux chef, il ne peut pas se retourner contre son Il est important que les propriétaires bail-
RCTVGPCKTGURCEUȌUUKIPKƒGTVQWUNGUCEVGU conjoint pour obtenir sa condamnation leurs connaissent les effets de la décision
ȃEJCEWPFGUȌRQWZQWFGURCTVGPCKTGU solidaire. du juge conciliateur en matière d’attribution
pacsés. FGNCLQWKUUCPEGFWNQIGOGPVEQOOWPȃ
Cependant, en vertu de l’article 9-1 de la l’un des époux, sur le contrat de bail.
loi du 6 juillet 1989, si le bailleur a été 'PGHHGVEQPVTCKTGOGPVȃEGSWGUQWVKGPV
tenu dans l’ignorance de l’existence d’un UQWXGPVNŨȌRQWZ
UG SWKPGEQPUGTXGRCU
conjoint ou d’un partenaire pacsé, en cours la jouissance du logement commun, ce
FGDCKNNŨGZKIGPEGFGNCFQWDNGPQVKƒECVKQP La désunion… ou de l’effet du dernier reste solidairement tenu du paie-
ne s’applique pas. divorce ou de la séparation de ment régulier des loyers et charges, tant
2TȌEKUQPUSWGNQTUSWGNGDCKNRTGPFƒP corps sur le contrat de bail SWGNGFKXQTEGPŨGUVRCUFȌƒPKVKH
par l’effet d’un congé ou d’une résiliation Le fait que le bailleur soit informé de la
LWFKEKCKTGȃNŨȌICTFFGFGWZȌRQWZQWFG Tant que les époux sont encore dans les séparation des époux et de l’attribution
deux partenaires pacsés, le principe de liens du mariage, la solidarité demeure. FWNQIGOGPVȃNŨWPFGWZPŨCRCUFŨKPEK-
solidarité subsiste jusqu’au terme du bail, Ce n’est que du jour où le divorce est FGPEGUWTUQPFTQKVȃRQWTUWKXTGNŨȌRQWZ
ȃUCXQKTSWGEJCEWPTGUVGVGPWXKUȃXKU transcrit sur les registres de l’état civil non occupant, en paiement des loyers et
du bailleur, de l’ensemble des obligations
GP OCTIG FG NŨCEVG FG OCTKCIG SWG NC EJCTIGUKORC[ȌURQUVȌTKGWTGOGPVȃNC
KPJȌTGPVGUȃNCƒPFWDCKN
RCKGOGPVFGU solidarité cesse. La transcription marque décision du juge.
loyers pendant le préavis, établissement de GP GHHGV NG ECTCEVȋTG FȌƒPKVKH FW LWIGOGPV &GOȍOGNŨGPICIGOGPVRTKURCTNŨȌRQWZ
UG 
NŨȌVCVFGUNKGWZHTCKUFGTGOKUGGPȌVCVŲ  de divorce, lequel devient opposable aux qui se voit attribuer la jouissance du loge-
Le bailleur pourra ainsi indifféremment se VKGTU ȃ EGVVG FCVG UGWNGOGPV ment, devant le juge aux affaires familiales,
retourner contre l’un ou contre l’autre des L’époux divorcé qui a quitté le logement de régler les loyers pendant la procédure
époux ou des partenaires pacsés. NQWȌ PŨGUV RNWU TGFGXCDNG XKUȃXKU FW DCKN- de divorce, ne prive pas le bailleur de son
Mais si l’un des époux ou des partenaires leur, du paiement du loyer et des charges, FTQKVȃRQWTUWKXTGNŨCWVTGȌRQWZGPRCKGOGPV

18 25 millions de Propriétaires - Mars 2017


DOSSIER
des loyers et charges. L’article 1751 alinéa 2 du Code civil stipule
+NGUVKPWVKNGFGPQVKƒGTCWDCKNNGWTNŨQTFQP- qu’en cas de divorce ou de séparation de
PCPEGFGPQPEQPEKNKCVKQPšGPXGTVWFG corps, le droit au bail du local qui sert
l’article 220 du Code civil, la solidarité GHHGEVKXGOGPV ȃ NŨJCDKVCVKQP FGU FGWZ
entre époux demeure et ne cesse que époux, peut être attribué, en considération
par application de l’article 262 du même des intérêts sociaux et familiaux en cause,
code, lequel rappelle que le jugement de par la juridiction saisie de la demande en
divorce est opposable aux tiers, en ce qui FKXQTEGQWGPUȌRCTCVKQPFGEQTRUȃNŨWP
EQPEGTPGNGUDKGPUFGUȌRQWZȃRCTVKTFW des époux.
jour où les formalités de transcription ont L’hypothèse est celle où les époux sont
été accomplies. en désaccord et revendiquent tous deux
Soulignons que dans l’hypothèse où le loge- l’attribution du doit au bail du logement

© SolisImages
OGPVCȌVȌCVVTKDWȌȃNŨȌRQWUGNCSWGNNG[ commun.
réside avec les enfants du couple, et que le Souvent, le juge tiendra compte de la
contrat de bail se trouve résilié en cours de résidence des enfants ou des capacités
procédure de divorce, si l’épouse se main-
tient dans les lieux malgré la résiliation,
FGNŨCWVTGEQPLQKPVȃUGTGNQIGT
Cette attribution judiciaire du droit au bail,
Les bons conseils
…š Lors de la conclusion du bail, le
l’époux qui n’y résiderait plus, pourrait, par prenant effet une fois le divorce prononcé,
décision de justice, être néanmoins tenu a cependant des incidences pour le bail-
bailleur aura tout intérêt, dans le strict
solidairement au paiement des indemnités leur, lequel voit ses garanties de paiement
TGURGEVFWFȌETGVPošFW
FŨQEEWRCVKQPSWKUGTCKGPVCNQTUSWCNKƒȌGU diminuer, dès lors que la solidarité entre
FGkšdettes contractées pour l’entretien du époux disparaît une fois la transcription 5 novembre 2015 ayant fixé la liste
ménage ou pour l’éducation des enfantsšz du divorce effectuée. FGURKȋEGULWUVKƒECVKXGURQWXCPVȍVTG
Il faut cependant relever que ces principes Mais la caution qui se serait engagée, au réclamées au candidat à la location, à
UŨCRRNKSWGPVȃNCEQPFKVKQPSWGNGFTQKVCW OQOGPVFGNCUKIPCVWTGFWEQPVTCVFGDCKNȃ demander le dernier avis d’imposition
bail en question ait effectivement servi au garantir personnellement et solidairement sur les revenus (ou de non-imposition)
logement de la famille. tant l’époux que l’épouse, pendant toute du candidat locataire, ce document
En effet, selon un arrêt de la Cour d’appel la durée de l’occupation des locaux, reste précisant si le locataire est marié ou
FG$QWTIGUFWLWKP
Poš  VGPWGXKUȃXKUFWDCKNNGWTFGUNQ[GTUGV non.
dès lors que le contrat de location n’a charges qui seraient impayés depuis le š
† Le bailleur ne doit pas omettre de
été signé que par l’un des époux, il a été jugement de divorce du fait de l’ex-époux PQVKƒGTVQWUNGUCEVGUȃEJCEWPFGU
jugé qu’il n’avait pas le pouvoir d’engager attributaire du droit au bail. époux, partenaires pacsés et concubins
son épouse séparée de biens pour un (s’ils sont tous deux contractants), et de
logement qu’elle n’a habité que de façon RTKXKNȌIKGTNCUKIPKƒECVKQPRCTJWKUUKGT
transitoire seulement quelques semaines
plutôt que la lettre recommandée,
et qui ne peut être réputé avoir servi
pour éviter que l’un des époux ne
XȌTKVCDNGOGPVȃNŨJCDKVCVKQPFGUȌRQWZGP Le décès signe à la place de l’autre. Bien sûr,
instance de divorce, lequel sera prononcé
ceci sous réserve que le bailleur ait
par jugement d’homologation rendu près En vertu de l’article 1751 alinéa 3 du Code
connaissance de l’existence du conjoint
de deux ans après la signature du bail. Le civil, en cas de décès d’un des époux, le
ou du partenaire pacsé arrivé en cours
bailleur a été débouté de ses demandes conjoint survivant cotitulaire du bail dispose
formées contre l’ex-épouse, seul l’époux d’un droit exclusif sur celui-ci sauf s’il y de bail, car à défaut de démarche
signataire étant tenu pour l’ensemble de renonce expressément. positive par le locataire d’information
la dette locative. Cette disposition a été étendue au partenaire du bailleur, ce dernier n’est pas censé
NKȌRCTWP2#%5NGSWGNDȌPȌƒEKGȌICNGOGPV connaître l’existence de ce conjoint ou
d’un droit exclusif sur le bail, sauf renon- du partenaire pacsé.
.ŨCWFKGPEGFGLWIGOGPVǡNŨCVVTKDWVKQP
judiciaire du logement loué
ciation expresse. š
‡ En cas de location à des concubins,
S’agissant des concubins, l’article 14 de le bailleur veillera à l’insertion d’une
Après la phase de conciliation, l’un ou la loi du 6 juillet 1989 prévoit que lors du clause expresse de solidarité dans
l’autre des époux peut poursuivre la procé- décès du locataire, le contrat de location l’exécution de toutes les obligations
dure pour obtenir un jugement de divorce, est transféré au concubin notoire qui vivait du bail (la première étant le paiement
GPHCKUCPVFȌNKXTGTȃNŨCWVTGWPGCUUKIPCVKQP CXGENGNQECVCKTGFGRWKUCWOQKPUWPCPȃ du loyer et des charges).
en divorce. la date du décès.

25 millions de Propriétaires - Mars 2017 19


TRIBUNE LIBRE

Un siècle d’oppression
législative et fiscale
Analysant les statistiques de l’Insee, les Comptes du logement, les rapports
parlementaires, ceux de la Cour des comptes et divers travaux scientifiques,
Jean Bigot, auteur de l’ouvrage « L’impact des politiques du logement sur les
bailleurs privés de 1914 à 2014 »(1), nous livre une vision inquiétante mais
tellement réaliste de la politique du logement.
Jean Bigot, président de l’UNPI 79

Un peu d’histoire… loyers et limite les droits des propriétaires retraites par des loyers. Ce fut une catas-
plus les investisseurs se désengagent et trophe urbanistique en concentrant les
La première république promettait que la plus il faut construire de logements publics. familles modestes dans des ghettos, en
propriété privée garantirait la liberté contre La deuxième guerre mondiale a détruit un favorisant le communautarisme, les exclu-
les élites qui toujours veulent légiférer pour million et demi de logements. Il manquait sions puis la délinquance.
museler le peuple qu’elles prétendent vouloir donc près de quatre millions de logements
CKFGTšEŨȌVCKVGP.GURTQRTKȌVCKTGUQPV en 1945. Au lieu de laisser le marché adapter
eu cette liberté et cette propriété heureuse NŨQHHTGȃNCFGOCPFGGPRTKXKNȌIKCPVNG(0#* Et aujourd’hui…
pendant le XIXème siècle, ils étaient reconnus RWKUNŨ#PCJNŨDZVCVGWVGPEQTGNŨKFȌGkšgéné-
comme source de stabilité par les différents TGWUGšzOCKUFTCOCVKSWGFGUWDXGPVKQPPGT Des chiffres contestables…
RQWXQKTU
GORKTGTQ[CWVȌTȌRWDNKSWG  des HLM par des impôts supplémentaires. L’État, toujours dans le registre des idées
La guerre de 1914 a entamé ces deux acquis Trop de subventions au parc public et une kšIȌPȌTGWUGUšzUGOKVGPVȍVGFGNKOKVGTUCPU
jumeaux de la liberté et de la propriété avec ƒUECNKVȌURQNKCVTKEGGPXGTUNGUKPXGUVKUUGWTU répit les droits des propriétaires pour favo-
WPRTGOKGTGPECFTGOGPVFGUNQ[GTUšWPG privés crée une concurrence déloyale et riser ceux des locataires par des séries de
KFȌGCRRCTGOOGPVkšIȌPȌTGWUGšzFGNŨDZVCV décourage ces derniers, ainsi la part du lois attentatoires au droit de propriété. Les
qui se découvrait une vocation liberticide marché privé se réduit régulièrement au procédures d’expulsion devinrent compli-
pour aider les locataires mais vingt-cinq RTQƒVFGUDCKNNGWTURWDNKEU quées et longues, le droit au logement,
ans plus tard en 1939, il manquait deux On ne se rendit pas compte de cette subs- GPEQTGWPGKFȌGkšIȌPȌTGWUGšzUWTNGRCRKGT
OKNNKQPUFGNQIGOGPVU2GTUQPPGPGƒVNG titution car le lobby du bâtiment sut faire permet aux locataires de mauvaise foi de
rapprochement entre la perte de rentabi- admettre cette nécessité d’un caserne- RTQƒVGTITCVWKVGOGPVFŨWPNQIGOGPVRGPFCPV
NKVȌFGURTQRTKȌVCKTGUFWGȃNŨGPECFTGOGPV ment vertical des classes populaires par deux ans et de recommencer chez un autre
des loyers et leur désintérêt pour ce type le confort nouveau des sanitaires et du bailleur.
d’investissement. Pourtant, quoi de plus chauffage central. Moyennant quoi, cet 0QVTGRC[UTKEJGRGTOGVȃVQWVNGOQPFG
ȌXKFGPVš!%ŨGUVNŨGHHGVFŨȌXKEVKQPSWKHWVOKU argent détourné du patrimoine privé a de se loger, les aides familiales de la CAF
en évidence par la théorie économique EQPVTKDWȌȃTȌFWKTGNGPKXGCWFGXKGFGNC sont faites pour cela et c’est un progrès. La
SWGNSWGUFȌEGPPKGURNWUVCTFšRNWUNŨDZVCV classe moyenne des petits propriétaires (QPFCVKQP#DDȌ2KGTTGȌXQSWGšOKNNKQPU
ƒUECNKUG NC RTQRTKȌVȌ RTKXȌG GPECFTG NGU qui autrefois complémentait ses chiches de mal-logés sans aucune référence statis-
tique. Ce chiffre est fantaisiste car il englobe
5 851 000 locataires 9 822 000 locataires 11 663 000 locataires 13 562 000 locataires
en 1963 en 1985 en 2008 en 2033 FGUOȌPCIGUC[CPVFGUFKHƒEWNVȌUƒPCP
EKȋTGUšEGRGPFCPVKNGZKUVGGPEQTGš
15% sans-abri qui sont le plus souvent déso-
34% 42%
44% EKCNKUȌUGVGPXKTQPšNQECVCKTGUGV
85% 56% 58%
66% propriétaires occupants qui vivent dans des

Parc privé Parc public ššDZFKVȌEJG\.Ũ*CTOCVVCP

20 25 millions de Propriétaires - Mars 2017


TRIBUNE LIBRE
logements précaires ou dégradés. C’est un En 2006, il n’y avait plus que 1,5 % des logements
scandale car c’est la preuve de l’échec des (locataires et propriétaires occupants) n’ayant pas le confort sanitaire
politiques du logement. Part des logements sans le confort sanitaire (%)
16
… qui conduisent à un déséquilibre 14
Bien évidemment des problèmes de logement 12
GZKUVGPVȃ2CTKUOCKUKN[CWPGZEȌFGPVFG 10

Source : Insee, enquêtes logement


logements en province de plus de deux 8
millions selon l’Insee. On a trop construit 15
6
et pas assez rénové sous l’influence de la 9,6
(($
(ȌFȌTCVKQP(TCPȊCKUGFW$ȅVKOGPV  4
6,2
GPOCTIKPCNKUCPVNC%#2'$
%QPHȌFȌTCVKQP 2 4,1 2,6
de l’Artisanat et des Petites Entreprises du 0
1,5
Bâtiment). Même les bailleurs publics ont 1984 1988 1992 1996 2002 2006
VTQRFGNQIGOGPVUSWŨKNUPŨCTTKXGPVRCUȃ
louer en province, devant faire passer des public qui ne percevant pas d’allocation n’ont Une crise du logement « ressentieš»
RGVKVGUCPPQPEGURQWTFȌPKEJGTGPƒPWP TKGPȃ[HCKTG.GUWTNQ[GTPŨGUVRCUWPGUQNW-
locataire solvable. On peut leur reprocher de tion car ces locataires doivent regagner le La crise du logement n’existe plus en France
ne pas loger les plus pauvres en préférant des parc privé. Il faut une loi pour expulser ceux UCWHȃ2CTKUGPTCKUQPPQVCOOGPVFŨWPG
NQECVCKTGUUQNXCDNGUšQWKNGU[UVȋOGȌVCVKSWG qui ne répondent plus aux critères d’accès politique des transports insuffisante et
FWNQIGOGPVGUVOCNHCKVšNGUDCKNNGWTURTKXȌU au parc public. inadaptée en banlieue, ce qui n’empêche
doivent loger les locataires pauvres dont les Les premiers logements HLM pouvaient pas l’État de se focaliser sur les demandes
HLM ne veulent pas. Les HLM construisent laisser espérer que la collectivité se préoc- de logements HLM pour croire encore
UGWNGOGPVšFGNQIGOGPVUVTȋUUQEKCWZ EWRCKVFGURNWUOQFGUVGUEQPVTKDWCPVCKPUKȃ dans la nécessité de nouveaux logements
selon un rapport de 2012 de la Mission inter- ȌTCFKSWGTNGUDKFQPXKNNGUȃNCUQTVKGFGUXKNNGU publics, confondant les listes d’attente
ministérielle d’inspection du logement social. de l’après-guerre, mais l’inconfort sanitaire réelles de l’après-guerre et les stratégies de
Les HLM préfèrent demander des agréments a disparu depuis les années 2000 dans la locataires voulant minimiser leurs loyers et
pour loger des familles solvables plutôt que presque totalité du parc privé. Le parc privé maximiser leur confort, en oubliant que les
de loger les familles vraiment modestes ou peut reprendre son rôle de locomotive qu’il demandes ne proviennent pas de sans-abri
insolvables, ce qui est un comble. Il existe a toujours eu quand l’État ne se mêlait pas OCKUFGNQECVCKTGUC[CPVFȌLȃWPVQKVOCKU
GPXKTQP  OKNNKQPU FG NQECVCKTGU FCPU NG RCTE de politique du logement. qui réclament plus grand ou plus petit, en
tout cas moins cher.
La construction de logements a toujours été supérieure aux besoins des ménages, C’est la loi du marché qui veut qu’une offre
EQPVTCKTGOGPVȃEGSWŨCHƒTOGPVFGUCUUQEKCVKQPURCTKUKGPPGU de produits moins chers déclenche toujours
dont la Fondation Abbé Pierre une demande, aussi plus l’État veut faire
Construction de logements et baisser les loyers avec toujours plus de HLM
500 000 accroissement du nombre de ménages
GPEQTGWPGKFȌGkšgénéreusešzFCPIGTGWUG 
plus il crée d’insatisfaction en faisant croire
que l’on pourra offrir un logement HLM
400 000
RQWTVQWUšQPQDVKGPVCNQTUWPGkšcrise du
Oct. 2013
NQIGOGPVTGUUGPVKGšzGPETȌCPVFGNCTCPE‘WT
300 000
319 654 chez les candidats refusés.

Changement
de série en
2012
200 000 Une nationalisation rampante du
logement…
100 000 Nombre de logements ordinaires commencés, cumulé sur les 12 derniers mois
Accroissement annuel du nombre de ménages
Car ce que l’État dissimule, c’est qu’il n’y
France Métropolitaine
a presque pas de logements réellement
0 UQEKCWZEJG\NGUDCKNNGWTURWDNKEUšNŨCWVTG
1/1 1950 1/1 1960 1/1 1970 1/1 1980 1/1 1990 1/1 2000 1/1 2010 1/1 2020
CPQOCNKGGUVNCRNȌVJQTGFGNQIGOGPVUkšdits
5QWTEG%)'&&FŨCRTȋU%)&&51G5GV+PUGG UQEKCWZšzOCKUSWKPGNGUQPVRCUššFGU

25 millions de Propriétaires - Mars 2017 21


TRIBUNE LIBRE
.GFȌUKPXGUVKUUGOGPVRTKXȌCEQOOGPEȌGPVTGGVǡ

5QWTEG'PSWȍVGNQIGOGPVFGNŨ+PUGGFQPPȌGUGZRNQKVȌGURCTNC&)#.0&*72
une destruction de 601 000 logements privés en 4 ans privatisation de services publics comme
16 000 Nombre de logements (en milliers) 15 032 NCUCPVȌNGUVȌNȌEQONGUCWVQTQWVGUŲ GP
15 000
13 724 RGTOGVVCPVȃEGUUQEKȌVȌUȌSWKXCNGPVGUȃ
14 000 FGUOWNVKPCVKQPCNGU
GNNGUGORNQKGPVš
13 000 12 645
11 913 salariés) de ne pas payer d’impôts tout en
12 000 11 387
RGTEGXCPVFGUUWDXGPVKQPUŲNGEQODNG
11 000 10 323
10 000 La plus importante société HLM possède
8 695
9 000
7 797 šNQIGOGPVUGNNGȌEQPQOKUGRCTCP
8 000 6 898 7 350 500 millions d’euros d’équivalent ISF, soit
7 000 6 247
5 076 5 369 NŨȌSWKXCNGPVCPPWGNFGUCKFGUFGNŨ#PCJȃ
5 029 5 171
4 971 4 886 5 019 4 786
6 000
5 000
4 570 4 291 4 650 l’ensemble des bailleurs privés.
4 000
4 091 4 231 4 487
3 000 3 622 3 375
3 362
2 000
1 933 2 481 … qui conduit à une désaffection
880 1 164 1 565
1 000
0 des bailleurs
1963 1967 1970 1973 1978 1984 1988 1992 1996 2002 2006
.GRCTERTKXȌNQECVKHGUVFȌVGPWRCTšOKNNKQPU
Propriétaires Secteur locatif social Secteur locatif privé
de propriétaires dont la majorité essaie de
UWTXKXTG
šQPVWPQWFGWZNQIGOGPVU 
OȌPCIGUHTCPȊCKUQPVFTQKVȃFGUkšloge- pauvres. Les bailleurs publics sont devenus avec ce complément de retraite. Beaucoup
OGPVUUQEKCWZšzKNUŨCIKVFGNCOȍOGENKGP- FGUUQEKȌVȌUECRKVCNKUVGUCXGEFGURTQƒVU sont des anciens travailleurs indépendants
tèle que celle des bailleurs privés. Depuis colossaux, faisant du commerce sans le PŨC[CPVSWŨWPGOQFGUVGTGVTCKVGšKNUQPV
quelques années, les bailleurs publics FKTG
NGUDCKNNGWTURWDNKEUUQWUNGRTȌVGZVG travaillé toute une vie, ont économisé pour

PQOOȌURCTNŨ#UUGODNȌGPCVKQPCNGFCPU FGNCTGXGPVGUQEKCNGȃFGUNQECVCKTGUHQPV acheter un ou deux logements. Les rende-
son rapport 3805 annexe 47, les «šFQFWU des opérations de promotion immobilière ments locatifs ont baissé depuis 2000,
FQTOCPVUšzGPTCKUQPFGNGWTVTȌUQTGTKG FCPUNGUTȌIKQPUȃHQTVGURQUUKDKNKVȌUFGRNWU HKUECNKVȌQDNKIGšNCEQPEWTTGPEGFȌNQ[CNG
scandaleuse de 10 milliards d’euros) ne XCNWGŲGZQPȌTȌGUFŨKORȖVU #KPUKNŨCWVTG des bailleurs publics a fait baisser les loyers,
sont plus des bailleurs sociaux car on ne scandale du logement en France, cautionné c’est une nouvelle incitation pour quitter ce
RGWVRTȌVGPFTGNQIGTšFGNCRQRWNCVKQP par tous les régimes politiques, est que l’on secteur d’investissement qui devient moins
française avec des critères sociaux, ce a mis en place une nationalisation rampante ITCVKƒCPVCXGENGUCNȌCUFGNCIGUVKQPš
UGTCKVCHƒTOGTSWGšFGU(TCPȊCKUUQPV FWNQIGOGPV
CNQTUSWGNŨQPCUUKUVGȃNC propriétaires ont été ruinés avec la loi Scellier,
investissant n’importe où, même quand il n’y
Les rendements locatifs sont en baisse continue depuis 2002, passant de 52% à 22 % en avait pas de demande.
2011. Les charges ne comprennent pas les remboursements de capital mais seulement
les intérêts. Pour les propriétaires endettés, il n’y a plus de rentabilité possible. Après les effets désastreux de la loi Quillot,
Montant en euros Résultat Brut Courant /Production en %
le nombre de logements privés locatifs a
10 000 Ressources par logement 100 baissé d’un million malgré le million de
NQIGOGPVUFȌƒUECNKUȌUV[RG5EGNNKGTOKU
9 000 Charges par logement 90 UWTNGOCTEJȌ#KPUKQPRGWVKORWVGTȃNCNQK
Résultat Brut Courant / Production Quillot la disparition d’environ 2 millions de
8 000 80
logements privés. Il faut attendre 2006 pour
7 000 70 retrouver le niveau de 1978. Mais la surpro-
6 000 60 duction des HLM ne s’est jamais arrêtée au
point que le parc public a des dizaines de
5 000 50
OKNNKGTUFGNQIGOGPVUXCECPVU
OCKUUCPU
Source : Comptes du logement 2011

4 000 40 NCVCZGUWTNGUNQIGOGPVUXCECPVU šKNGUV


paradoxal de constater que les bailleurs
3000 30
publics en province sont contraints de faire
2 000 20 passer des petites annonces et de poser
FGURCPPGCWZkšǨNQWGTšz+NPŨ[CLCOCKU
1 000 10
eu d’enquête sur le nombre de logements
0 0 vacants dans le parc public car ce serait
1993 1996 1999 2002 2005 2008 2011 TGNGXGTUQPȌEJGEšБ

22 25 millions de Propriétaires - Mars 2017


ANALYSE

La loi « Égalité et citoyenneté »


après passage
au Conseil constitutionnel
La loi n° 2017-86 du 27 janvier 2017 relative à l’Égalité et à la citoyenneté a été publiée au JO
du 28 janvier dernier. C’est un texte ambitieux destiné, si l’on reprend ses intitulés, à favoriser
l’émancipation des jeunes et leur participation à la vie de la République, à promouvoir la
mixité sociale et l’égalité des chances dans l’habitat, et à instaurer « l’égalité réelle ». Il a
pourtant été raccourci à la suite de la décision rendue par le Conseil constitutionnel le 26
janvier 2017 (décision n° 2016-745).

Frédéric Zumbiehl

Sur les 224 articles figurant dans le Chasse ouverte aux cavaliers WPGRTQRQUKVKQPFGNQK
KUUWGFŨWPRCTNGOGP-
texte adopté par l’Assemblée nationale en législatifs taire) peuvent donc être modifiés après
NGEVWTGFȌƒPKVKXGGVSWGPQWUEQOOGPVKQPU dépôt si des amendements sont proposés
dans notre numéro de février, 48 articles L’article 44 de la Constitution française GVXQVȌU%GRGPFCPVCƒPFGICTCPVKTWPG
ont été censurés. Certains l’ont été prévoit que «šNGUOGODTGUFW2CTNGOGPVGVNG certaine cohérence de la procédure légis-
pour des raisons de fond. Au nom de la Gouvernement ont le droit d’amendementšz lative, le droit d’amendement est encadré.
liber té d’enseignement, les Sages 7PRTQLGVFGNQK
KUUWFW)QWXGTPGOGPV QW En premier lieu, le Conseil constitutionnel
ont par exemple censuré l’article 39
XKUCPV ȃ TGORNCEGT NC RTQEȌFWTG FG
déclaration préalable des établissements
d’enseignement privé par un système
d’autorisation préalable. Une réforme
de la loi sur la presse de 1881, visant
ȃ ȌVGPFTG NG FȌNKV FG PȌICVKQPPKUOG ȃ
d’autres crimes de masse non encore jugés,
CCWUUKȌVȌGUVKOȌGVTQRCVVGPVCVQKTGȃNC
liberté d’expression.
Toutefois, en matière de droit immobilier,
la plupart des dispositions censurées
l’ont été pour un motif de procédure.
Le Conseil constitutionnel a en effet
sanctionné un recours abusif au droit
d’amendement, qu’il soit d’ailleurs le
HCKVFGURCTNGOGPVCKTGUQWFW)QWXGTPG
ment. À l’inverse, parmi les articles
UQWOKUȃNCEGPUWTGFGULWIGUCTVKENGU
ont été validés. En particulier, le volet
© pixarno

kǡHLMǡzFGNCNQKkǡDZICNKVȌGVEKVQ[GPPGVȌǡz
a été maintenu.

25 millions de Propriétaires - Mars 2017 23


ANALYSE
censure depuis les années 1980 les amen- les amendements déposés en nouvelle
dements sans lien avec le texte initial. Pour lecture alors qu’ils ne présentent pas de lien
ce faire, il s’est fondé sur les règlements direct avec une disposition restant
des assemblées puis sur l’article 45 de la en discussion. Rappelons ici que la
Constitution. En effet, depuis une réforme PCXGVVGǡRCTNGOGPVCKTGHQPEVKQPPGUGNQP
constitutionnelle de 2008, ce dernier énonce NC TȋING FG NŨkšentonnoiršz .G VGZVG GP
SWGkštout amendement est recevable en débat fait un aller-retour entre les deux
RTGOKȋTGNGEVWTGFȋUNQTUSWŨKNRTȌUGPVGWP EJCODTGURCTNGOGPVCKTGUǡFȋUSWŨWPG
NKGPOȍOGKPFKTGEVCXGENGVGZVGFȌRQUȌQW disposition est votée en termes identiques,
transmisšz+NUŨCIKVFŨȌXKVGTSWŨWPRCTNGOGP- celle-ci est extraite du débat, et ce dernier
VCKTG
QWNG)QWXGTPGOGPV RTGPPGCRRWKUWT se poursuit uniquement sur les points
un projet de texte pour tenter de faire passer, de désaccord. En limitant l’objet des
plus ou moins en catimini, une mesure qui amendements aux seules dispositions
PŨC TKGP ȃ XQKT CXGE EG RTQLGV
QP RCTNG FG k TGUVCPV GP FKUEWUUKQP z KN UŨCIKV FŨGORȍEJGT
k cavalier législatif z
 . non seulement des cavaliers législatifs, mais

© Brad Pict
Dans leur décision du 26 janvier, les juges également des amendements qui viennent
de la rue Montpensier ont censuré pas torpiller la navette parlementaire dans
moins de 36 cavaliers législatifs. En ce qui son avancement
 . Sur ce fondement, ont
concerne le droit immobilier, disparaissent PQVCOOGPV ȌVȌ TGVTCPEJȌU FG NC NQK k Égalité en 2012 devant la Commission européenne
FG NC NQK k DZICNKVȌ GV EKVQ[GPPGVȌ z  GV EKVQ[GPPGVȌ z  inspire directement ces réformes.
 NŨCDCKUUGOGPV FCPU NGU VGTTKVQKTGU  NC UQWOKUUKQP FGU EQNQECVKQPU ȃ DCWZ Des parlementaires ont néanmoins tenté
k tendus z FG NC OCLQTKVȌ TGSWKUG RQWT multiples aux règles de surface et volume de d’en faire censurer certaines. Il en va
CWVQTKUGT WP EQRTQRTKȌVCKTG ȃ TȌWPKT FGU FTQKV EQOOWP
CNQTU SWŨCWLQWTFŨJWK EG V[RG notamment ainsi de l’article 70 de la loi,
lots dont l’un mesure moins de neuf mètres FG EQNQECVKQP GUV CUUKOKNȌG ȃ WPG FKXKUKQP FG qui prévoit de réserver une partie des
ECTTȌU  logements impliquant de louer des surfaces logements sociaux aux plus démunis.
 NG UCWHEQPFWKV FQPPȌ CWZ GPSWȍVGWTU FG UWRȌTKGWTGU ȃ  OȋVTGU ECTTȌU  2NWU GZCEVGOGPV NŨCTVKENG .š FW
l’INSEE pour accéder, pour le besoin d’en-  NG RNCHQPPGOGPV FGU JQPQTCKTGU SWŨWP Code de la construction et de l’habitation
quêtes statistiques, aux parties communes U[PFKE RGWV FGOCPFGT ȃ WP EQRTQRTKȌVCKTG énonce dorénavant que, dans la plupart
FGU KOOGWDNGU FŨJCDKVCVKQP  mauvais payeur pour ses prestations de des territoires urbains où il existe l’un
 NG FTQKV RQWT WP RTQRTKȌVCKTG FŨKPXQSWGT mise en demeure et de relance. FGUšSWCTVKGTURTKQTKVCKTGUFGNCRQNK-
la résiliation de plein droit du bail en cas On peut regretter la disparition de certaines VKSWGFGNCXKNNG
328VGTTKVQKTGUKFGPVKƒȌU
FG EQPFCOPCVKQP FW NQECVCKTG RQWT VTCƒE FG EGU OGUWTGU EQOOG EGNNG HCXQTCDNG ȃ NC au plan national comme abritant une
FG UVWRȌƒCPVU EQNQECVKQP ȃ DCWZ OWNVKRNGU KUUWG FŨCKNNGWTU population particulièrement démunie),
En second lieu, depuis 1998, le Conseil FŨWP COGPFGOGPV FW )QWXGTPGOGPV %GRGP-  FGUNQIGOGPVUUQEKCWZUKVWȌUGP
constitutionnel interprète l’article 45 dant, on peut comprendre que le Conseil dehors dudit QPV doivent être attribués au
de la Constitution comme interdisant constitutionnel s’assure du bon déroulement k SWCTVKNGFGUFGOCPFGWTUCWZTGUUQWTEGU
FG NC RTQEȌFWTG NȌIKUNCVKXG k La forme est les plus faiblesšz
QWCNQTUȃFGURGTUQPPGU
NC U‘WT LWOGNNG FG NC NKDGTVȌ z FKUCKV +JGTKPI TGNQIȌGU ȃ NC UWKVG FŨWPG QRȌTCVKQP FG
WP EȌNȋDTG LWTKUVG CNNGOCPFŲ renouvellement urbain). Comme l’indiquait
NG )QWXGTPGOGPVFCPUNŨGZRQUȌFGUOQVKHU
FW RTQLGVFGNQKKNUŨCIKVFGkšICTCPVKTSWGNGU
personnes aux ressources les plus modestes
/CKPVKGP FW XQNGV k HLM z

.C NQK k DZICNKVȌ GV %KVQ[GPPGVȌ z EQPVKGPV FG   'PTGXCPEJGTKGPPŨKPVGTFKVFGFȌRQUGTFGURTQLGVU


PQODTGWUGU FKURQUKVKQPU XKUCPV ȃ TGEGPVTGT FG NQKUGWZOȍOGUkǡfourre-toutǡz%GNCȌNCTIKV
d’autant le champ des amendements possibles.
les bailleurs sociaux sur leur mission origi-
Par exception, certaines lois, comme les lois de
PGNNG SWŨKN UŨCIKUUG FG TGFȌƒPKT NGU ETKVȋTGU ƒPCPEGUQWFGƒPCPEGOGPVFGNCUȌEWTKVȌUQEKCNG
d’attribution de logements sociaux, de PG RGWXGPVCXQKTSWŨWPQDLGVNKOKVȌ
KPVGTFKEVKQPFGU
© Graphithèque

durcir les conditions du droit au maintien k cavaliers budgétairesǡz 

dans les lieux ou d’imposer aux acteurs   +NGUVHCKVGZEGRVKQPȃEGVVGTȋINGNQTUSWŨWPCOGP-


FGOGPVXKUGȃCUUWTGTNGTGURGEVFGNC%QPUVKVWVKQP
du secteur de nouvelles obligations de contient une simple mesure de coordination ou tend
transparence. La plainte déposée par l’UNPI ȃ EQTTKIGTWPGGTTGWTOCVȌTKGNNG

24 25 millions de Propriétaires - Mars 2017


ANALYSE
puissent être logées dans l’ensemble du
parc social et permettre ainsi un meilleur Les Sages valident l’ouverture au public du
ȌSWKNKDTGGPVTGNGUVGTTKVQKTGUšz+NHCWVGP
effet éviter que les plus démunis soient registre des syndicats de copropriété
kšconfinésšzFCPUNGUNQIGOGPVUUKVWȌU Après la parution de divers textes d’application de la loi ALUR de 2014, le registre
en QPV, les logements sociaux situés
national des syndicats de copropriété est en cours de constitution. Ce registre
CKNNGWTUȌVCPVNQWȌUȃFGURWDNKEUFCXCP
ȌVCKVCWFȌRCTVEQPUKFȌTȌEQOOGWPOQ[GPXKUCPVȃkšfaciliter la connaissance
VCIGkšprisésšz&GUFȌRWVȌUQPVFȌPQPEȌ
des pouvoirs publics sur l’état des copropriétésšz5WKVGȃWPCOGPFGOGPVRCTNG
dans cette contrainte supplémentaire une
atteinte disproportionnée au principe de OGPVCKTGGPUWKVGFȌHGPFWRCTNG)QWXGTPGOGPVNCNQKkšÉgalité et citoyennetéšz
libre administration des collectivités terri- OQFKƒGNG%QFGFGNCEQPUVTWEVKQPGVFGNŨJCDKVCVKQPRQWTTGPFTGNGRWDNKEȌICNGOGPV
toriales. Mais le Conseil constitutionnel a destinataire des informations collectées. À terme, il semble que chacun pourra
TGLGVȌEGITKGHšNGUFKURQUKVKQPUNKVKIKGWUGU connaître le nom du syndic qui gère une copropriété en particulier, le nombre
kšTȌRQPFGPVȃFGUƒPUFŨKPVȌTȍVIȌPȌTCNšzGV et la nature des lots qui composent cette copropriété, mais également savoir
kšle taux d’attributions annuelles retenu par si celle-ci fait l’objet d’une procédure de désignation d’un mandataire ad hoc,
NGNȌIKUNCVGWTSWKPGUŨȌNȋXGSWŨȃšPŨGUV FŨWP CFOKPKUVTCVGWT RTQXKUQKTG QW GPEQTG FŨWP CTTȍVȌ FG RȌTKNǡ Б 5GWNGU NGU
pas en lui-même excessifšz informations les plus sensibles, relatives aux comptes du syndicat ou à l’état du bâti,
.GRQKPVFGXWGFGU5CIGUGUVVQWVȃHCKV resteront inaccessibles au public. En revanche, les notaires auront désormais accès
appréciable. Il faut en effet poursuivre les à ces informations et pourront les relayer aux acquéreurs de lots de copropriété.
efforts réalisés en vue de ramener le parc
Des sénateurs ont en vain dénoncé une atteinte au droit au respect de la vie privée
*./ȃUCOKUUKQPRTGOKȋTGǨEGUWLGV
FGUEQRTQRTKȌVCKTGUNG%QPUGKNEQPUVKVWVKQPPGNLWIGCPVSWGkǡles informations rendues
un document publié par le ministère du
Logement et de l’Habitat durable
 fait publiques (…) ne comportent aucune donnée personnelle relative aux copropriétairesǡz
état de divers progrès. D’une part, parmi 2QWTVCPVFCPUWPGFȌEKUKQPFWOCTUKPXQSWȌGFŨCKNNGWTURCTNGUUȌPCVGWTU
l’ensemble des constructions de loge- NC%0+.OGPVKQPPCKVNGTKUSWGFŨKFGPVKƒECVKQPFGUEQRTQRTKȌVCKTGUCWOQ[GPFŨWP
ments sociaux, la part des constructions recoupement d’informations, en particulier dans les petites copropriétés. Il faudra
de logements destinés aux personnes les donc être vigilant sur les précautions mises en place pour limiter ce risque…
RNWUFȌHCXQTKUȌGU
NQIGOGPVUkšPLAIšz 
GUVRCUUȌGFGšGPȃšGP
2015. D’autre part, les logements sociaux Mise à jour de notre article publié en février (p. 12)
se construisent de plus en plus dans les
\QPGUNGURNWUkštenduesšzFWVGTTKVQKTGšGP Parmi les mesures détaillées dans notre précédent numéro, sont supprimées
šFGUNQIGOGPVUCKFȌUȌVCKGPV celles concernant :
EQPUVTWKVUGPkšzone AšzGVšGPkšzone • le regroupement de lots en copropriété (art.91) ;
CšzVCPFKUSWŨGPEGURTQRQTVKQPUUQPV • la résiliation de plein droit du bail en cas de condamnation pénale (art.119) ;
TGURGEVKXGOGPVFGšGVš • les normes de décence en cas de colocation (art.121) ;
• les honoraires des syndics (art. 122).
šš$KNCPFGUNQIGOGPVUCKFȌULWKNNGV

VOUS ÊTES ABONNÉ


RETROUVEZ NOS ARTICLES ARCHIVÉS SUR
www.unpi.org
rubrique Nos services / revue 25 millions de propriétaires
puis, en bas de page : « #EEȌFG\CWZ CTVKENGU FW LQWTPCN z
ou scannez le QRCode

25 millions de Propriétaires - Mars 2017 25


ANALYSE

Investir en Pinel sans


se tromper
Destinée à stimuler et relancer l’immobilier locatif, la loi Pinel a succédé à la loi Duflot en
septembre 2014, offrant la possibilité à l’investisseur qui achète un bien immobilier neuf
- ou assimilé - dans une ville où le marché locatif est tendu de bénéficier, sous certaines
conditions, d’un allégement fiscal. La prolongation de ce dispositif jusqu’au 31 décembre
prochain est l’occasion d’en rappeler les avantages et contraintes ainsi que les pièges à éviter
pour réussir son investissement.

Mireille Sarlin

,WUSWŨȃššŻFGICKPƒUECN PGRQWTTCDȌPȌƒEKGTFGNŨCXCPVCIGƒUECN CPUUQKVššŻRCTCPUWTUKZQWPGWH


SWŨȃJCWVGWTFGEGWZEK#WFGNȃNŨCXCPVCIG CPUGVššŻUWRRNȌOGPVCKTGUNGUVTQKU
.ŨCXCPVCIGƒUECNEQPUKUVGGPWPGTȌFWE- ƒUECNPGUŨCRRNKSWGTCRCU années suivantes. Lorsque l’investissement
tion d’impôt s’appliquant sur la fraction Le taux de la réduction dépend de la durée en loi Pinel se fait outre-mer, la réduction
de l’investissement ne dépassant pas FGNQECVKQPššUWTCPUšUWTCPU OCZKOCNG RGWV ȍVTG ȌICNG ȃ š UQKV
ššŻRCTCP
FGWZDKGPUKOOQDKNKGTU šUWTCPU
ššQWšQWVTG LWUSWŨȃššŻFGTȌFWEVKQPFŨKORȖVQW
OCZKOWO FCPUNCNKOKVGFGššŻOq.G OGT EGSWKEQTTGURQPFȃWPGTȌFWEVKQP ššŻRCTCP6QWVGHQKUGPVTCPVFCPUNG
contribuable qui achète au-dessus de ces FŨKORȖVOCZKOCNGFGššŻUWTUKZCPU RNCHQPPGOGPVINQDCNFGUPKEJGUƒUECNGU
UGWKNUFGššŻRCTCPGVFGššŻOq ššŻUWTPGWHCPUGVššŻUWTFQW\G
RQWTTCRRGNFGššŻOCLQTȌȃššŻ
pour les investissements en Outre-mer et
NGUUQWUETKRVKQPUCWECRKVCNFG5QƒEC WP
investissement en Pinel perd de son intérêt
lorsque les réductions ou crédits d’impôt
FQPVDȌPȌƒEKGRCTCKNNGWTUNGEQPVTKDWCDNG

ICTFGFŨGPHCPVGORNQKFŨWPUCNCTKȌȃFQOK-
EKNGCWVTGRNCEGOGPVFȌƒUECNKUCPV UQPV
FȌLȃRTQEJGUFGEGUGWKNFGššŻ&G
plus, s’agissant d’une réduction d’impôt et
non pas d’un crédit d’impôt, l’administration
ƒUECNGPGTGODQWTUGTCRCUNGUWTRNWUUK
NGOQPVCPVFGNCTȌFWEVKQPGUVUWRȌTKGWTȃ
l’impôt dû par le contribuable. La différence
sera perdue. Une simulation s’impose
donc avant de se lancer pour calculer au
plus juste le montant de l’investissement
2KPGNPȌEGUUCKTGCƒPFŨQRVKOKUGTNŨCXCPVCIG
ƒUECN
FGUECNEWNCVGWTUGPNKIPGRGTOGVVGPV
d’effectuer des simulations gratuites sur
© ah_fotobox

NC6QKNG 2QWTWPHCKDNGOQPVCPVFGFȌƒU-
calisation, la souscription de parts d’une

26 25 millions de Propriétaires - Mars 2017


ANALYSE
RGWVGZEȌFGT.GE‘HƒEKGPVOCZKOWO
GUVCVVGKPVCXGEWPCRRCTVGOGPVFGšOq

E‘HƒEKGPV ǨNŨKPXGTUGNGUDKGPUFG
Quels
RNWU FG šOq QPV WP RNCHQPF FG NQ[GT KPXGUVKUUGOGPVUǡ!
minoré. Pour le calcul des plafonds de
Ouvrent doit à la réduction d’impôt
NQ[GTU CW Oq NC UWTHCEG ȃ RTGPFTG GP
2KPGN 
compte est la surface habitable augmentée
FGšFGUUWTHCEGUCPPGZGURNCHQPPȌGU • NGU NQIGOGPV CESWKU PGWHU
ȃšOq
ECXGEGNNKGTDCNEQP  • NGUNQIGOGPVUGPNŨȌVCVHWVWTFŨCEJȋ-
L’engagement de location, qui doit prendre vement (VEFA)
effet dans les douze mois qui suivent la
date d’achèvement de l’immeuble ou de
• NGUNQIGOGPVUSWGNGEQPVTKDWCDNG
fait construire
son acquisition si elle est postérieure, est
FŨWPGFWTȌGOKPKOCNGFGCPUȃNŨKUUWG • NGUNQIGOGPVUCPEKGPUHCKUCPVNŨQDLGV
FGNCSWGNNGNGDKGPRGWVȍVTGEQPUGTXȌȃNC de travaux pour être transformés en
location trois ou six années supplémen- logement neuf
• NGUNQIGOGPVUPGUCVKUHCKUCPVRCU
© Eléonore H

taires en gardant l’avantage fiscal. La


réduction d’impôt est accordée au titre aux caractéristiques de décence et
de l’année d’achèvement du logement, faisant l’objet de travaux de réhabili-
ou de son acquisition si elle est posté- tation leur permettant d’acquérir des
société civile de placement immobilier rieure, et imputée sur l’impôt dû au titre performances techniques proches de

5%2+ RTQRQUCPVFŨCEEȌFGTCWFKURQUKVKH de cette même année, puis sur l’impôt dû celles des logements neufs
Pinel constitue une solution alternative. au titre de chacune des années suivantes

ȃEQPEWTTGPEGFGNCFWTȌGFŨGPICIGOGPV
• NGUNQECWZCHHGEVȌUȃWPWUCIGCWVTG
que l’habitation et faisant l’objet de
de location choisie).
travaux de transformation en loge-
Rappelons que depuis 2015, il est possible
ments.
Conditions à remplir FGNQWGTȃUGUGPHCPVUQWRCTGPVUFȋUNQTU
qu’ils ne font pas partie du même foyer
.GDȌPȌƒEGFGNŨCXCPVCIGƒUECNGUVUQWOKU ƒUECN
ȃRNWUKGWTUEQPFKVKQPU FGRTQRTKȌVȌ
PWGRTQRTKȌVȌGVWUWHTWKV 
pendant la totalité de l’engagement de
Conditions tenant au bien location.
Des plafonds de loyers et de ressources
 Concernant le bien lui-même, il doit être
.GEQPVTKDWCDNGFQKVCKPUKUŨGPICIGTȃNQWGT CESWKUPGWHQWGP8'(#
XGPVGGPNŨȌVCV
NGNQIGOGPVPW
EŨGUVȃFKTGPQPOGWDNȌ ȃ futur d’achèvement) et respecter la régle-
VKVTGFGTȌUKFGPEGRTKPEKRCNGȃWPNQECVCKTG OGPVCVKQP VJGTOKSWG 
RGTOKU FG 1șKPXGUVKTǡ!
FQPVNGUTGUUQWTEGU
EQTTGURQPFCPVȃUQP construire déposé depuis le 1er janvier
TGXGPWƒUECNFGTȌHȌTGPEGSWKƒIWTGUWT 2013) ou bénéficier du label BBC 2005 Comme pour tout achat dans la pierre, la
l’avis d’impôt sur le revenu de l’avant-
RGTOKUFGEQPUVTWKTGFȌRQUȌCXCPVNGer SWCNKVȌFGNŨGORNCEGOGPV
XKNNGSWCTVKGT 
dernière année précédant la signature du LCPXKGT 5QPVȌNKIKDNGUȃNŨCXCPVCIG ainsi que l’existence réelle d’une demande
bail) ne dépassent pas certains plafonds ƒUECNNGUDKGPUUKVWȌUFCPUWPGFGU\QPGU locative solvable et pérenne sont primor-

CXGEFGURNCHQPFUURȌEKƒSWGURQWTNGU QșNCFGOCPFGNQECVKXGGUVHQTVGš\QPG# diaux. Au sein d’une ville, il est recommandé


logements situés outre-mer) et pratiquer bis, zone A et zone B1. Les logements en FGRTKXKNȌIKGTNGU\QPGUȃRTQZKOKVȌFGU
WPNQ[GTRNCHQPPȌKPHȌTKGWTFŨGPXKTQPš zone B2, ainsi que depuis 2017, les loge- transports, commerces et écoles et de
aux loyers du marché, variable selon la OGPVUGP\QPG%RGWXGPVDȌPȌƒEKGTFGNC XȌTKƒGTNŨCDUGPEGFGPWKUCPEGUGZKUVCPVGUGV
\QPGIȌQITCRJKSWGFWNQIGOGPV
GP loi Pinel sur agrément préfectoral. Il est futures. En n’oubliant pas que les plaquettes
FG  ȃ šŻOq  GV UC UWTHCEG nécessaire que l’achèvement du logement commerciales des promoteurs sont faites
RQPFȌTȌG'PGHHGVCƒPFGVGPKTEQORVG intervienne dans les trente mois qui suivent pour présenter leurs opérations sous leurs
de la surface de l’appartement, il est fait la date de la déclaration d’ouverture de
CRRNKECVKQPFŨWPE‘HƒEKGPVOWNVKRNKECVGWT EJCPVKGT.GDKGPKOOQDKNKGT
QWNGURCTVU
ECNEWNȌUGNQPNCHQTOWNGUWKXCPVGš  sociales si l’acquisition se fait via une ššǨNŨJGWTGQșPQWUOGVVQPUUQWURTGUUGNGU
plafonds pour 2017 ne sont pas encore connus
5WTHCEGFWNQIGOGPV#TTQPFKȃNCFGWZKȋOG 5%2+ PGRGWVRCUUCWHGZEGRVKQP
XQKT mais devraient être les mêmes que ceux de l’an
FȌEKOCNGNCRNWURTQEJGEGE‘HƒEKGPVPG plus loin), faire l’objet d’un démembrement passé, publiés dans notre revue de mars 2016 p.34

25 millions de Propriétaires - Mars 2017 27


ANALYSE
meilleurs aspects, pas pour indiquer que Saint-Omer
Boulogne-sur-Mer Lens Douai
NC\QPGGUVFȌLȃUCVWTȌGGPNQIGOGPVU Anzin
Béthune
neufs ou mal desservie par les transports. Denain Maubeuge
Arras
Dieppe
Bien qu’éligibles au dispositif Pinel, des Cherbourg-Octeville Cambrai Longwy
Le Havre
XKNNGUUGTCKGPVCKPUKȃȌXKVGT
XQKTNCECTVG Fécamp Charleville-Mézières Algrange

ci-contre), selon le Laboratoire de l’Immobi- Saint-Brieuc Pont-Audemer Châlons-en-Champagne Metz


Elbeuf
lier, société d’études de Théséis, spécialiste Toul
Sens
de la sélection de programmes immobiliers Quimper Dinan Laval
Troyes Epinal Colmar
neufs, qui base son analyse sur un taux de Concarneau Le Mans
Chartres
Mulhouse
vacance élevé, une évolution démographique Auxerre

défavorable, un rythme de construction de Angers Dole


Montbéliard
Châlon-sur-Saône
logements neufs soutenu ou en accéléra-
Poitiers
VKQP
RNWUFGFȌVCKNUWTwww.labo-immo. Niort
Bourg-en-Bresse
Vichy
org). Dans ces villes, l’investisseur risque Rochefort
Saintes
Cluses
Angoulême Chamalière
de devoir brader le loyer, voire de ne pas Roanne
Vienne
trouver de locataire, ce qui lui ferait perdre Périgueux
Brive-la-Gaillarde Voiron
Saint-Etienne
NŨCXCPVCIGƒUECNVQWVGPFGXCPVTGODQWTUGT Tournon-sur-Rhône
#IINQOȌTCVKQP ȃ ȌXKVGT Gap
les mensualités du crédit souscrit pour Valence
#IINQOȌTCVKQP Courthézon
ƒPCPEGTNŨCESWKUKVKQP#KNNGWTUNŨKPXGUVKU sous surveillance Sisteron
Alès
seur s’assurera de la pertinence de son Avignon
Carpentras
Pau Brignoles
EJQKZGPXGKNNCPVȃPGRCUUWTRC[GTNGDKGP Cavaillon
Tarascon
un écueil fréquent avec des programmes Béziers

offrant de la défiscalisation. Comparer Perpignan

les prix des différents programmes neufs


qui sortent de terre dans les alentours et 5QWTEG Le Laboratoire de l’Immobilier
leur évolution permet de se faire une idée
sur l’intérêt de l’investissement. À défaut, RQVGPVKGN FG RNWUXCNWG ȃ VGTOG PŨGUV RCU Remise en cause des avantages
le rendement en pâtirait, sans compter le PQP RNWU ȃ PȌINKIGT #KPUK CXGE NŨCTTKXȌG ƒUECWZ
TKUSWGFGOQKPUXCNWGȃNCTGXGPVG#VVGPVKQP RTQEJCKPG FW )TCPF 2CTKU 'ZRTGUU GV NGU
également aux simulations de rendement grands projets urbains qui l’accompagnent, En cas de non-respect des engagements de
qui retiennent comme hypothèse de loyer le FGU EQOOWPGU FŨǶNGFG(TCPEG ITȅEG ȃ NŨKPXGUVKUUGWT
FȌRCUUGOGPVFGURNCHQPFU
plafond applicable dans la zone considérée leur facilité d’accès aux différents pôles de loyers ou de ressources, interruption de
alors que dans certaines villes, les loyers économiques franciliens, devraient prendre la location...) ou de démembrement du droit
TȌGNNGOGPVRTCVKSWȌUUQPVKPHȌTKGWTUȃEGNWK de la valeur, offrant des opportunités aux de propriété, la réduction d’impôt fait l’objet
ci. A prix d’acquisition équivalent, mieux vaut investisseurs dans le neuf. En province, les d’une reprise. Toutefois, aucune remise en
investir dans une ville où le loyer de marché RGTURGEVKXGU FG RNWUXCNWG ȃ SWKP\G CPU cause n’est effectuée lorsque le démem-
est le plus proche possible de ce plafond UGTCKGPV NGU OGKNNGWTGU ȃ .[QP 0CPVGU GV brement ou le transfert de la propriété du
si l’on veut optimiser son rendement. Le Rennes, selon MeilleursAgents.com. bien résulte du décès de l’un des membres
FWEQWRNGUQWOKUȃKORQUKVKQPEQOOWPG
et que le conjoint survivant attributaire du
bien ou titulaire de son usufruit s’engage
ȃTGURGEVGTNGUGPICIGOGPVU
Aucune reprise n’est non plus effectuée dans
les cas suivants dès lors qu’ils concernent
NŨWPFGUOGODTGUFWEQWRNGUQWOKUȃKORQ
sition commune : invalidité classée en 2e ou
3e catégorie, licenciement, décès. En cas de
divorce pendant la période d’engagement,
NŨCXCPVCIGƒUECNPŨGUVRCUTGOKUGPECWUG
lorsque l’époux attributaire du bien reprend
l’engagement de location ou si les ex époux
© Rick Henzel

conservent en indivision le bien acquis au


cours du mariage.

28 25 millions de Propriétaires - Mars 2017


ANALYSE

Réforme du droit des contrats:


les premiers impacts en
matière de baux commerciaux
(suite et fin)
Dans un article paru en janvier 2017, nous vous avons présenté une première partie de la
réfome du droit des contrats, organisée par l’ordonnance n° 2016-131 du 10 février 2016,
et ses impacts concernant le bail commercial, et plus particulièrment ceux concernant la
négociation de ce dernier. Plaçons-nous cette fois-ci postérieurement à la conclusion d’un
bail commercial pour appréhender les impacts de cette réforme.

Pierre Benoit Vermande


avocat au sein du département Droit des Sociétés, cabinet FIDAL (Toulouse)

L’exécution du contrat o&ŨCUUWTGTȌICNGOGPVNCRGTOCPGPEGGVNC de la substance du bail.


SWCNKVȌFGURNCPVCVKQPUšz
L’obligation de délivrance affectée et Compte tenu de la nouvelle rédaction de
par la réforme kšLe bailleur est tenu de délivrer la chose NŨCTVKENGFW%QFGEKXKNNCRTWFGPEG
en bon état de réparations de toute espèce. est encore plus de rigueur et conduit
Le nouvel article 1170 du Code civil dispose +NFQKV[HCKTGRGPFCPVNCFWTȌGFWDCKNVQWVGU aujourd’hui à ne pas entretenir trop
SWGkšVQWVGENCWUGSWKRTKXGFGUCUWDUVCPEG NGUTȌRCTCVKQPUSWKRGWXGPVFGXGPKTPȌEGU- d’espoir sur les clauses qui dérogent
l’obligation essentielle du débiteur est réputée UCKTGUCWVTGUSWGNGUNQECVKXGUšz à l’obligation de délivrance du bailleur.
non écritešz La jurisprudence considère depuis les arrêts
Comme chacun sait, l’obligation essentielle kšChronopostšzGP
 que les clauses šš%QOQEVQDTGPo
du bailleur est son obligation de délivrance FȌTQIGCPVȃNŨQDNKICVKQPFGFȌNKXTCPEGFW

CTVKENGGVFW%QFGEKXKN š bailleur sont annulables, puisque cette déro-


kš.GDCKNNGWTGUVQDNKIȌRCTNCPCVWTGFW gation affectant une obligation essentielle
EQPVTCVGVUCPUSWŨKNUQKVDGUQKPFŨCWEWPG du bailleur impacte l’objet même du contrat.
UVKRWNCVKQPRCTVKEWNKȋTGš Certains auteurs envisageaient toutefois
o&GFȌNKXTGTCWRTGPGWTNCEJQUGNQWȌGGV que le bailleur puisse convenir d’une déroga-
UŨKNUŨCIKVFGUQPJCDKVCVKQPRTKPEKRCNGWP VKQPRCTVKGNNGȃUQPQDNKICVKQPFCPUNCOGUWTG
NQIGOGPVFȌEGPV.QTUSWGFGUNQECWZNQWȌU où celle-ci est mentionnée clairement et
à usage d’habitation sont impropres à cet LWUVKƒȌGRCTWPGQWRNWUKGWTUEQPVTGRCTVKGU
WUCIGNGDCKNNGWTPGRGWVUGRTȌXCNQKTFG Au regard de la réforme, ce point amène
la nullité du bail ou de sa résiliation pour ȃUŨKPVGTTQIGTUWTNCRȌTGPPKVȌFGEGVVG
demander l’expulsion de l’occupant ; RTCVKSWGSWKEQPUKUVGȃFȌTQIGTCWZFKURQUK-
o&ŨGPVTGVGPKTEGVVGEJQUGGPȌVCVFGUGTXKT tions des articles 1719 et 1720 du Code civil.
ȃNŨWUCIGRQWTNGSWGNGNNGCȌVȌNQWȌG Même si la jurisprudence a considéré que
© VTT Studio

o&ŨGPHCKTGLQWKTRCKUKDNGOGPVNGRTGPGWT ces articles sont supplétifs de la volonté


pendant la durée du bail ; des parties, ils sont objectivement au cœur

25 millions de Propriétaires - Mars 2017 29


ANALYSE
L’inexécution du contrat SWGUQPEQEQPVTCEVCPVPGUŨGZȌEWVGTCRCUȃ
NŨȌEJȌCPEGGVSWGNGUEQPUȌSWGPEGUFGEGVVG
L’ordonnance a manifestement modifié KPGZȌEWVKQPUQPVUWHƒUCOOGPVITCXGURQWT
le régime des sanctions de l’inexécution GNNG%GVVGUWURGPUKQPFQKVȍVTGPQVKƒȌGFCPU
du contrat. les meilleurs délaisšz
Avant cette réforme, l’ancien article 1184 Ce deuxième article vise même l’exception
organisait le régime de la condition réso- d’inexécution par anticipation.
NWVQKTG
SWKRGTOGVVCKVȃWPGRCTVKGNQTUSWG La réforme paraît ainsi faciliter le droit de
NŨCWVTGPGUŨGZȌEWVGRCUUQKVFGNCHQTEGTȃ suspendre l’exécution de son obligation
s’exécuter soit de demander en justice la par une partie.
résolution du contrat) et l’ancien article 1147 Cette avancée peut paraître, en pratique,
aménageait l’attribution de dommages et majeure. Toutefois, compte tenu des
intérêts en cas d’inexécution. Un certain conditions imposées par ces deux textes
PQODTGFGPQWXGCWZVGZVGUUQPVCKPUKȃ
kšKPGZȌEWVKQPUWHƒUCOOGPVITCXGšzPQVKƒ-

© polkadot
souligner. ECVKQPŲ KNGUVXKXGOGPVTGEQOOCPFȌFG
UŨCFTGUUGTȃFGURTQHGUUKQPPGNUFWFTQKVUK
L’exception d’inéxecution l’un des cocontractants souhaite mettre
en application ces textes sur l’exception NGWTȃTȌCNKUGTFGUVTCXCWZCRTGUNŨCXQKTOKU
Avant la réforme, il faut savoir qu’en matière d’inexécution. GPFGOGWTGFGNGUTȌCNKUGTGVȃFȌHCWVGP
de baux commerciaux, l’exception d’inexé- Ainsi, dans l’attente de la jurisprudence qui UGHCKUCPVCWVQTKUGTRCTNGLWIGȃNGUHCKTGȃ
cution était très encadrée. UGTCCOGPȌGȃFȌƒPKTNGUEQPVQWTUFGEG sa place et en en obtenant en suivant son
.ŨGZEGRVKQPFŨKPGZȌEWVKQP
SWKRGTOGVȃWP mécanisme, la prudence reste de rigueur. remboursement. Le preneur ne pouvait
contractant de ne pas s’exécuter lorsque CKPUKUGHCKTGLWUVKEGNWKOGOG
UCWHECU
son cocontractant ne s’exécute pas en trés particulier du type urgence).
RTGOKGT PŨȌVCKVRCUEQFKƒȌGFCPUNG%QFG Astuce de rédaction Désormais les nouveaux articles 1221 et
civil en tant que tel, seuls certains textes y FW%QFGEKXKNFKURQUGPVš
#ƒPFŨCNNGTFCPUNGUGPUFGUCTVKENGU
HCKUCKGPVTȌHȌTGPEGšNCLWTKURTWFGPEGNŨCXCKV šš0QWXGNCTVKENGFW%QFGEKXKNškšLe
1219 et 1220 du Code civil, et faciliter
toutefois généralisée dans les contrats ETȌCPEKGTFŨWPGQDNKICVKQPRGWVCRTȋUOKUGGP
NCSWCNKƒECVKQPFŨǡkšKPGZȌEWVKQPUWHƒ-
U[PCNNCIOCVKSWGU
EQPVTCVFCPUNGSWGNNGU FGOGWTGGPRQWTUWKXTGNŨGZȌEWVKQPGPPCVWTG
samment gravešzRQWTRQWXQKTWVKNKUGTNG
parties ont des obligations réciproques). sauf si cette exécution est impossible ou s’il
mécanisme d’exception d’inexécution, il
Cette exception d’inexécution ne pouvait existe une disproportion manifeste entre son
pourrait être envisagé d’insérer dans les
être soulevée par le preneur, en cas de coût pour le débiteur et son intérêt pour le
baux commerciaux des clauses visant à
OCPSWGOGPVUFWDCKNNGWTȃNŨQDNKICVKQP créancierǡz
KFGPVKƒGTNGUQDNKICVKQPUFȌVGTOKPCPVGU
d’exécuter des réparations nécessaires, šš0QWXGNCTVKENGFW%QFGEKXKNškšAprès
du contrat dont l’inexécution serait
que lorsque ces manquements avaient pour OKUGGPFGOGWTGNGETȌCPEKGTRGWVCWUUK
particulièrement grave.
conséquence que le locataire ne pouvait FCPUWPFȌNCKGVȃWPEQțVTCKUQPPCDNGU
Ce type de clause, qui pourrait être
utiliser les locaux louésšNGRTGPGWTRQWXCKV HCKTGGZȌEWVGTNWKOȍOGNŨQDNKICVKQPQWUWT
insérée dans chaque contrat, ne viserait
soulever cette exception et ne pas payer le CWVQTKUCVKQPRTȌCNCDNGFWLWIGFȌVTWKTGEG
pas toujours les mêmes obligations,
loyer lorque son bailleur avait par exemple SWKCȌVȌHCKVGPXKQNCVKQPFGEGNNGEK+NRGWV
EGNNGUEKȌVCPVKFGPVKƒȌGUGPHQPEVKQP
OCPSWȌȃUQPQDNKICVKQPGPTCKUQPFG demander au débiteur le remboursement des
FGNCTGNCVKQPURȌEKƒSWGGVWPKSWGGPVTG
l’impossibilité d’exploiter pour le preneur UQOOGUGPICIȌGUȃEGVVGƒP
un bailleur et son preneur. Ainsi, cette
un ballon d’eau chaude, élément indispen- +NRGWVCWUUKFGOCPFGTGPLWUVKEGSWGNG
clause sur-mesure aurait une seconde
UCDNGȃNCDQPPGGZRNQKVCVKQPFŨWPUCNQP débiteur avance les sommes nécessaires
XQECVKQPš GNNG RQWTTCKV ȍVTG WP FGU
de coiffure, rendant le local inexploitable. à cette exécution ou à cette destructionšz
éléments retenus par le juge pour ne pas
Le nouvel article 1219 du Code civil dispose L’attention du lecteur est ainsi attirée sur la
SWCNKƒGTNGFKVDCKNFGEQPVTCVFŨCFJȌUKQP
CWLQWTFŨJWKSWGškšUne partie peut refuser mise en place de mise en demeure préalable.
FŨGZȌEWVGTUQPQDNKICVKQPCNQTUOȍOGSWG De plus, le créancier de l’obligation devra être
EGNNGEKGUVGZKIKDNGUKNŨCWVTGPŨGZȌEWVGRCU XKIKNCPVSWCPVȃNCPQVKQPFGkšdisproportion
NCUKGPPGGVUKEGVVGKPGZȌEWVKQPGUVUWHƒ- L’exécution forcée en nature manifeste entre son coût pour le débiteur
samment gravešz GVUQPKPVȌTȍVRQWTNGETȌCPEKGTšzRQWTNG
Le nouvel article 1220 poursuit en indiquant Cette exécution était prévue par l’ancien RTGOKGTGVFGkšEQțVTCKUQPPPCDNGšzRQWTNG
SWŨkšune partie peut suspendre l’exécution article 1144 du Code civil et permettait second, notions qui seront interprétées par
FGUQPQDNKICVKQPFȋUNQTUSWŨKNGUVOCPKHGUVG notammant au locataire de forcer son bail- le juge, et qu’il faut donc anticiper.

30 25 millions de Propriétaires - Mars 2017


ANALYSE
On pourrait dès lors envisager que le preneur Le débiteur peut à tout moment saisir le juge
puisse demander une baisse de loyer en cas pour contester la résolution. Le créancier doit
FGOCPSWGOGPVFWDCKNNGWTȃNŨWPGFGUGU alors prouver la gravité de l’inexécutionšz
QDNKICVKQPU
VTCXCWZGPVTGVKGPŲ  La résiliation est dorénavant possible par
XQKGFGPQVKƒECVKQPGPECUFGECTGPEGFW
Résolution unilatérale du bail FȌDKVGWTFGNŨQDNKICVKQPSWKEQPUGTXGȃ
tout moment le droit de saisir le juge pour
.GPQWXGNCTVKENGFKURQUGSWGškšLa la contester. Sauf urgence, une mise en
résolution résulte soit de l’application d’une demeure préalable doit être adressée.
ENCWUGTȌUQNWVQKTGUQKVGPECUFŨKPGZȌEWVKQP Ce mécanisme, aux risques et périls de son
UWHƒUCOOGPVITCXGFŨWPGPQVKƒECVKQPFW auteurGUVOCPKHGUVGOGPVFGUVKPȌȃFGU
créancier au débiteur ou d’une décision de situations dans lesquelles la poursuite du
justicešz bail est impossible.
L’ordonnance du 10 février 2016 a instauré .ȃGPEQTGNCSWGUVKQPFGNCITCXKVȌFW
la possibilité de résoudre unilatéralement manquement invoqué sera nécessairement
le bail par simple notification «šGPECU TGPXQ[ȌGȃNŨCRRTȌEKCVKQPUQWXGTCKPGFGU
FŨKPGZȌEWVKQPUWHƒUCOOGPVITCXGšz magistrats. Mais il faut envisager, avec
%GVVGCRRCTGPVGUKORNKƒECVKQPTKUSWGFG RTWFGPEGVQWVGHQKUWPGUKORNKƒECVKQPFGU
se retourner contre son utilisateur car si la règles applicables. La prudence reste de
TȌUQNWVKQPRCTCȑVUKORNKƒȌGNGULWIGUFGXTQPV rigueur et il est vivement recommandé de
apprécier précisément la notion d’«šKPGZȌ- XQWUCFTGUUGTȃXQVTGEQPUGKNJCDKVWGNUK
© hcast

EWVKQPUWHƒUCOOGPVITCXGšzUQWOGVVCPV vous souhaitez utiliser ces dispositions.


NŨCEVKQPȃWPCNȌCLWTKFKSWG
Le nouvel article 1226 du Code civil continue
La réduction du prix pour inexécution GPRTȌXQ[CPVSWGš
Pour conclure ces deux articles rela-
imparfaite kš.GETȌCPEKGTRGWVȃUGUTKUSWGUGVRȌTKNU
tifs à la réforme du droit des contrats
TȌUQWFTGNGEQPVTCVRCTXQKGFGPQVKƒECVKQP
appliquée aux baux commerciaux, il
Le créancier d’une obligation peut également 5CWHWTIGPEGKNFQKVRTȌCNCDNGOGPVOGVVTGGP
apparaît ainsi que les nouveaux textes
solliciter une réduction du prix du contrat demeure le débiteur défaillant de satisfaire à
qui en découlent auront inévitablement
en cas d’exécution imparfaite du débiteur. son engagement dans un délai raisonnable.
des impacts sur l’approche des baux
0QWXGNCTVKENGFW%QFGEKXKNškšLe La mise en demeure mentionne expressément
commerciaux, paraissant simplifier
ETȌCPEKGTRGWVCRTȋUOKUGGPFGOGWTG SWŨȃFȌHCWVRQWTNGFȌDKVGWTFGUCVKUHCKTGȃ
certains mécanismes.
accepter une exécution imparfaite du contrat UQPQDNKICVKQPNGETȌCPEKGTUGTCGPFTQKVFG
Toutefois, comme pour beaucoup de
et solliciter une réduction proportionnelle du résoudre le contrat.
réformes, c’est la pratique et la juris-
RTKZ5ŨKNPŨCRCUGPEQTGRC[ȌNGETȌCPEKGT .QTUSWGNŨKPGZȌEWVKQPRGTUKUVGNGETȌCPEKGT
prudence qui permettront de déceler
PQVKƒGUCFȌEKUKQPFGTȌFWKTGNGRTKZFCPU PQVKƒGCWFȌDKVGWTNCTȌUQNWVKQPFWEQPVTCV
toute sa portée.
les meilleurs délaisšz GVNGUTCKUQPUSWKNCOQVKXGPV

25 millions de Propriétaires - Mars 2017 31


DÉCRYPTAGE

Médiation de l’énergie :
pour quelles requêtes ?
Le Médiateur national de l’énergie est une autorité administrative indépendante qui a
pour mission de proposer des solutions amiables aux litiges et d’informer et conseiller les
consommateurs comme les professionnels de l’énergie.

Céline Capayrou

•šš.GUNKVKIGU
La recevabilité IC\RȌVTQNGNKSWȌHKȌ
)2. HKQWNDQKUGV Le Médiateur de l’énergie traite les litiges
réseaux de chaleur. L’électricité et le gaz nés de contrats conclus avec une entreprise
3WGNTGSWȌTCPVRQWTSWGNNGTGSWȍVGǡ!.C naturel sont les deux sources d’énergie du secteur de l’énergie, qu’il s’agisse du
TȌRQPUGȃEGVVGSWGUVKQPUGVTQWXGFCPU les plus consommées, elles concentrent fournisseur ou du distributeur.
les conditions de saisine
 du médiateur l’essentiel des requêtes. %GUEQPVTCVURGWXGPVȍVTGTGNCVKHUȃNCHQWT-
de l’énergie, mises en conformité avec niture de l’énergie et aux services qui y sont
NCNȌIKUNCVKQPTGNCVKXGȃNCOȌFKCVKQPFGU •šš.GUTGSWȌTCPVU liés, aux contrats de raccordement ainsi
litiges de la consommation
 GVTGNCVKXGUȃ Les consommateurs particuliers, les syndi- qu’aux contrats sur les services annexes
la source d’énergie, au requérant, au type cats de copropriétaires, les artisans, les FGUHQWTPKUUGWTUǡ
de litige et au recours préalable. commerçants, les professions libérales, Le médiateur n’a pas compétence pour les
certaines petites entreprises, les associa- NKVKIGUEQPEGTPCPVǡ
Conditions particulières de saisine VKQPUȃDWVPQPNWETCVKHGVNGUEQNNGEVKXKVȌU ššNCHQTOCVKQPFWEQPVTCV
GZǡXGPVGUUCPU
•šš.ŨȌPGTIKG locales peuvent saisir le Médiateur de commande préalable, démarchage et vente
Toutes les formes d’énergie domestiques l’énergie, directement ou par l’intermédiaire ȃFKUVCPEGCXGERTCVKSWGUEQOOGTEKCNGU
UQPVEQPEGTPȌGUǡȌNGEVTKEKVȌIC\PCVWTGN du tiers les représentant. CDWUKXGU ǡ
-ššNCRTQFWEVKQPFŨȌNGEVTKEKVȌ
RJQVQXQNVCȒSWG
éolienne).

Conditions générales de
saisine(3)š
-ššle consommateur a tenté, au préalable,
de résoudre son litige directement
auprès du service client compétent par
une réclamation écrite dans un délai
compris entre deux mois et un an avant
FGUCKUKTNG/ȌFKCVGWT
-ššla demande n’est pas infondée ou
© PV

CDWUKXG
-ššle dossier n’est pas examiné simul-
tanément par un autre médiateur ou
WPVTKDWPCN
-ššle consommateur introduit sa
FGOCPFGFCPUWPFȌNCKKPHȌTKGWTȃWP
CPȃEQORVGTFGUCTȌENCOCVKQPȌETKVG
auprès du professionnel.

32 25 millions de Propriétaires - Mars 2017


DÉCRYPTAGE
La saisine en pratique
Entretien avec Jean Gaubert,
Elle est gratuite et réalisable sous 2 formats
différents. Médiateur national de l’énergie
.ŨQWXGTVWTGFWOCTEJȌFGUȌPGTIKGUǡCVGNNGGPVTCȑPȌFGU
Déclarer le litige en ligne
NKVKIGURCTVKEWNKGTUǡ!
La plateforme internet SOLLEN est le
UGTXKEGFGTȋINGOGPVGPNKIPGFȌFKȌȃ )NQDCNGOGPVEJCPIGTFGHQWTPKUUGWTUGUVWPGCEVKQPUKORNGSWK
la saisine du Médiateur. www.sollen.fr se déroule sans accroc. Depuis 10 ans, la majorité des litiges
dont je suis saisi concerne la contestation des niveaux de
Déclarer le litige par courrier EQPUQOOCVKQPHCEVWTȌUEGSWKPŨGUVRCUNKȌȃNŨQWXGTVWTGFWOCTEJȌȃNCEQPEWTTGPEG
Il faut compléter le formulaire
 et J’ai cependant constaté, chez certains fournisseurs ayant connu un afflux important
l’envoyer, sans l’affranchir, annexé des FGPQWXGCWZENKGPVUWPCEETQKUUGOGPVFGNKVKIGUkšsimplesšzNKȌUȃFGUFȌHCKNNCPEGU
FQEWOGPVUTGNCVKHUCWNKVKIGȃ des systèmes d’information ou un service de gestion clientèle sous-dimensionné.
Médiateur national de l’énergie
Les compteurs communicants vont-ils permettre de réduire les litiges liés à la
Libre réponse n° 59252
HCEVWTCVKQP!
75443 PARIS Cedex 09
Les compteurs communicants vont permettre un relevé de la consommation plus
HTȌSWGPVCWUUKLGRGPUGSWŨKNUFGXTCKGPVTȌFWKTGNGUNKVKIGUNKȌUȃNCHCEVWTCVKQP+NUXQPV
également permettre aux consommateurs de suivre plus facilement leur consommation
Examen du dossier d’énergie et donc de mieux la maîtriser.

Étude préalable du dossier DzVGUXQWUUCKUKFGNKVKIGUTGNCVKHUCWZEQNQPPGUOQPVCPVGUǡ!


Oui. Et le nombre de recommandations que nous effectuons sur le sujet augmente
L’analyse de recevabilité détermine la
chaque année ! Malheureusement, concernant les colonnes montantes, mes recom-
compétence des services du Médiateur.
mandations sont rarement suivies par les opérateurs. C’est un sujet complexe qui
2QWTWPNKVKIGTGEGXCDNGǡNGTGSWȌTCPVGUV
OȌTKVGSWŨQPUŨ[CVVCTFGRWKUSWGšEQNQPPGUOQPVCPVGUȌNGEVTKSWGUUGTCKGPV
informé par écrit du déroulement, des délais
XȌVWUVGUGVFQPEȃTȌPQXGT+NPŨGZKUVGRCURQWTNŨKPUVCPVFGECFTGLWTKFKSWGENCKTGOGPV
prévisibles et de la possibilité de se retirer
FȌƒPK.ŨȌNCDQTCVKQPFŨWPGUQNWVKQPRȌTGPPGRQWTNGƒPCPEGOGPVFGNGWTTȌPQXCVKQPHCKV
FGNCOȌFKCVKQPȃVQWVOQOGPV
partie des mesures que je considère comme prioritaires pour l’année 2017.
(CEGȃWPNKVKIGPQPTGEGXCDNGNGTGSWȌTCPV
est informé dans un délai maximum de trois 3WGNNGCPCN[UGHCKVGUXQWUFGXQVTGOKUUKQP!
semaines avec le suivi approprié selon deux
Depuis sa mise en place il y a 10 ans, l’institution publique que je représente a deux
UKVWCVKQPUFKUVKPEVGUǡ
OKUUKQPUǡTȌINGTNGUNKVKIGUKPFKXKFWGNUGVKPHQTOGTNGUEQPUQOOCVGWTUFŨȌPGTIKG
NGNKVKIGGUVKTTGEGXCDNGGPNŨȌVCV
UCKUKPG

UKVGenergie-info.frGVPoXGTVššš /QPCEVKQPOGRGTOGVFŨKFGPVKƒGT
RTȌOCVWTȌGQWVTQRVCTFKXGRCTGZGORNG ǡ
les mauvaises pratiques et les dysfonctionnements pour améliorer le marché de
les parties sont informées des conditions
l’énergie et les droits des consommateurs. J’ai notamment soutenu la mise en place
FŨWPGHWVWTGTGEGXCDKNKVȌFWFQUUKGTǡ
de nouvelles mesures telles que la trêve hivernale des coupures d’énergie, la limitation
NGNKVKIGGUVJQTUEJCORFGEQORȌVGPEGǡFW
FGUTCVVTCRCIGUFGHCEVWTCVKQPȃOQKUGVNGEJȋSWGȌPGTIKG
Médiateur : le requérant est orienté vers
une démarche adéquate et les services du
/ȌFKCVGWTUKIPCNGPVNGNKVKIGȃNŨGPVTGRTKUG
concernée, lorsque les premières démarches acte de la résolution du litige par la forma- La recommandation
du requérant sont restées sans suite. lisation d’un accord amiable.
šš&QUUKGTEQORNGZGǡGPNŨCDUGPEGFGUQNW- La proposition de solution au litige
Analyse du dossier tion proposée par l’opérateur dans le délai prend la forme d’une recommandation

Les services du Médiateur classent les ƒZȌQWFŨCEEQTFCOKCDNGGPVTGNGURCTVKGU EQOOWPKSWȌGRCTȌETKVȃEJCEWPGFGU
litiges selon la teneur du dossier. NG/ȌFKCVGWTRTQEȋFGȃWPGKPUVTWEVKQP parties, libres de suivre ou non l’avis du
šš&QUUKGTUKORNGǡNG/ȌFKCVGWTKPXKVGNŨQRȌ- CRRTQHQPFKGFWFQUUKGTȃNŨCRRWKFGVQWV Médiateur. Les opérateurs sont tenus
TCVGWTȃNWKUQWOGVVTGWPGRTQRQUKVKQPFG FQEWOGPVWVKNGȃNCEQORTȌJGPUKQPFGU d’informer le Médiateur dans un délai
UQNWVKQPFCPUWPFȌNCKƒZȌGNNGGUVGPUWKVG HCKVU
JKUVQTKSWGFGUEQPUQOOCVKQPUGV de deux mois des suites qu’ils comptent
transmise au requérant. des échanges avec le client, compte-rendu FQPPGTȃEGVVGTGEQOOCPFCVKQPUWKXKG
Si cette solution est jugée équitable et FŨKPVGTXGPVKQPRKȋEGUEQORVCDNGUŲ RQWT GPOQ[GPPGȃšRCTNGUHQWTPKUUGWTU
acceptée par les parties, le Médiateur prend préparer sa recommandation. Le délai réglementaire d’émission des

25 millions de Propriétaires - Mars 2017 33


DÉCRYPTAGE 50% contestation
des niveaux
Typologie des litiges
recommandations du Médiateur national de consommation
recevables en 2015
FGNŨȌPGTIKGGUVƒZȌȃLQWTU
 ȃEQORVGT facturés
Extrait Le médiateur natio-
FGNCFCVGFGPQVKƒECVKQPFGTȌEGRVKQPFW nal de l’énergie - Rapport 11% Paiement
dossier complet. Le médiateur s’efforce d’activité 2015
et règlement
toutefois de respecter le délai de deux
mois pour les cas les plus simples.
8% Facture

Recommandations génériques 7% Qualité


Le Médiateur national de l’énergie de fourniture
rend également des recommandations
génériques
 qui proposent des évolu-
tions pour améliorer le fonctionnement 8% Prix/Tarif
FWOCTEJȌFGNŨȌPGTIKGCWDȌPȌƒEGFGU
consommateurs, et prévenir les litiges. 4% Raccordement
Elles s’adressent principalement aux four- Réseaux
nisseurs et aux distributeurs d’énergie et
6% Autres
CWZGPVTGRTKUGUNQECNGUFGFKUVTKDWVKQP
mais elles peuvent également concerner
tous les acteurs qui concourent au bon
fonctionnement du marché de l’énergie
Chiffres clé 2015

RQWXQKTURWDNKEU%QOOKUUKQPFGTȌIW- ÖNKVKIGUQPVHCKVNŨQDLGVFŨWPGFGOCPFGFGOȌFKCVKQP
NCVKQP FG NŨȌPGTIKGŲ  ÖNKVKIGUTGEGXCDNGU
TGEQOOCPFCVKQPUȌETKVGUGVTȌUQNWVKQPKPHQTOGNNG
ou abandon)
šš#TVKENG.FW%QFGFGNŨȌPGTIKG
šš&ȌETGVPoFWQEVQDTGTGNCVKHȃ ÖTGEQOOCPFCVKQPUȌETKVGU
š
la médiation des litiges de consommation Ö61 jours délai moyen de clôture d’un dossier recevable (68 en 2014)
šš#TVKENG.FW%QFGFGNCEQPUQOOCVKQP
šš&KURQPKDNGGPVȌNȌEJCTIGOGPVUWTNGUKVGwww. Ö-15 % de litiges enregistrés /2014 (amélioration du traitement des réclamations par
energie-mediateur.fr NGUQRȌTCVGWTUUWKVGCWZTGEQOOCPFCVKQPUFGUCPPȌGURTȌEȌFGPVGUGVšJKXGTUFQWZ
šš#TVKENG.%QFGFGNŨȌPGTIKG réduisant les contestations de facture)
šš#TVKENG4FW%QFGFGNCEQPUQOOCVKQP
šš.KUVGUWTwww.energie-mediateur.fr
Ö5CKUKPGǡRCTFGURCTVKEWNKGTU

34 25 millions de Propriétaires - Mars 2017


DÉCRYPTAGE

Le changement
d’affectation d’un bien
Au fil des ans, l’évolution de l’usage d’un immeuble peut s’avérer nécessaire. Un logement
situé dans le quartier des affaires d’une grande ville pourrait avantageusement s’aménager
en bureau car la demande y est forte. À l’inverse, dans des quartiers périphériques, un
usage commercial initialement prisé peut être moins recherché avec l’évolution du quartier
et susciter une réflexion sur la transformation du bâtiment en logement. La réhabilitation
d’un immeuble vétuste peut aussi être l’occasion de réfléchir à un changement d’usage.

Bertrand Desjuzeur

Pour que vous puissiez choisir en toute 6QWTFŨJQTK\QPFGSWGNSWGUSWGUVKQPUȃPG De façon traditionnelle, on considérait que
connaissance de cause votre projet, pas éluder. le pouvoir administratif exerçait un contrôle
vous devez intégrer dans votre réflexion NQTUFGNŨȌFKƒECVKQPFWDȅVKOGPVOCKUSWG
le contexte réglementaire. En effet, les UQPRQWXQKTUŨCTTȍVCKVNȃ1TFGRNWUGPRNWU
pouvoirs publics contrôlent les change- NŨCFOKPKUVTCVKQPEJGTEJGȃEQPVTȖNGTNCXKGFW
ments d’usage, notamment dans un objectif Les règles d’urbanisme DȅVKOGPVCWFGNȃFGUQPȌFKƒECVKQP.GDWV
de protection du parc de logements. Par est généralement d’assurer une préserva-
ailleurs, dans un immeuble en copropriété, le Le droit de l’urbanisme intervient sur le tion du parc de logements, pour éviter que
changement doit se faire en conformité avec contrôle des destinations au moment de la dans les quartiers centraux des grandes
les exigences du règlement de copropriété. EQPUVTWEVKQPFWDȅVKOGPVEŨGUVȃFKTGNQTU agglomérations, le développement du parc
+NPGHCWVRCUPQPRNWUQWDNKGTNŨCURGEVƒUECN de la délivrance d’un permis de construire. de bureaux ne fasse disparaître l’habitat.

La protection du logement
Le Code de la construction et de l’habitation
comporte donc un chapitre consacré au
changement d’usage des locaux d’habitation

CTV.GVUWKXCPVU +NUŨCRRNKSWGFCPU
NGUEQOOWPGUFGRNWUFGšJCDKVCPVU
GVFCPUNCRGVKVGEQWTQPPG
*CWVUFG5GKPG
Seine-Saint-Denis et Val-de-Marne). Dans
les autres communes, cette réglementation
peut être étendue sur proposition du maire.
+NHCWVFQPEXQWUTGPUGKIPGTȃNCOCKTKGRQWT
XȌTKƒGTUKWPGFȌEKUKQPCȌVȌRTKUGGPEGUGPU
dans votre commune.
Dans les communes concernées, le change-
OGPVFŨWUCIGFGUNQECWZFGUVKPȌUȃNŨJCDK-
VCVKQPGUVUQWOKUȃCWVQTKUCVKQPRTȌCNCDNG
© Xiongmao

.GEJCPIGOGPVGUVCRRTȌEKȌRCTTCRRQTVȃNC
date du 1er janvier 1970. La loi précise que

25 millions de Propriétaires - Mars 2017 35


DÉCRYPTAGE

Les 5 destinations
du Code de l'urbanisme
nšš'ZRNQKVCVKQPUCITKEQNGGVHQTGUVKȋTG
ošš*CDKVCVKQP
p %QOOGTEG GV CEVKXKVȌU FG UGTXKEG
q DZSWKRGOGPVFŨKPVȌTȍVEQNNGEVKHGV
services publics
r #WVTGUCEVKXKVȌUFGUUGEVGWTU
secondaire ou tertiaire

Ces destinations ont été précisées en

© Philippe Bernard
vingt sous-destinations par un arrêté du
10 novembre 2016. Par exemple, le logement
UGFȌENKPGGPFGWZUQWUFGUVKPCVKQPUšNG
NGHCKVFGNQWGTWPNQECNOGWDNȌFGUVKPȌȃ copropriété ne n’y oppose pas. logement et l’hébergement.
NŨJCDKVCVKQPȃWPGENKGPVȋNGFGRCUUCIGSWK Ces dispositions ont été insérées dans le En cas de changement de destination ou en
n’y élit pas domicile est considéré comme Code de la construction et de l’habitation cas de changement de sous-destinations,
un changement d’usage. RCTNCNQKFWCQțVCƒPPQVCOOGPV SWKUŨCEEQORCIPGFGVTCXCWZFGOQFKƒ-
L’autorisation de changement d’usage de faciliter le développement du télétravail cation de la structure du bâtiment ou de
GUVFȌNKXTȌGRCTNGOCKTG
CTV. et le commerce électronique. Mais elles ont la façade, il faut un permis de construire
1). Ce même article prévoit deux types WPQDLGVNKOKVȌšGNNGUPGRGTOGVVGPVRCUFG
CTV4š 
d’autorisation. L’autorisation peut être transformer totalement un logement en Si le changement de destination ou de
FQPPȌGȃVKVTGRGTUQPPGN&CPUEGECU local professionnel. Par ailleurs, l’occupant sous-destinations est fait sans travaux ou
elle cesse de produire effet lorsqu’il ne peut pas employer de salariés dans le CXGEFGUVTCXCWZKPVȌTKGWTUNȌIGTUKNUWHƒV
GUVOKUHKPȃVKVTGFȌHKPKVKHȃNŨGZGTEKEG local. Bien entendu, il doit aussi respecter d’une déclaration préalable.
RTQHGUUKQPPGNFWDȌPȌƒEKCKTG'NNGRGWV les clauses du règlement de copropriété et
aussi être donnée avec une condition de les clauses du bail.
EQORGPUCVKQPšFCPUEGECUNGVKVTGGUV 'PƒPNCNQKCRTȌXWWPFKURQUKVKHRCTVKEWNKGT
CVVCEJȌCWNQECNGVPQPȃNCRGTUQPPG pour les locaux situés en rez-de-chaussée. Le règlement de copropriété
En cas de vente, l’autorisation est donc L’exercice d’une activité professionnelle, y
VTCPUOKUGȃNŨCESWȌTGWT.CEQORGPUCVKQP compris commerciale, est autorisé dans Si vous décidez de changer la destination
EQPUKUVGȃCHHGEVGTCWNQIGOGPVWPCWVTG une partie d’un local d’habitation situé au du lot dont vous êtes copropriétaire, vous
NQECNRTȌEȌFGOOGPVCHHGEVȌȃWPWUCIG TG\FGEJCWUUȌGȃEQPFKVKQPSWŨGNNGUQKV FGXG\XȌTKƒGTUKNCFGUVKPCVKQPGPXKUCIȌGGUV
professionnel. Vous devez vous renseigner exercée par les occupants y ayant leur autorisée par le règlement de copropriété.
ȃNCOCKTKGRQWTEQPPCȑVTGNGUEQPFKVKQPU résidence principale et qu’elle ne provoque C’est ce document qui détermine la desti-
de la compensation. ni nuisance ni danger pour le voisinage et nation de l’immeuble, tant pour les parties
La loi prévoit un régime plus souple pour PGEQPFWKUGȃCWEWPFȌUQTFTGRQWTNGDȅVK RTKXCVKXGUSWGEQOOWPGU
CTVšFGNCNQK
RGTOGVVTG ȃ NŨQEEWRCPV FŨWP NQIGOGPV
CTV.š  du 10 juillet 1965). En conséquence, une
d’exercer dans une partie de ce logement une Si le changement d’usage s’accompagne de OQFKƒECVKQPFGNCFGUVKPCVKQPFGURCTVKGU
activité professionnelle, y compris commer- travaux nécessitant un permis de construire, privatives suppose une autorisation de
ciale, si elle n’engendre ni nuisance ni danger la demande de permis de construire ou la l’assemblée générale. Ainsi par exemple,
pour le voisinage. L’activité peut alors être déclaration préalable, vaut demande de si un copropriétaire veut remplacer une
CWVQTKUȌGRCTNGOCKTG
CTV.š &G EJCPIGOGPVFŨWUCIG
CTV.  activité commerciale et artisanale de garage
RNWUUKNŨCEVKXKVȌPGEQPFWKVȃTGEGXQKTPK GVTȌRCTCVKQPFGXQKVWTGURCTEGNNGȃECTCE-
clientèle ni marchandise, l’exercice de tère industriel, de mécanique de précision
NŨCEVKXKVȌGUVCWVQTKUȌUCPUCXQKTȃFGOCPFGT Les 5 destinations KPVGTFKVGRCTNGTȋINGOGPV
%KXe, 3 janvier
FŨCWVQTKUCVKQP
CTV.š  Le Code de l’urbanisme prévoit 5 desti- 1979). De même une activité commerciale
Dans les deux cas, le droit d’exercer l’activité PCVKQPURTKPEKRCNGU
CTV4XQKT ne peut être exercée dans un lot que le
dans sa résidence principale est accordé encadré). Elles sont énumérées par le plan TȋINGOGPVFȌUKIPGEQOOGCRRCTVGOGPVȃ
sous réserve que le bail ou le règlement de local d’urbanisme. WUCIGFŨJCDKVCVKQP
%KXe, 6 février 1991).

36 25 millions de Propriétaires - Mars 2017


DÉCRYPTAGE
Liberté encadrée vous avez un doute sur la possibilité qu’offre
le règlement, vous devez demander une
Par principe, l’article 9 de la loi de 1965 autorisation de changement. Demandez au
indique que le copropriétaire use et jouit U[PFKEFGRQTVGTNCSWGUVKQPȃNCRTQEJCKPG
librement des parties privatives mais sous la assemblée. L’assemblée des copropriétaires
condition de ne porter atteinte, ni aux droits RQWTTCCNQTUXQWUCWVQTKUGT
QWTGHWUGT NG
FGUCWVTGUEQRTQRTKȌVCKTGUPKȃNCFGUVKPCVKQP changement.
de l’immeuble. En parallèle, l’article 8 précise
que le règlement ne peut imposer aucune
restriction aux droits des copropriétaires La question des charges
GPFGJQTUFGEGNNGUSWKUGTCKGPVLWUVKƒȌGU S’agissant de la répartition des charges,
par la destination de l’immeuble. QPUCKVSWŨGPRTKPEKRGNCOQFKƒECVKQPFG
Il incombe le cas échéant au juge de déter- cette répartition suppose l’unanimité.
OKPGTUKNCOQFKƒECVKQPGPXKUCIȌGRCTNG Mais lorsque l’assemblée accorde une
EQRTQRTKȌVCKTGGUVQWPQPEQPVTCKTGȃNC autorisation de travaux, la modification

© Eléonore H
destination de l’immeuble. Ainsi par exemple de la répartition des charges qui est ainsi
WPNQVFȌUKIPȌEQOOGWPCRRCTVGOGPVȃ rendue nécessaire peut être décidée par
usage d’habitation ne peut pas être affecté NŨCUUGODNȌGȃEGVVGOȍOGOCLQTKVȌ
CTVš
ȃWPGCEVKXKVȌEQOOGTEKCNG
%KXe, 6 février de la loi de 1965). déclarer le changement de consistance ou
1991). De même, s’agissant d’un problème .CNQKRTȌXQKVRCTCKNNGWTUWPGTȋINGURȌEKƒSWG d’affectation de son local. La déclaration doit
fréquent pour des meublés, il a été jugé visant la répartition des charges, liée au ȍVTGHCKVGFCPUNGUšLQWTUFGNCTȌCNKUCVKQP
SWŨWPGUQEKȌVȌPŨGUVRCUCFOKUGȃGZGTEGT EJCPIGOGPVFŨWUCIG5GNQPNŨCTVKENGšG FWEJCPIGOGPV
CTVFW%QFGIȌPȌTCN
une activité de loueur professionnel qui FGNCNQKFWLWKNNGVUQPVRTKUGUȃ des impôts). Elle est adressée au service
QEECUKQPPGFGUPWKUCPEGU
CNNȌGUGVXGPWGU la majorité des voix des copropriétaires des impôts fonciers du lieu de situation
dégradation des moquettes) si le règle- NGUFȌEKUKQPUEQPEGTPCPVkšNCOQFKƒECVKQP des biens, sur un imprimé fourni par l’admi-
ment de copropriété interdit toute activité de la répartition des charges [relatives aux PKUVTCVKQP
HQTOWNCKTGEGTHCPoš 
EQOOGTEKCNG
%#2CTUFȌEGODTG  UGTXKEGUEQNNGEVKHUGVCWZȌNȌOGPVUFŨȌSWK- pour transformer un logement en local
5KNGEJCPIGOGPVUGNKOKVGȃWPGOQFKƒEC- pement commun] rendue nécessaire par un professionnel).
tion de la nature de l’activité commerciale changement de l’usage d’une ou plusieurs Un impact est aussi possible en cas de
exercée dans les lieux, et que le règlement parties privativesšz%GVGZVGUŨCRRNKSWGRCT XGPVG#KPUKWPTȌIKOGURȌEKƒSWGGUVRTȌXW
autorise l’activité commerciale, le chan- GZGORNGNQTUSWGFGUNQECWZȃWUCIGFŨJCDK- RQWTNGUEGUUKQPUFGNQECWZȃWUCIGFG
IGOGPVRGWVUŨGHHGEVWGTNKDTGOGPV
%KXše, VCVKQPUQPVCHHGEVȌUȃWUCIGEQOOGTEKCN bureaux ou de commerce, lorsque le cédant
10 décembre 1986). Par exemple, si le QWRTQHGUUKQPPGN
%KXe, 17 juillet 1996) GUVUQWOKUȃNŨKORȖVUWTNGUUQEKȌVȌU
GV
règlement autorise l’usage commercial sans ou lorsque des pièces inhabitables sont PQPȃNŨKORȖVUWTNGTGXGPW .GWTEGUUKQP
autre réserve que celle de l’interdiction des VTCPUHQTOȌGURQWTȍVTGCHHGEVȌGUȃNŨJCDKVC- DȌPȌƒEKGFŨWPVCWZTȌFWKVFŨ+5ȃšUKNG
nuisances, cela n’interdit pas d’exploiter VKQP
%#2CTKUOCTU .ŨCUUGODNȌG EGUUKQPPCKTGUŨGPICIGȃNGUVTCPUHQTOGTGP
WPTGUVCWTCPV
%KXe, 3 juin 1998 ou 14 FȌEKFGCNQTUNCOQFKƒECVKQP+NPGRGWVRCU locaux d’habitation dans un délai de 4 ans.
décembre 2010). y avoir de changement automatique en Depuis le 1erLCPXKGTNCNQKFGƒPCPEGU
La jurisprudence est très abondante sur HQPEVKQPFŨWPGENCWUGFWTȋINGOGPV
%# RQWT
CTVš CȌVGPFWEGVVGOGUWTG
la question de savoir si un copropriétaire Paris 25 février 1989). CWDȌPȌƒEGFGUNQECWZȃWUCIGKPFWUVTKGN
peut changer l’usage d’un lot. En voici qui sont transformés en logements.
SWGNSWGUGZGORNGUšNŨWVKNKUCVKQPFGICTCIGU
comme dépôts de matériel et d’archives est
une gêne qui crée un risque d’incendie et
En résumé, pour mener à bien votre
RQTVGCVVGKPVGȃNCUȌEWTKVȌFGNŨKOOGWDNG .ŨKPEKFGPEGƒUECNG

%KXše, 11 octobre 1995). La destination du projet, et après avoir consulté la mairie,


bâtiment d’un centre commercial ne peut Le changement d’affectation peut, le cas en tant que bailleur, votre premier réflexe
être autre que commerciale a jugé la Cour échéant, avoir un impact fiscal. C’est le FQKVȍVTGFGXȌTKƒGTNGUENCWUGUSWKQPV
FGECUUCVKQPȃRTQRQUFŨWPGFGOCPFGFG cas en matière d’impôts locaux. La valeur été insérées dans le bail. En tant que
transformation d’un local commercial en locative sera affectée et un local d’habitation copropriétaire, vous devez impérative-
EGPVTGEWNVWTGN
%KXe, 26 février 1997). FGXGPWȃWUCIGEQOOGTEKCNQWFGDWTGCWZ OGPVXȌTKƒGTNGEQPVGPWFWTȋINGOGPV
En conséquence, si vous avez le projet de sera imposé plus lourdement au titre de la
de copropriété.
changer la destination de votre lot et que taxe foncière. Le propriétaire est tenu de

25 millions de Propriétaires - Mars 2017 37


QUESTIONS/RÉPONSES Nos experts vous répondent Arnaud Couvelard

Copropriété
Mise en concurrence des contrats de syndic
Å Dans quelles conditions le conseil syndical est-il dispensé de présenter en assemblée générale
d’autres candidats au poste de syndic ?

La mise en concurrence des candidats FGNŨCTVKENGFŨ[FȌTQIGT%GVVGSWGUVKQPGUV KPUETKVGȃNŨQTFTGFWLQWTFGNŨCUUGODNȌG


U[PFKEUGUVXKUȌGȃNŨCTVKENGFGNCNQKFW obligatoirement inscrite à l’ordre du jour de A contrario, si la dispense n’est pas
LWKNNGV
VGNSWGOQFKƒȌRCTNCNQK l’assemblée générale concernée. CFQRVȌG
CPPȌG0 NGEQPUGKNU[PFKECN
/CETQPFWCQțV š .GEQPUGKNU[PFKECNRGWVUGRTQPQPEGTRCT doit proposer plusieurs contrats de syndic
kš6QWUNGUVTQKUCPUNGEQPUGKNU[PFKECN WPCXKUȌETKVUWTVQWVRTQLGVFGEQPVTCVFG
CPPȌG0 
procède à une mise en concurrence de U[PFKE5KWPVGNCXKUGUVȌOKUKNGUVLQKPV
RNWUKGWTURTQLGVUFGEQPVTCVFGU[PFKECXCPV ȃNCEQPXQECVKQPFGNŨCUUGODNȌGIȌPȌTCNG
la tenue de la prochaine assemblée générale concomitamment avec les projets de contrat
appelée à se prononcer sur la désignation concernés. À noter : avant la loi Macron, la loi
FŨWPU[PFKEUCPURTȌLWFKEGFGNCRQUUKDK .QTUSWGNCEQRTQRTKȌVȌPŨCRCUKPUVKVWȌFG ALUR du 24 mars 2014 organisait
NKVȌRQWTNGUEQRTQRTKȌVCKTGUFGFGOCPFGT EQPUGKNU[PFKECNNCOKUGGPEQPEWTTGPEG une mise en concurrence obligatoire
CWU[PFKENŨKPUETKRVKQPȃNŨQTFTGFWLQWTFG n’est pas obligatoirešz NQTUFGEJCSWGCUUGODNȌGCRRGNȌGȃ
l’assemblée générale de l’examen des projets se prononcer sur la désignation du
FGEQPVTCVFGU[PFKESWŨKNUEQOOWPKSWGPVȃ Lors de l’assemblée générale qui doit syndic, sauf «šNQTUSWGNGOCTEJȌNQECN
EGVGHHGV6QWVGHQKUNGEQPUGKNU[PFKECNGUV FȌUKIPGTNGU[PFKE
CPPȌG0 NGEQPUGKN FGUU[PFKEUPGRGTOGVRCUEGVVGOKUG
dispensé de procéder à cette mise en concur- U[PFKECNGUVFQPEFKURGPUȌFGRTQEȌFGTȃ en concurrencešz
CPEKGPCTVKENGFG
TGPEGNQTUSWGNŨCUUGODNȌGIȌPȌTCNGCPPWGNNG cette mise en concurrence si une dispense la loi de 1965). Ce dispositif était lourd
SWKRTȌEȋFGEGNNGCRRGNȌGȃUGRTQPQPEGTUWT CȌVȌXQVȌGNŨCPPȌGRTȌEȌFGPVGȃNCOCLQTKVȌ puisque les syndics sont généralement
NCFȌUKIPCVKQPFŨWPU[PFKECRTȋUOKUGGP CDUQNWG
CUUGODNȌGIȌPȌTCNGFGNŨCPPȌG désignés pour un an.
concurrence obligatoire décide à la majorité N-1). Cette question est obligatoirement

Bail d’habitation
Bail conclu Congé par une
par une SCI familiale personne morale
Å Quelle doit être la durée d’un bail Å Un bailleur personne morale (SARL)
d’habitation lorsque le bailleur est une peut-il délivrer un congé pour habiter ?
SCI familiale ?
Le bailleur, personne morale, peut donner congé pour
vendre ou pour motif légitime et sérieux, mais il ne peut
.ŨCTVKENGFGNCNQKFWLWKNNGVȌPQPEGSWGkšle contrat de location pas donner un congé pour habiter, sauf s’il s’agit d’une
est conclu pour une durée au moins égale à trois ans pour les bailleurs société civile de famille répondant aux critères de l’article
RGTUQPPGURJ[UKSWGUCKPUKSWGRQWTNGUDCKNNGWTUFȌƒPKUȃNŨCTVKENGǡGV 13 de la loi du 6 juillet 1989
 .
ȃUKZCPURQWTNGUDCKNNGWTURGTUQPPGUOQTCNGUšz En tant que SARL, vous ne pouvez donc pas délivrer un
.ŨCTVKENGFGNCNQKFGXKUGNGECUFGNCkšsociété civile constituée congé pour reprise.
GZENWUKXGOGPVGPVTGRCTGPVUGVCNNKȌULWUSWŨCWSWCVTKȋOGFGITȌKPENWUšz
šškǡ.GUFKURQUKVKQPUFGNŨCTVKENGGVFGNŨCTVKENGRGWXGPVȍVTGKPXQSWȌGU
.CFWTȌGFŨWPDCKNFŨJCDKVCVKQPEQPENWRCTWPG5%+HCOKNKCNG
EŨGUVȃFKTG
C .QTUSWGNGDCKNNGWTGUVWPGUQEKȌVȌEKXKNGEQPUVKVWȌGGZENWUKXGOGPVGPVTG
constituée exclusivement entre parents et alliés jusqu’au quatrième RCTGPVUGVCNNKȌULWUSWŨCWSWCVTKȋOGFGITȌKPENWURCTNCUQEKȌVȌCWRTQƒVFGNŨWP
degré inclus) doit donc être de trois ans minimum. FGUCUUQEKȌU
Ų ǡ

38 25 millions de Propriétaires - Mars 2017


Nos experts vous répondent QUESTIONS/RÉPONSES

Copropriété
Changement d’usage d’un lot et modification
de la répartition des charges
Å Un des copropriétaires a transformé son grenier en habitation sans faire le nécessaire pour
modifier la répartition des tantièmes dans la copropriété, et ce malgré une demande du syndic.
Que pouvons-nous faire ?

Si la modification de la répartition des CHHGEVȌUȃWPWUCIGEQOOGTEKCNRTQHGU .CSWGUVKQPFGNCOQFKƒECVKQPEQTTȌNCVKXG


EJCTIGUPGRGWVPQTOCNGOGPVKPVGTXGPKTSWŨȃ UKQPPGNQWKPXGTUGOGPVǡ FGUEJCTIGUUWKVGȃWPEJCPIGOGPVFŨWUCIG
l’unanimité des copropriétaires, la loi du 10 ššFGURKȋEGUPQPJCDKVCDNGUUQPVVTCPUHQT RGWV ȍVTG RQTVȌG ȃ NŨQTFTG FW LQWT FG NC
LWKNNGVCRTȌXWFGUGZEGRVKQPUȃEGVVG OȌGURQWTȍVTGCHHGEVȌGUȃNŨJCDKVCVKQP
%# prochaine assemblée générale soit par
TȋINGGVRCTOKGNNGUƒIWTGkšNCOQFKƒECVKQP Paris, 23ème ch. A, 10 mars 1986). NGU[PFKEUQKVRCTVQWVEQRTQRTKȌVCKTG
GP
de la répartition des charges visées à l’alinéa C’est ce dernier cas qui vous intéresse. faisant la demande par lettre recommandée
1er de l’article 10 rendue nécessaire par un Dans votre copropriété, la décision de avec AR).
changement de l’usage d’une ou plusieurs OQFKƒGTNGUSWQVGURCTVUFGEJCTIGURGWV +NCRRCTVKGPVCNQTUȃNŨCUUGODNȌG
SWKRGWV
parties privativesšz
CTVKENGG  FQPE ȍVTG RTKUG ȃ NC OCLQTKVȌ FGU XQKZ FȌUKIPGTWPGZRGTVȃEGVVGƒP FGFȌEKFGT
2CTOKNGUEJCPIGOGPVUFŨWUCIGǡXKUȌURCT de tous les copropriétaires ou majorité FGNCOQFKƒECVKQP
ce texte, on peut citer les hypothèses CDUQNWG
NGEJCPIGOGPVFŨWUCIGPŨCHHGEVG 5KNCFȌEKUKQPFGOQFKƒECVKQPFGUEJCTIGU
UWKXCPVGUš pas les tantièmes de copropriété, mais les GUVXQVȌGȃNCOCLQTKVȌCDUQNWGEGNNGEKGUV
ššFGUNQECWZȃWUCIGFŨJCDKVCVKQPUQPV tantièmes de charges). opposable au copropriétaire qui a procédé
CWEJCPIGOGPVFŨWUCIG
UCWHȃEQPVGUVGT
la décision devant le tribunal dans les deux
OQKUSWKUWKXGPVNCPQVKƒECVKQPFWRTQEȋU
verbal d’assemblée).

'PƒPNQTUSWGNŨCUUGODNȌGIȌPȌTCNGFȌEKFG
de modifier la répartition des charges
ƒIWTCPVCWTȋINGOGPVFGEQRTQRTKȌVȌEGNC
GPVTCȑPGPȌEGUUCKTGOGPVWPGOQFKƒECVKQP
du règlement de copropriété et sa publica-
VKQPȃNCEQPUGTXCVKQPFGUJ[RQVJȋSWGU
GP
pratique, l’assemblée, après avoir décidé de
NCOQFKƒECVKQPFGNCTȌRCTVKVKQPFGUEJCTIGU
donne mandat au syndic de procéder aux
formalités de dépôt et de publication de
EGVVGOQFKƒECVKQPCƒPSWŨGNNGUQKVQRRQ
UCDNG ȃ VQWU GV PQVCOOGPV CWZ HWVWTU
acquéreurs des lots de l’immeuble). Ces frais
sont pris en charge par le copropriétaire qui
© mariesacha
COQFKƒȌNŨWUCIGFGUQPNQV

L’UNPI & vous


Les réponses que nous vous apportons, de manière rapide, le sont toujours sous réserve de l’appréciation souveraine des tribu-
naux. Nous ne pouvons toutefois pas répondre aux questions personnelles et conseillons de vous adresser à votre
Chambre syndicale de propriétaires et copropriétaires qui est la plus à même d’apporter la réponse adaptée à votre cas.
Retrouver les coordonnées de votre Chambre syndicale sur www.unpi.org, rubrique « Réseau UNPI »
25 millions de Propriétaires - Mars 2017 39
JURISPRUDENCE Mireille Sarlin

Copropriété Affichage à l’entrée de


Participation bénévole des copropriétaires à l’immeuble de la défaillance d’un
l’entretien courant de l’immeuble copropriétaire
Cour de cassation, 3e civ., 22 septembre 2016, n° 972, pourvoi n° 15-22593 Cour de cassation, 3e civ., 3 novembre 2016,
n° 1221, pourvoi n° 15-17150
La volonté de maîtriser les charges de copropriété peut conduire les
EQRTQRTKȌVCKTGUȃGHHGEVWGTGWZOȍOGUEGTVCKPGUVȅEJGU7PGFȌEKUKQPTȌEGPVG Un conseil syndical avait affiché sur une porte
de la Cour de cassation les encourage dans cette voie. La haute juridiction vitrée de l’immeuble une note indiquant que des
TGHWUGGPGHHGVFŨCPPWNGTWPGFȌEKUKQPFŨCUUGODNȌGSWKCXCKVCWVQTKUȌȃNC travaux n’avaient pas pu être effectués faute de
majorité simple de l’article 24 les membres du conseil syndical le souhaitant paiement de ses charges par un copropriétaire.
ȃTȌCNKUGTFKXGTUVTCXCWZFŨGPVTGVKGPFGURCTVKGUEQOOWPGUFGNCTȌUKFGPEG Seul le nombre de tantièmes détenus par celui-ci

TGORNCEGOGPVFŨCORQWNGGPVTGVKGPFGUGURCEGUXGTVURGVKVUVTCXCWZFG
  ȌVCKV RTȌEKUȌ OCKU EGNC ȌVCKV UWHƒUCPV RQWT
serrurerie et d’électricité, salage et déneigement, petits travaux de nettoyage NŨKFGPVKƒGT .G EQRTQRTKȌVCKTG KPFKTGEVGOGPV FȌUKIPȌ
et de peinture), estimant qu’une telle délibération ne constitue pas un excès avait alors assigné deux membres du conseil syndical
de pouvoir. L’assemblée avait pris la précaution d’anticiper les conséquences en réparation de son préjudice. Un juge de proximité
d’éventuels litiges en adoptant un contrat d’assurance qui couvrait les risques avait accepté cette demande de dommages-intérêts
liés aux dommages causés aux tiers par ces interventions. Par ailleurs, une au titre du droit commun de la responsabilité, en raison
assurance personnelle de chaque copropriétaire intervenant était exigée. FG NŨCVVGKPVG ECWUȌG ȃ NC TȌRWVCVKQP FW EQRTQRTKȌVCKTG
par l’affichage du conseil syndical. La Cour de
cassation censure cette décision par un moyen relevé
FŨQHƒEG 'P NŨGURȋEG NGU HCKVU TGRTQEJȌU FGXCKGPV ȍVTG
L’assemblée générale ne peut désigner qu’un seul sanctionnés au titre de l’abus de la liberté d’expression
syndic réprimé par la loi du 29 juillet 1881 et non pas sur
Cour de cassation, 3e civ., 22 septembre 2016, n° 971, pourvoi n° 15-13896 le terrain de la responsabilité délictuelle de droit
EQOOWP
CTVKENG  FW %QFG EKXKN CPEKGP CTVKENG
Une copropriété était en litige avec une entreprise chargée de travaux de 1382 avant la réforme du droit des obligations entrée
ravalement. La particularité de l’espèce était que les copropriétaires avaient en vigueur le 1er octobre dernier). Toutefois, l’article 65
FȌUKIPȌFGWZU[PFKEUȃSWKKNUCXCKGPVFQPPȌOCPFCVRQWTCUUKIPGTNŨGPVTGRTKUG de la loi de 1881 prévoyant un délai de prescription de
en justice. Une Cour d’appel avait accueilli la demande, jugeant valable la trois mois, les hauts magistrats constatent l’extinction
désignation de deux personnes pour exercer les fonctions de syndic et le de l’action du copropriétaire. Il faut en retenir qu’un
mandat donné pour intenter un procès contre leur cocontractant. La Cour EQRTQRTKȌVCKTG UŨGUVKOCPV FKHHCOȌ RCT WP CHƒEJCIG
de cassation n’est pas de cet avis. S’appuyant notamment sur l’article 17 doit agir sans tarder.
de la loi de 1965 qui prévoit que l’exécution des décisions du syndicat est
EQPƒȌGȃkšWPU[PFKEšzGVUWTNŨCTVKENGFWFȌETGVFGKPFKSWCPVSWG
«šNGUHQPEVKQPUFGU[PFKERGWXGPVȍVTGCUUWOȌGURCTVQWVGRGTUQPPGRJ[UKSWG
QWOQTCNGšzGNNGGPFȌFWKVSWGNŨCUUGODNȌGIȌPȌTCNGPGRGWVFȌUKIPGTSWŨWP
seul syndic.

L’absence de syndic ne constitue pas un vice caché


Cour de cassation, 3e civ., 8 décembre 2016, n° 1404, pourvoi n° 14-27986

Une architecte qui avait acheté deux appartements dans un même immeuble
avait assigné les vendeurs, les notaires et l’agent immobilier sur le fondement
de la garantie des vices cachés, se prévalant, entre autres, de l’absence de
syndic. Son action en réduction du prix est rejetée. La Cour de cassation
CRRTQWXGNC%QWTFŨCRRGNFŨCXQKTTGVGPWSWGkšNŨCDUGPEGFGU[PFKEPGEQPUVKVWCKV
© monregard

pas un vice de nature à rendre l’immeuble impropre à son usage d’habitation


PKȃGPFKOKPWGTVGNNGOGPVEGVWUCIGSWGNŨCEJGVGWTPGNŨCWTCKVCESWKUSWŨȃWP
prix moindrešz

40 25 millions de Propriétaires - Mars 2017


Mickael Terrom ÉCO-ÉNERGIE COPROPRIÉTÉ FICHE N° 5
Directeur division Énergétique E2C,
groupe ACCEO - Bureau d’études et d’ingénierie en bâtiments

Le Diagnostic
À échéance du 1er janvier 2017, la loi Technique Global
ALUR n° 2014-366 (loi relative au loge-
ment et à l’urbanisme rénové), publiée au
DTG
Journal Officiel du 26 mars 2014, a ins-
ššǨ5#81+4
tauré pour les copropriétés à destination
Les documents nécessaires
totale ou partielle d’habitation, la réalisa-
à réunir en vue de la réalisation d’un DTG
tion par un tiers d’un Diagnostic Tech-
nique Global (DTG). ¾
Diagnostic Technique amiante pour les copropriétés

dont le permis de construire a été déposé avant le 1er
L’objectif de cette nouvelle disposition est
juillet 1997,
d’assurer l’information des copropriétaires
¾
Contrôle technique ascenseur pour les copropriétés

sur la situation générale de leur immeuble en disposant,
en réalisant un état des lieux technique et ¾ WFKVDZPGTIȌVKSWGRQWTNGUEQRTQRTKȌVȌUFG FGNQVU

#

réglementaire du bâtiment. ȃEJCWHHCIGEQNNGEVKHGVFQPVNGRGTOKUFGEQPUVTWKTGC
été déposé avant le 1er juin 2001,
¾
Diagnostic de Performance Énergétique - DPE pour les

EQRTQRTKȌVȌUFGFGNQVUȃEJCWHHCIGEQNNGEVKHGVFQPV
Les immeubles le permis de construire a été déposé avant le 1er juin 2001,
¾
8ȌTKƒECVKQPGZVKPEVGWTURQWTNGU+OOGWDNGUFG)TCPFG

concernés Hauteur, parkings et chaufferie,
(art. 731-1 à 731-5 ¾
Plan d’évacuation et consignes de sécurité,

du Code de la construction et de l’habitation) ¾
Carnet d’entretien.


Depuis le 1er LCPXKGT   UKVWCVKQPU UQPV RQUUKDNGU 


Le DTG devra être réalisé
Immeubles de plus de 10 ans par un « professionnel
compétent »
faisant l’objet d’une mise en copropriété
- et -
1 Copropriétés faisant l’objet d’une procédure
d’insalubrité Le décret n°2016-1965
du 28/12/2016 précise
l e s é l é m e n t s re q u i s
Réalisation du Diagnostic Technique Global (DTG)
pour pouvoir réaliser
WP &KCIPQUVKE )NQDCN
Toutes les autres copropriétés
Le professionnel doit
RQUUȌFGTšFGUEQPPCKU

2 Mise au vote, en Assemblée Générale, de la


réalisation du Diagnostic Technique Global (DTG)
sances dans le domaine
du bâtiment et de l’effi-
La décision, de réaliser le DTG, devra être prise cacité énergétique et une
à la majorité simple. HQTOCVKQPFGPKXGCW$CE 
minimum ou un titre professionnel ou une inscription au tableau
'PƒPRQWTICTCPVKTUQPRNGKPKPVȌTȍVNG&6)FGXTCHCKTGCRRCTCȑVTG FŨWPQTFTGRTQHGUUKQPPGNQWWPGSWCNKƒECVKQPRTQHGUUKQPPGNNGFG
une évaluation du coût ainsi que la liste des travaux nécessaires niveau équivalent.
ȃNCDQPPGEQPUGTXCVKQPFGNŨKOOGWDNGGPRTȌEKUCPVPQVCOOGPV 2QWTEGNCXQWUFGXTG\XGKNNGTȃEGSWGNGRTGUVCVCKTGSWKTȌCNKUGTC
ceux qui devraient être menés dans les dix prochaines années. NG&6)TGURGEVGNGUEQPFKVKQPUFGEQPPCKUUCPEGFGEQORȌVGPEGU
Cela permettra d’établir un plan pluriannuel de travaux. GVFŨKPFȌRGPFCPEGSWKƒIWTGPVCWXGTUQ

25 millions de Propriétaires - Mars 2017 41


FICHE N° 5 ÉCO-ÉNERGIE COPROPRIÉTÉ
šš%100#+55#0%'5š VKUGUGVEQPVTȖNGUFȌLȃTȌCNKUȌUEGSWKRGTOGVVTCFŨQDVGPKTWP
~
DȅVKOGPV
RTQFWKVUOCVȌTKCWZȌSWKRGOGPVURCVJQNQIKGUŲ  relevé de toutes les pathologies existantes dans le bâtiment
~
VJGTOKSWGFGUDȅVKOGPVU
FKCIPQUVKERTȌEQPKUCVKQPUFŨCOȌ
 classées dans un document unique.
liorations, réhabilitation thermique, impacts des travaux), Pour chaque pathologie, les travaux devront être hiérarchisés
techniques et juridiques dans le secteur du bâtiment,
~
 UWKXCPVNGWTFGITȌFŨWTIGPEGGVCUUQEKȌUȃWPGGUVKOCVKQP
ƒPCPEKȋTGFGNGWTEQțV
~
NȌIKUNCVKXGUGVTȌINGOGPVCKTGUȃRTQRQUFGNŨJCDKVCVGVFGNC

construction et sur le fonctionnement des copropriétés,
Le Diagnostic Technique Global doit vous permettre de
~
GPIGUVKQPƒPCPEKȋTGFGUEQRTQRTKȌVȌU

FKURQUGTFŨWPXȌTKVCDNGQWVKNFŨCKFGȃNCFȌEKUKQPRQWT
Demander l’organigramme de l’équipe et le CV détaillé des
Â


personnes qui réaliseront le DTG
¾
KFGPVKƒGTNŨȌVCVFŨCXCPEGOGPVFGUQDNKICVKQPUNȌICNGU

et réglementaires,
šš%1/2DZ6'0%'5+0&DZ2'0&#0%'š ¾
anticiper l’entretien du bâti et des équipements,

diplôme sanctionnant une formation du niveau de l’enseigne-
~
 ¾
prioriser sur les 10 prochaines années, les travaux

obligatoires et réellement nécessaires, des travaux
ment postsecondaire d’une durée minimale de trois ans ou
préventifs ou d’amélioration,
FŨWPGFWTȌGȌSWKXCNGPVGȃVGORURCTVKGNFCPUNGUFQOCKPGU
des techniques du bâtiment, ¾ dopter une programmation de travaux optimisée et
a


CFCRVȌGCWZDGUQKPUURȌEKƒSWGUFGUEQRTQRTKȌVȌU
assurance responsabilité civile professionnelle,
~

et de ses habitants.
~
CVVGUVCVKQPUWTNŨJQPPGWTFŨKORCTVKCNKVȌGVFŨKPFȌRGPFCPEGȃ

l’égard du syndic, des fournisseurs d’énergie et des entreprises
pouvant intervenir sur les immeubles ou ses équipements,
ššǨ016'4
références en copropriété.
~

2QWTEQPƒTOGTSWGNŨGPUGODNGFGUETKVȋTGUOȌVJQFQ
D emander une copie des diplômes de l’intervenant,
Â

 logiques sont remplis, n’hésitez pas à vous référer à un
attestations d’assurance, attestation d’indépendance, exemple de rendu ainsi qu’à un devis précis sur le déroulé
liste des références… de la mission, les actions menées et le matériel utilisé.

ǨSWKUŨCFTGUUGT RQWT TȌCNKUGT UQP &6) !


'PƒPXGKNNG\ȃEGSWGXQVTG&6)RWKUUG
Bureaux d’études bâtiment, Bureaux d’études thermiques bâtiment, ȍVTGOKUȃLQWTUKORNGOGPV
Architectes, Diagnostiqueurs spécialisés dans le traitement des En effet, si une fois réalisé, des exper-
RCVJQNQIKGUFW DȅVKOGPV GP XȌTKƒCPV ȃ EJCSWG HQKU NŨGZRȌTKGPEG tises et/ou contrôles complémentaires
et l’existence de références dans le monde de la copropriété. étaient effectués, il sera opportun de
HCKTGȌXQNWGTNG&6)RQWTSWŨKNRTGPPG

Faire de son DTG un en compte les nouvelles analyses et les répercute sur les
préconisations de travaux et leur hiérarchisation. Ce point
véritable outil de pilotage vous permettra de garantir la performance dans le temps
FGXQVTG&6)
2NWUSWŨWPG UKORNG QDNKICVKQP NG &KCIPQUVKE 6GEJPKSWG )NQDCN
est un véritable outil de pilotage pour hiérarchiser, prévoir et
QRVKOKUGTNGU VTCXCWZ ȃ TȌCNKUGT FCPU WPG EQRTQRTKȌVȌ En conclusion
Réalisé par un professionnel compétent, le Diagnostic Technique
/DZ6*1&1.1)+'  )NQDCN UGTC NŨQWVKN FG RKNQVCIG WPKSWG XQWU RGTOGVVCPV FŨQDVGPKT
En plus de ces critères généraux WPG XKUKQP ENCKTG GV EQORNȋVG UWT NGU VTCXCWZ ȃ TȌCNKUGT FCPU
Collecte des données
caractérisant le professionnel votre copropriété.
Audit sur site choisi, le diagnostic doit suivre
Toutes les préconisations, chiffrées et hiérarchisées, réunies
CPCN[UGU une méthodologie complète. Il
dans un document unique permettront de réaliser une program-
2TȌEQPKUCVKQPU  doit être composé d’un audit sur
mation pluriannuelle optimisée, incluant des synergies entre les
compte-rendu site et d’une analyse des exper-
FKHHȌTGPVU VTCXCWZ GV CFCRVȌG CWZ URȌEKƒEKVȌU FG NC EQRTQRTKȌVȌ

* ACCEO, bureau d’études et d’ingénierie en bâtiments. www.acceo.eu


42 25 millions de Propriétaires - Mars 2017


PETITES ANNONCES
/#01537'
 2CTVKEWNKGTXGPFCRRCTVGOGPVRKȋEGU DCNEQP RNCEGUFG $174$10.#0%;
 ȃNQWGTQWȃXGPFTGNQECNEQOOGTEKCNGVCRRCTVGOGPVȃ
ACHAT / VENTE IMMEUBLES DE RAPPORT RCTMKPIFCPUTȌUKFGPEGUȌEWTKUȌGCXGERKUEKPG2TQZKOKVȌEQOOGTEGUN[EȌG NŨȌVCIGEJCODTGUEGPVTGXKNNG6ȌNšššš
PROCHE BAIE DE SOMME, Bord de Mer. Ensemble immobilier de 20 logements JȖRKVCN6ȌNšššš %#4%#55100' Ť .QWG NQECN šOq  ECXG HGTOȌG šOq CXGE CRRGPVK 
NQWȌUȃNŨCPPȌG6TȋUDQPȌVCV2CUFGVTCXCWZȃRTȌXQKT4CRRQTV š#IGPEG &+,10 6#.#06 SWCTVKGT TȌUKFGPVKGN 6
FG   šOq GP VTȋU DQP ȌVCV CW (CEKNKVȌ UVCVKQPPGOGPV EQPXKGPV RQWT CVGNKGT CTVKUKPCN FȌRȖV FG UVQEM 6ȌN
UŨCDUVGPKT2TKZšššŻ6ȌNšššš 2èmeȌVCIGCXGECUEGPUGWTXWGFȌICIȌGRTQEJGEQOOGTEGUDWUȃšO šššš
41#00'
 'PUGODNGKOOQDKNKGTFCPUCPEKGPGPDQPȌVCVNQIGOGPVUVQWU CXGE CEEȋU FKTGEV EGPVTGXKNNG &+,10 GV ICTG 50%( 2TKZš ššŻ 6ȌN
NQWȌU$GCWXQNWOGRCUFGITQUVTCXCWZȃRTȌXQKT6GTTCKPšOq$QPTCRRQTV šššš AUTRES LOCATIONS
#IGPEGUŨCDUVGPKT2TKZšššŻȃUCKUKT6ȌNšššš 56 '6+'00'
  8'0& 6 RTQEJG EGPVTGXKNNG
%CTPQV  KOOGWDNG  TȌ Ǩ .17'4  CRRCTVGOGPVU CPEKGPU TȌPQXȌGU ƒP  ( šOq RTQZKOKVȌ
Ť8GPFKOOGWDNGȌVCIGUšOqCWUQNDQPȌVCVFGUVWFKQUOGWDNȌU EGOOGPVTȌPQXȌ%QRTQRTKȌVȌNQVUème étage ASC. Appartement traversant, VTCOYC[CWVQTQWVGU/10('44#0&EJCWHHCIGGCWEJCWFGEWKUKPGKPFKXK
6Ť&2'&ȃ' %1//'4%'FGšOqGP4F%J6QWUNQWȌU RCTVKG EQORTGPCPVǡEWKUKPGȌSWKRȌGITCPFUȌLQWTCXGECNEȖXGGVDCNEQPEJCODTGU FWGN)#<ECXGXQWVȌGHCKDNGUEJCTIGU&2'GPEQWTUšŻGVšŻ6ȌN
RTKXȌG ȃ GZRNQKVGT šOq GP 4F%J  ECXGU GV ITGPKGTU 2TKZš ššŻ 6ȌN GVFTGUUKPI5&$DWTGCW ECXGU ICTCIG
&2'ǡ' 2TKZšššŻ6ȌN šššš
šššš šššš Ť2#4+52CTVKEWNKGTNQWGCRRCTVGOGPVCPPȌGšOqǡUȌLQWTCXGEHG
2QWT +PXGUVKUUGWTU TGPVCDKNKVȌ š DGN KOOGWDNG UKVWȌ CP %GPVTGXKNNG FG  Ť 4'00'5 XGPFU CRRCTVGOGPV V[RG  šOq EWKUKPG ȌSWKRȌG UCNNG PȍVTG
šOq CWUWFǡEJCODTGUEWKUKPG5&$CXGE9%UCNNGFGFQWEJG9%
/106.7%10
 EQORQUȌFGNQIGOGPVUOGWDNȌUGVGPVKȋTGOGPVȌSWKRȌU FGDCKPGSWKRȌGICTCIGGPUQWUUQNTȌPQXCVKQPȌPGTIȌVKSWGGPEQWTU2TKZš ECXG#WèmeGVFGTPKGTȌVCIG+NQVVTȋURTKXȌECNOG0KXGCWRQTVGFŨ#WVGWKN

UWTHCEGVQVCNFGNŨKOOGWDNGGPXKTQPšOq %GUCRRCTVGOGPVUFGUVCPFKPI ššŻ6ȌNšššš 4#4'ǡ.Q[GTššŻOQKUEJCTIGUEQORTKUGU6ȌNšššš


QPVȌVȌTȌCNKUȌUGPFGV[RGUVWFKQ((GV(CXGEEWKUKPGUȌSWKRȌGU 2174+08'56+55'74MOFG2#4+5
 #ȌTQFTQOGRTKXȌUWTšJC*CP .+/1)'5
  .17' ( $KU FCPU TȌUKFGPEG UVCPFKPI SWCTVKGT ECNOG RTQEJG
GVOQDKNKGTFGSWCNKVȌ2CTMKPIRTKXȌIQWFTQPPȌRQWTRNCEGU
šOqVQWU ICTUšOq%NWD*QWUGšOq.Q[GTšŻCP2TKZFGXGPVGšššŻ FGUWPKXGTUKVȌUITCPFGGPVTȌGCXGEXKUKQRJQPGITCPFURNCECTFUEWKUKPGPGWXG
EGUNQIGOGPVUUQPVNQWȌU#WEWPUVTCXCWZȃRTȌXQKTšБ2TKZFGXGPVGšššŻ 6ȌNšššš COȌPCIȌG
RNCSWGKPFWEVKQPTȌHTKIȌTCVGWTRNWUKGWTUTCPIGOGPVUJCWVUGVDCU 
6ȌNšššš $CKGXKVTȌGUWTVQWVGNCNQPIWGWTFGNŨCRRCTVGOGPV2KȋEGRTKPEKRCNGFKXKUȌGP
%#8#.#+4'5/'4
 6DGNNGXWGOGTšOqCXGEVGTTCUUGFGšOq
/106.7%10+FȌCNKPXGUVKUUGWTUDGNKOOGWDNGEGPVTGXKNNGCRRCTVGOGPVU RTQEJGEGPVTGGVRNCIGUGZRQUKVKQP'UVITCPFUȌLQWTCXGEEWKUKPGQWXGTVGȌSWK RCTVKGUOQFWNCDNGU5CNNGFGDCKPUDCKIPQKTGDTCPEJGOGPVNCXGNKPIG9%
OGWDNȌUGVGPVKȋTGOGPVȌSWKRȌU NQECNEQOOGTEKCN%GUNQIGOGPVUQPVȌVȌ RȌGEJCTIGUOGPUWGNNGUšŻ
ICTFKGPGURCEGUXGTVU 6CZG(QPEKȋTGšŻ UȌRCTȌU)TCPFGVGTTCUUG2CTMKPIRTKXCVKH.QECNȃXȌNQ%QPUQOOCVKQPȌPGT
TȌCNKUȌUGPFGV[RGUVWFKQ((CXGEEWKUKPGUȌSWKRȌGUGVOQDKNKGTFG &2'ǡ'èmeȌVCIG2TKZšššŻ6ȌNšššš IȌVKSWG ENCUUȌ ' )'5 ENCUUȌ $ .Q[GT šŻOQKU EJCTIGU EQORTKUGU 6ȌN
SWCNKVȌ6QWUEGUNQIGOGPVUUQPVNQWȌU#WEWPUVTCXCWZȃRTȌXQKTšБ6TȋUDQPPG šššš
TGPVCDKNKVȌ2TKZFGXGPVGšššŻ6ȌNšššš 8'0&ȃ%#4%#55100'<QPG%QOOGTEKCNG$ȅVKOGPVšOqCXGEšOq
DWTGCWZUWTVGTTCKPššOq2TKZššššŻšOKPWVGUQTVKGCWVQTQWVG6ȌN
8GPF 5#+06)#7&'05
*CWVG)CTQPPG  kǡ %'064'ǡ z &)' ' +OOGWDNG šššššššš
LOCATIONS SAISONNIÈRES
UȌEWTKVȌQHHTCPVNQIGOGPVU NQECWZ2TQHGUUKQPPGNU'PUGODNGNQWȌTȌPQ Ť5#+06'/#:+/'.'5+55#/$4'5NQWGXKNNCRGTUQPPGUEWKUKPGUȌ
XȌRCUFGVTCXCWZ0QTOG*CPFKECRš4GXGPW#PPWGN$TWVššŻ
š ST ETIENNE vend maison bourgeoise sur 2 niveaux possibilité de faire 2 loge
LQWTEJCODTGU9%5&$8ȌTCPFCENKOCVKUCVKQP9+(+VGTTCUUGŤ,CTFKP
TGXGPWPGVš%JCTIGUNQECVKXGUCPPWGNNGUššŻ8GPVGGPDNQE2TKZš OGPVUGPVTȌGUKPFȌRGPFCPVGU4&%šOqEJCODTGU
ȃšOq UȌLQWT
ENQU  2KUEKPG QODTCIȌG DCTDGEWG RCTMKPI RTKXȌ RNCIG šO EQOOGTEGU
ššŻ6ȌNšššš2JQVQUUWTFGOCPFG šOqEWKUKPGCXGEEQKPTGRCU
šOq erȌVCIGšOq VGTTCUUGšOq5QWU
šO 2QTV 2NCKUCPEG CEVKXKVȌU OQPVCIPGU šO 6JCNCUUQ šO 6ȌN
UQNGVITGPKGT2TKZšššŻ6ȌNšššš&2'&
5#7.+'7%GPVTG
 2CTEFW/QTXCP+//'7$.'FGNQIGOGPVUNQWȌUȃ šššš'OCKNǡwww.locissambresorange.fr
NŨCPPȌG4CRRQTVš2TKZGUVKOȌšššŻ6ȌNšššš .#41%*'..'Ť.GU/KPKOGUHCEGN[EȌGJȖVGNKGT6&WRNGZème étage dans
KOOGWDNGFGDGNNGRTGUVCVKQP5WRGTƒEKGJCDKVCDNGšOq6GTTCUUGȌVCIG DIVERS
/#45'+..'%#56'..#0'eXGPFWPKOOGWDNGGPVKGTš6š6NQECN$W šOqEWKUKPGGPVTȌGUWTRKȋEGUȌLQWTEJCODTGUCNNGFŨGCW9%UȌRCTȌRNC
TGCWZšOqGPXKTQPVTȋUDQPȌVCV4CRRQTVššŻCP2TKZššššŻ ECTF#PPȌG6ȌNšššš )/#6%1746#)'ITQWRGOGPVFŨCTVKUCPUFGRWKUXQWURGTOGVFGTȌC
#IGPEGUŨCDUVGPKT6ȌNšššš NKUGTVQWUXQUVTCXCWZFGTȌPQXCVKQPQWEQPUVTWEVKQPUCPUUVTGUUGVFȌRGPUGU
/#0&'.+'7Ť%#00'58'0&5#22#46'/'06GPTG\FGLCTFKPFGOq
8#.'0%' Ť +OOGWDNG  CRRCTVGOGPVU
 RKȋEGU   LCTFKPU VTȋU DQP ȌVCV KPWVKNGU
CUUWTCPEGUFȌEGPPCNGGVEKXKNGTȌHȌTGPEGUCFJȌUKQPȃWPGEJCTVGSWC
FCPUTȌUKFGPEGCXGEICTFKGPUGVRKUEKPGU'PVKȋTGOGPVȌSWKRȌOQDKNKGTPGWH
FQWDNG XKVTCIG  RCTMKPI   ICTCIGU UWT VGTTCKP GPXKTQP šOq J[RGT NKVȌTGURGEVFGUFȌNCKU 0QWUKPVGTXGPQPUUWT2CTKUGVTȌIKQPRCTKUKGPPGRQWT
EQORQUȌFGUȌLQWTEWKUKPGEJCODTGUȌRCTȌGUCNNGFGDCKPU9%6GTTCUUG
EGPVTG
RTȌHGEVWTGRTQZKOKVȌTWGURKȌVQPPGU $KGPNQWȌ4GPFGOGPVšCOȌ NGU RCTVKEWNKGTU QW GPVTGRTKUGU 6ȌN šššš  šššš 'OCKNǡ 
LCTFKP ECXG RCTMKPIUQWUUQN2TKZšššŻ6ȌNšššš
NKQTCDNG2TKZšššŻ6DZ.šššš contact@gmat-courtage.frŤUKVGKPVGTPGVǡhttp//www.gmat-courtage.fr
2+#Ť8'0&/#+510&'8+..#)'TG\FGEJCWUUȌGEWKUKPGUCNNGȃOCPIGT #)'0624+8DZ&'4'%*'4%*'#)4''2.75&'#05FŨGZRȌTKGPEGCFJȌTGPV
5#+06&+'FGU815)'5XGPFKOOGWDNGFGCRRCTVGOGPVU
(GVš( PQP FQPPCPVUWTEQWTKPVȌTKGWTGerȌVCIGEJCODTGUUCNNGFGDCKPUème étage
NQWȌU6TCXCWZȃRTȌXQKTFCPUš(&2''ȃ(6ȌNšššš 702+DZXKVG\NGUKORC[ȌUGVOCKVTKUG\XQUTKUSWGU#$/+RTQRQUGVQWUV[RGU
EJCODTGCOȌPCIȌGEQODNGU(GPȍVTGU28%EJCWHHCIGȌNGEVTKSWG
ȌPGTIKG&  FŨKPXGUVKICVKQPU EQPEGTPCPV RGTUQPPG RJ[UKSWG QW OQTCNG SWG EG UQKV FG
8'0&+OOGWDNGFGTCRRQTVUKVWȌȃ.10)7;10
 EQORQUȌFGš(GVš( UKVWȌšMOCȌTQRQTVšMOFGNCOGTšMOFG2GTRKIPCP
RCUFGVTCXCWZ 2TKZš OCPFGRTȌNQECVKXGKORC[ȌQWCWVTGEQPVGZVGǡTGEJGTEJGCFTGUUGFWNQECVCKTG
FQPVWPȌSWKRȌFGEWKUKPGKPVȌITȌGVTȋUDQPȌVCV4CRRQTVCPPWGNššŻ ššŻ6ȌNšššššššššššš HWVWTQWRCTVKNCUQWTEGFGTGXGPWNCDCPSWGQWNGRCVTKOQKPG+PVGTXGPVKQPPC
2TKZšššŻ6ȌNšššš
VKQPCNGKPENWCPVNGU&1/61/5QWVKGPKPFKURGPUCDNGRQWTRQWTUWKVGUCOKCDNGU
LOCAUX COMMERCIAUX OU INDUSTRIELS QWLWFKEKCKTGU6TȋUKORQTVCPVǡHCEVWTCVKQPWPKSWGOGPVUKNGTȌUWNVCVGUVRQUKVKH
VENTES OFFRES 417'0
 TGPFGOGPVDTWV'PUGODNGFGNQECWZKPFWUVTKGNUNQWȌU2TKZ %106#%65#4.#$/+OCKNǡb.huet@outlook.fr.
Ż6ȌNšššš/CKNšparc.activites.grammont@gmail.com. SOLUCOP, le 22ème UCNQP RQWT NGU EQRTQRTKȌVCKTGU GV NGU U[PFKEU FG NC %ȖVG
.# %+16#6
  8'0& OCKUQP HCOKNKCNG CPPȌG  ȃ TCHTCȑEJKT 
 $'#70'
 2.#%'%'064'2TQEJGJQURKEGUGORNPo$CKNPGWHKO FŨ#\WTCWTCNKGWCW2CNCKU0KMCKCFG0+%'NGUGVPQXGODTG
4'+/5 *[RGT EGPVTG TWG 6JKGTU FCPU KOOGWDNG 2KGTTG FG 6CKNNG V[RG OGWDNGEQORNGVEQOOGTEGšOqVTȋUDQPȌVCVECXGCWDWTGCWNQIGOGPVer UVCPFUGURCEGUEQPUGKNUŤEQPHȌTGPEGU'PVTGVKGPTȌPQXCVKQPȌXQNWVKQP
JCWUUOCPPKGPWPCRRCTVGOGPV(ǡšOqWPKSWGCWUGEQPFȌVCIGFKUVTKDW ȌVCIG  Oq &ȌRGPFCPEGU  Oq 2GTH ȌPGTIȌVKSWG  (  6ȌN š    FG NC NȌIKUNCVKQP 4GPUGKIPGOGPVU  www.solucop.com
VKQPGPȌVQKNG(GPȍVTGUFQWDNGXKVTCIG6ȌNšššš
$#)0+'4'5&'.7%*10
 8GPF6+OOGWDNGCXGECUEGPUGWTEGPVTG
XKNNG
6JGTOGUGV5MK *CNNFŨGPVTȌGUCNQPEWKUKPGEJCODTGCXGEUCNNGFŨGCWGV Comment passer Votre annonce de 5 lignes pour 25 € TTC
9%CVVGPCPVU2TKZšššŻ&2'ǡ)'6ȌNšššš
.#$4137'4'
  Ť 8GPF OCKUQP šOq 5*# šOq5*1  EJCODTGU votre annonce ? 2 passages pour 40 € TTC
 UCNNGU FG DCKP  9% XCUVG EWKUKPG GV CTTKȋTG EWKUKPG XȌTCPFC FG šOq
UȌLQWTGVUCNQPšOqEJGOKPȌGOG\\CPKPGVGTTCUUGUICTCIG8EGNNKGTCVG Merci de nous faire parvenir votre annonce au plus tard le 10 de chaque mois pour une parution dans le numéro du mois suivant
NKGTDWCPFGTKGEJCWHHGTKG
EJCWHOC\QWVGVUQNCKTG DWTGCW6GTTCKPššOq 2QWTVQWVGCPPQPEGUWRȌTKGWTGȃNKIPGUOGTEKFGPQWUEQPUWNVGTCW/GTEKFŨCFTGUUGTEGVGZVGȃ
RKUEKPG EQWXGTVG RQQN JQWUG šOq
EWKUKPG 9%  $KGP FGUUGTXK 8WGU
6(ššŻ6*šŻ2JQVQUUWTFGOCPFG&2'ǡ&Ť2TKZšššŻ6ȌN 25 millions de Propriétaires - 11, quai Anatole-France - 75007 Paris
šššš /GTEK FG EQEJGT NC TWDTKSWG FCPU NCSWGNNG XQWU UQWJCKVG\ HCKTG RCTCȑVTG XQVTG CPPQPEG 
Ť'PVTG/14<+0'
šMO GV6*1010.#%.'/#0
šMO 6GPXKTQPšOq 8GPVGU QHHTGU #EJCVU XGPVGU KOOGWDNGU FG TCRRQTV .QECWZ EQOOGTEKCWZ QW KPFWUVTKGNU
DCNEQPUGPXšOq
GUVUWFQWGUV CITȌCDNGU8WGOQPVCIPG5VCVKQPUMK.C
)TCPFG6GTEJG#NKOGPVCVKQPTGUVCWTCPVUDCTUȃRTQZKOKVȌ$QKUGTKGU
EJCODTG .QECVKQPU UCKUQPPKȋTGU #WVTGU NQECVKQPU 6GTTCKPU 8KCIGTU ššDivers
MKVEJGPGVVG XQNGVU HCȊCFG  +OOGWDNG  NQIGOGPVU DKGP GPVTGVGPW 2TKZš
ššŻ6ȌNšššššššš
OGUUCIGTKG 
Ť/#45'+..'E‘WTFGUEKPSCXGPWGU6FGšOqRCTHCKVȌVCVŤ2TKZš
ššŻ6ȌNšššš
417'0567&+1šOqFCPUTȌUKFGPEGFGDQPUVCPFKPIème étage, as
EGPUGWT Ǩ  OKPWVGU ȃ RKGF  OȌVTQ DWU EGPVTG EQOOGTEKCN HWVWTG ICTG
50%(2TQEJGPQODTGWUGUȌEQNGU&2'%$QPȌVCV2TKZšššŻ6ȌN
šššš
 Ť .#10  8'0& 6 TȌUKFGPEG ème ȌVCIG JCNN FŨGPVTȌG  EJCODTGU
EQWNQKTUCNNGFŨGCWUCNQPEWKUKPG9%%CRJCTPCȜOECXGCWUQWUUQN5*
šOq&2')(%JCWHHCIGRCTNGUQN2TKZšššŻ6ȌNšššš À remplir obligatoirement
8'0&5617.175'%QVG2CXȌGOCKUQPRKGEGUšOqTȌPQXȌG5&$9% ,GUQWUUKIPȌ
DWCPFGTKGECXGUWTVTQKUGVCIGUVGTTCUUGRKUEKPGEJCWHHȌG2TKZšššŻ 5KIPCVWTG
6ȌNšššš 01/ __________________________________________________ 2TȌPQO ___________________________________________
ŰFȌENCTGUWTNŨJQPPGWTSWGNGUTGPUGKIPGOGPVURQTVȌUUWTEGDWNNGVKPUQPVGZCEVUGVPGUQPV
GPVCEJȌUFŨCWEWPGGTTGWTQWQOKUUKQPFGECTCEVȋTGVTQORGWT
ŰRTGPFUPQVGSWGNGUCPPQPEGUTGNCVKXGUȃNCOKUGGPXGPVGQWȃNCNQECVKQPFŨWPDKGPKOOQDKNKGT
FQKXGPVQDNKICVQKTGOGPVEQORQTVGTNCNGVVTGEQTTGURQPFCPVCWENCUUGOGPVȌPGTIȌVKSWGFWDKGP
INDICES Le tableau de bord du propriétaire

Indice du coût de la construction (ICC) Indice des loyers commerciaux (ILC)


INSEE LES VARIATIONS (en %) Champ d’application : toutes les activités commerciales, y compris celles
ICC 3ème T 2016 exercées par les artisans, peuvent bénéficier de l’ILC. Sont en revanche
= 1 643 100 au
Annuelles
Trien-
Sur 9 ans exclues du champ d’application les activités commerciales exercées
4e T 1953 nales dans des locaux à usage exclusif de bureaux, y compris les plates-formes
2007 4e trimestre   4,84 16,15 37,24 logistiques, ainsi que les activités industrielles.
er
1 trimestre   8,09 17,87 39,78 ILC 3ème T 2016 ILC BASE 100 au 1er trimestre 2008
2e trimestre   8,85 22,41 45,44 = 108,56
2008 ILC Variation annuelle

2CTWVKQP+PUGG
3e trimestre   10,46 24,73 47,59
2e trimestre    
4e trimestre   3,32 14,34 43,00
2015 3e trimestre    
1er trimestre   0,40 10,35 38,78 4e trimestre    
2e trimestre   – 4,10 9,66 37,56 1er trimestre   
2009 2016
3e trimestre   – 5,77 8,76 37,42 2e trimestre   
4e trimestre   – 1,05 7,18 33,72 3e trimestre   
1er trimestre   0,33 8,88 34,04
2e trimestre   1,27 5,71 33,19 Indice des loyers des activités tertiaires (ILAT)
2010 Champ d’application : activités commerciales exercées dans des locaux
3e trimestre   1,20 5,34 32,75 à usage exclusif de bureaux, activités effectuées dans les plates-formes
4e trimestre   1,73 4,00 34,47 logistiques (y compris les entrepôts), activités industrielles, activités des
professions libérales.
1er trimestre   3,05 3,81 34,08
2e trimestre   5,01 1,98 36,97 ILAT 3ème T 2016 ILAT BASE 100 au 1er trimestre2010
2011 = 108,49
3e trimestre   6,84 1,88 38,80 ILAT Variation annuelle
4e trimestre   6,85 7,55 39,76
er
1 trimestre   
1er trimestre   4,05 7,58 36,69 2e trimestre   
2009    
3e trimestre
2e trimestre   4,58 11,21 38,60
2012 4e trimestre    
3e trimestre   1,48 9,72 36,99 1er trimestre    
4e trimestre   0,06 8,76 35,01 2e trimestre    
  1,79 9,15 34,37
2010
1er trimestre 3e trimestre   
2e trimestre   - 1,74 7,91 29,20 4e trimestre   
2013 1er trimestre   
3e trimestre   - 2,18 6,05 26,73
2e trimestre   
4e trimestre   - 1,46 5,35 27,27 2011   
3e trimestre
1er trimestre   0,12 6,05 29,76 4e trimestre   
2e trimestre   - 0,98 1,76 27,04 1er trimestre   
2014
3e trimestre   0,93 0,18 27,31 2e trimestre   
2012   
4e trimestre   0,62 - 0,79 22,00 3e trimestre
1er trimestre     0,93 19,82 4e trimestre   
1er trimestre   
2CTWVKQP+PUGG

2e trimestre   - 0,43   18,16


2015 2e trimestre   
3e trimestre       16,44 2013   
3e trimestre
4e trimestre   0,25 - 0,61 15,86 4e trimestre   
1er trimestre     - 1,88 16,61 1er trimestre   
2016 2e trimestre   0,50   13,03 2e trimestre   
2014   
3e trimestre   2,18 1,92 13,86 3e trimestre
4e trimestre   
2CTWVKQP+PUGG

1er trimestre   


IMPORTANT : la loi Pinel n° 2014-626 du 18 juin 2014 (voir le numé- 2e trimestre   
ro de juillet/août 2014, p.10) supprime la référence à l’ICC pour déterminer 2015   
3e trimestre
le loyer plafond au moment du renouvellement du bail ou de la révision 4e trimestre   
triennale. Cette mesure concerne tous les baux commerciaux conclus ou 1er trimestre   
renouvelés depuis le 1er septembre 2014. Pour ces baux, seul l’ILC ou l’ILAT 2016 2e trimestre   
(suivant l’activité exercée) peut être utilisé comme indice de référence. 3e trimestre   

44 25 millions de Propriétaires - Mars 2017


Le tableau de bord du propriétaire INDICES

Indice de référence des loyers - IRL «nouvelle version»


POUR L’INDEXATION DES LOYERS D’HABITATION À COMPTER DU 10 FÉVRIER 2008
Cet indice concerne les locations soumises à la loi du 6 juillet 1989 (c’est-à-dire essentiellement les locations à usage d’habitation principale
ou à usage mixte professionnel et d’habitation principale), les locations meublées, les bâtiments d’habitation loués dans le cadre de baux
ruraux (article L. 411-11 du Code rural) et les loyers relevant de la location-accession à la propriété (article 7 de la loi n° 84-595 du 12 juillet
1984). Cet indice est publié chaque trimestre par l’Insee.

IRL 3ème T 2016 1er TRIMESTRE 2e TRIMESTRE 3e TRIMESTRE 4e TRIMESTRE


= 125,50 Variation Variation Variation Variation
En niveau En niveau En niveau En niveau
annuelle annuelle annuelle annuelle
2012  š  š  š  š
2013  šš  šš  šš  šš
2014  š  š  š  š
2015  š  š  š  ššš
2016  š  š  š  
2CTWVKQP +PUGG 

Indice mensuel des prix à la consommation* Indice mensuel


= 100,61
(HORS TABAC, DES MÉNAGES URBAINS DONT LE CHEF EST OUVRIER, BASE 100 EN 2015) des prix 12/2016
JANV. FÉV. MARS AVRIL MAI JUIN JUIL. AOÛT SEPT. OCT. NOV. DÉC.
2013            
2014            
2015            
2016            
* En janvier 2016, l’indice des prix à la consommation a changé d’année de référence (base 100 en 2015).

Indice bâtiment national BT 01* BT01 11/2016 = 104,9


JANV. FÉV. MARS AVRIL MAI JUIN JUIL. AOÛT SEPT. OCT. NOV. DÉC.
2013            
2014            
2015            
2016           
0QWXGNNG XCNGWT DCUG  GP 
,1 FW 

Indice Taux de l’intérêt légal


Un arrêté du 29 décembre 2016 (J.O. du 30 décembre) fixe les taux de l’intérêt
FÉDÉRATION FRANÇAISE 2014 e T  légal pour le 1er semestre 2017, l’un pour les personnes physiques n’agissant
DU BÂTIMENT pas pour des besoins professionnels, l’autre pour tous les autres cas.
1er T 
BASE 1 EN 1941 Ces taux sont désormais actualisés une fois par semestre (sachant que les
Depuis le 1 er jui l let 1983, le  T
e
 taux indiqués dans le tableau sont des taux annuels).
versement destiné aux transports 2015 Pour calculer l’intérêt dû sur le semestre, il faut appliquer la formule :
en commun a été étendu à toute
 T
e
 montant dû X taux annuel valable pour le semestre X jours de retard dans
l’Île-de-France. En conséquence, e T  ce semestre / 365 jours.
la FFB ne publie plus qu’une
seule valeur, prenant en compte 1er T  Débiteur Créancier Type de taux 2CTVKEWNKGT 
l’incidence de ce versement. Le 2CTVKEWNKGT 2CTVKEWNKGT   RGTUQPPG RJ[UKSWG
cœfficient de raccordement avec e T  PŨCIKUUCPV RCU
valeur applicable aux départements 2016 2TQHGUUKQPPGN 2CTVKEWNKGT   RQWT FGU DGUQKPU
dans lesquels le versement destiné  T
e
 2TQHGUUKQPPGN 2TQHGUUKQPPGN   RTQHGUUKQPPGNU
aux transports en commun n’était 2TQHGUUKQPPGN 
pas pris en compte est de 0,995.  T
e
 2CTVKEWNKGT 2TQHGUUKQPPGN   VQWU NGU CWVTGU ECU

25 millions de Propriétaires - Mars 2017 45


INDICES Le tableau de bord du propriétaire

Salaires et divers šš)TKNNGEQPEGTPCPVNGUUCNCTKȌUFGNCECVȌIQTKG$RQWTWPUGTXKEG


• 5OKE JQTCKTG DTWV
ȃ EQORVGT FW er LCPXKGT    Ż EQORNGV DCUG   78
FGRWKU NG er CXTKN  
• )CTFKGPU EQPEKGTIGU GV GORNQ[ȌU FŨKOOGWDNGU
Cœfficient Salaire minimum brut mensuel
Ǩ PQVGT  NG 5OKE GUV RNWU ȌNGXȌ SWG NG OKPKOWO EQPXGPVKQPPGN  Niveau (pour mémoire) conventionnel (151,67 heures)
&GWZ ITKNNGU FG UCNCKTGU UQPV CRRNKECDNGU 
1 %GPKXGCWPGUŨCRRNKSWGRCU
 )TKNNG EQPEGTPCPV NGU UCNCTKȌU FG NC ECVȌIQTKG # Employé d’immeuble CWZUCNCTKȌUFGEGVVGECVȌIQTKG
UWT NC DCUG NȌICNG FG  JGWTGU
FGRWKU NG er CXTKN   2  ššŻ
.GU JGWTGU UWRRNȌOGPVCKTGU UQPV OCLQTȌGU FG  
CTV .  Gardien concierge
FW %QFG FW VTCXCKN GV NGU JGWTGU EQORNȌOGPVCKTGU FG   FGRWKU 3 Employé
d’immeuble qualifié
 ššŻ
NG 
CXGPCPV Po   CTTȍVȌ FŨGZVGPUKQP FW   ,1 FW
 4
Gardien principal
 ššŻ
Cœfficient Salaire minimum brut mensuel
Niveau (pour mémoire) conventionnel (151,67 heures) 5  ššŻ
Gardien chef (AM)
1    Ż
Employé d’immeuble 6 Agent  ššŻ
2    Ż
principal de gérance
Gardien concierge
3 Employé •šš5CNCKTGGPPCVWTGNQIGOGPV
CWO2)
d’immeuble qualifié    Ż
%CVȌIQTKGššŻšECVȌIQTKGššŻšECVȌIQTKGššŻ
4    Ż %GVVGȌXCNWCVKQPPGRGWVVQWVGHQKUȍVTGKPHȌTKGWTGȃšŻ
Gardien principal
•šš5CNCKTGGPPCVWTGȌNGEVTKEKVȌIC\EJCWHHCIGGCWEJCWFGšŻ
5    Ż
Gardien chef (AM) NGM9JVCTKH'&(FȌTȌIWNȌ
QHHTGFWOCTEJȌ ȃEQORVGTFW
6 Agent • #UVTGKPVG FG PWKV   Ż
principal de gérance    Ż
• 2NCHQPF FG 5ȌEWTKVȌ UQEKCNG CPPȌG     Ż
.G5OKEȌVCPVUWRȌTKGWTKN[CNKGWFŨCLWUVGTEGOKPKOWOȃšŻ
XCNGWTFW5OKE

Plus-values immobilières
TAUX D’ABATTEMENT ANNUEL EN VIGUEUR DEPUIS LE 1er SEPTEMBRE 2013*
Moins Entre Entre Entre Entre Entre Entre Entre Entre Entre Entre Entre Entre
Durée de détention du bien de 6 et  GV 8 et 9 et 10 et 11 et 12 et 13 et 14 et 15 et 16 et  GV
6 ans  CPU 8 ans 9 ans 10 ans 11 ans 12 ans 13 ans 14 ans 15 ans 16 ans  CPU 18 ans
Impôt sur le revenu (19%)*                        
Prélèvements sociaux (15,5 %)                         
Entre Entre Entre Entre Entre Entre Entre Entre Entre Entre Entre Entre Plus
Durée de détention du bien 18 et 19 et 20 et 21 et 22 et 23 et 24 et 25 et 26 et  GV 28 et 29 et de
19 ans 20 ans 21 ans 22 ans 23 ans 24 ans 25 ans 26 ans  CPU 28 ans 29 ans 30 ans 30 ans
Impôt sur le revenu (19%)*         'ZQPȌTCVKQP
Prélèvements sociaux (15,5 %)                         'ZQPȌTCVKQP
&G RNWU WP CDCVVGOGPV GZEGRVKQPPGN FG   GUV CRRNKECDNG FCPU EGTVCKPGU EQPFKVKQPU RQWT NGU RNWUXCNWGU TȌCNKUȌGU CW VKVTG FG NC EGUUKQP FG VGTTCKPU ȃ DȅVKT
XQKT R  
 OKNNKQPU FG 2TQRTKȌVCKTGU  0QXGODTG 

Taux de l’usure Taux effectifs pratiqués au 4ème T 2016 Seuil de l’usure applicable à
par les établissements de crédit compter du 1er janvier 2017
LES TAUX DE L’USURE PRÊTS IMMOBILIERS AUX PARTICULIERS
APPLICABLES À COMPTER
•ššPrêts à taux variable š š
DU 1er JANVIER 2017
ONT ÉTÉ PUBLIÉS AU JO •ššPrêts relais š š
DU 27 DÉCEMBRE 2016 PRÊTS À LA CONSOMMATION
2QWT CRRTȌEKGT NG ECTCEVȋTG WUWTCKTG •šš2TȍVUFŨWPOQPVCPVƎȃššŻ š š
FW VCWZ GHHGEVKH INQDCN FŨWP FȌEQWXGTV
GP EQORVG QW FŨWP RTȍV RGTOCPGPV NG •ššPrêts d’un montant ȃŻGVƎȃššŻ š š
OQPVCPV ȃ RTGPFTG GP EQPUKFȌTCVKQP GUV
•šš2TȍVUFŨWPOQPVCPV ȃŻ  šššš ššš
EGNWK FW ETȌFKV GHHGEVKXGOGPV WVKNKUȌ

46 25 millions de Propriétaires - Mars 2017


Le tableau de bord du propriétaire INDICES

Loi de 1948 : les loyers RENTES VIAGÈRES


er
AU 1 JUILLET 2016 Les taux de majoration pour 2017
Le décret n° 2016-1448 du 26 octobre 2016 paru au Journal officiel du Un arrêté du 28 décembre 2016, publié au JORF du 30 décembre 2016
28 octobre 2016 a fixé les hausses des loyers relevant de la loi du 1er septembre (texte n° 58), a fixé à 0,1 % la revalorisation des taux de majoration pour
1948 applicables à compter du 1er juillet 2016 (effet rétroactif). Ces loyers peuvent les rentes servies en 2017. Ainsi les taux de majoration applicables en 2017
être augmentés dans les conditions suivantes : sont les suivants :
- taux de majoration de 0,06 % pour les catégories III A, III B, II A, II B et II C
pour l’ensemble des communes, y compris celles situées dans le périmètre de Période au cours de laquelle Taux de majoration
l’agglomération parisienne ; est née la rente originaire applicable
- taux de majoration de 0,06 % pour les loyers au forfait (article 34 de la loi du #XCPVNG 
1er septembre 1948); &WCW 
- les logements de la catégorie IV ne subissent aucune augmentation.
&WCW 
Les communes concernées par ce décret sont les mêmes que celles visées par
l’ancien décret (n° 2015-1149 du 15 septembre 2015). &WCW 
La liste des communes situées dans le périmètre de l’agglomération parisienne &WCW 
figure à l’annexe du décret. &WCW 
&WCW 
AGGLOMÉRATION PARISIENNE #PPȌGU 
Prix de base de chacun #PPȌGU 
Prix de base
des 10 premiers m2 #PPȌGUȃKPENWUG 
des m2 suivants
de surface corrigée #PPȌGUȃKPENWUG 
#PPȌGUGV 
II A Ż Ż
#PPȌGU 
II B Ż Ż #PPȌGUGV 
II C Ż Ż #PPȌGUGV 
#PPȌG 
III A Ż Ż #PPȌG 
III B Ż Ż #PPȌGUGV 
#PPȌG 
IV  Ż  Ż #PPȌG 
#PPȌG 
HORS AGGLOMÉRATION PARISIENNE
#PPȌG 
Prix de base de chacun #PPȌG 
Prix de base des m2
des 10 premiers m2 de #PPȌG 
suivants
surface corrigée #PPȌG 
II A Ż Ż #PPȌG 
#PPȌG 
II B Ż Ż #PPȌG 
II C Ż Ż #PPȌG 
#PPȌG 
III A Ż Ż
#PPȌG 
III B Ż Ż #PPȌG 
#PPȌG 
IV Ż Ż
#PPȌG 
#PPȌG 
Loi de 1948 : la sortie #PPȌG 
Le bailleur ne peut pas proposer un bail de huit ans pour sortir de la loi de 1948 #PPȌG 
à son locataire ou occupant dont les ressources, cumulées avec celles des autres #PPȌG 
occupants du logement, sont inférieures aux seuils fixés par décret (art. 29 de la #PPȌG 
loi du 23/12/1986). Conséquence: pour toute proposition de sortie de la loi de 1948 #PPȌG 
faite à compter du 1er janvier 2017, les revenus nets imposables de l’année 2015 #PPȌG 
doivent être supérieurs aux seuils de ressources indiqués dans le tableau ci-dessous. #PPȌG 
#PPȌG 
Nombre
Revenus nets Revenus nets #PPȌG 
de personnes
Île-de-France province #PPȌG 
par foyer #PPȌG 
#PPȌG 
RGTUQPPG Ż šŻ #PPȌG 
#PPȌG 
RGTUQPPGU Ż Ż #PPȌG 
#PPȌG š
RGTUQPPGU Ż Ż #PPȌG š
#PPȌG š
RGTUQPPGU Ż šŻ #PPȌG š
#PPȌG š
2GTUQPPGGP Ż Ż #PPȌG š

25 millions de Propriétaires - Mars 2017 47