Vous êtes sur la page 1sur 156

Maîtriser Office 2010

Corrigé
Cours d'autoformation
Pages
Office Word 2010 ............................... 1-46
Office Excel 2010 ............................. 47-80
Office Access 2010........................ 81-117
Office PowerPoint 2010............... 118-154
Windows ± Entraînement 1 ± Dossier 1
Débuter et paramétrer Windows
x 3DUDPpWUHUO¶DIILFKDJHpFUDQ
Objectifs
x Paramétrer les gadgets
Durée ¶
Support Aucun

1. Charger Windows

2. 0RGLILHUODFRXOHXUHWO¶DIILFKDJHGHV
fenêtres

- Cliquer-GURLWOHIRQGG¶pFUDQGH9LVWD
- Cliquer : Personnaliser

- &OLTXHUO¶RSWLRQCouleur et apparence des


fenêtres
- &OLTXHUO¶DSSDUHQFHGpVLUpH
- $MXVWHUO¶LQWHQVLWpGHVFRXOHXUV
- Cliquer : OK

3. 0RGLILHUO¶LPDJHG¶DUULqUH-plan

- &OLTXHUO¶RSWLRQArrière-plan du bureau
- Cliquer O¶LPDJHVRXKDLWpH
- Paramétrer la présentation désirée
- Cliquer : OK

4. Réinitialiser les paramètres initiaux

- 5pSpWHUOHVRSpUDWLRQVSUpFpGHQWHVHQUHSUHQDQWOHVRSWLRQVG¶RULJLQH

5. Paramétrer une trainée pour le pointeur

- Démarrer - Panneau de configuration


- Double-cliquer l'icône : Souris

- Cliquer l'onglet : Options du pointeur


- Cliquer la case : Afficher les traces de la souris

1
6. Réinitialiser les paramètres initiaux

- 5pSpWHUOHVRSpUDWLRQVSUpFpGHQWHVHQUHSUHQDQWOHVRSWLRQVG¶RULJLQH

7. 0RGLILHUO¶KRUORJH

- Cliquer-droit le gadget - Options

8. Ajouter la météo et paramétrer la ville pour laquelle afficher la météo

- Cliquer-droit le volet des gadgets ± $MRXWHUGHVJDGJHWV«


- Double-clic sur le gadget à placer

9. $MRXWHUOHIOX[ 566 )OX[G¶LQIRUPDWLRQHQFRQWLQXHO¶RUGLQDWHXUGRLWrWUH FRQQHFWpj/¶LQWHUQHW 


Le flux installé est le flux par défaut de MSN

- Cliquer-droit le volet des gadgets ± $MRXWHUGHVJDGJHWV«


- Double-clic sur le gadget : Titres des Flux

2
Windows ± Entraînement 2 - Dossier 1
Raccourci et contrôle
x Créer des raccourcis
Objectifs
x Gérer un compte utilisateur
Durée ¶
Support Clé USB ou espace personnel sur serveur ou disque dur

Programmes
- $MRXWHUOHUDFFRXUFLG¶([FHOGH:RUGHWGH3RZHU3RLQWGDQVOHPHQX'pPDUUHU

- Cliquer le bouton : Démarrer ± Tous les programmes


- Afficher le programme à épingler dans la barre des tâches ou le menu démarrer
- Cliquer-GURLWOHSURJUDPPHSXLVFOLTXHUO¶RSWLRQGpVLUpH : Épingler à la barre des menus

- Tester les raccourcis

- Cliquer le raccourci

- Supprimer les raccourcis du menu : Démarrer

- Cliquer-droit le raccourci ± Supprimer de cette liste

Fichier
- Ouvrir Excel

- Cliquer le bouton : Démarrer ± Tous les programmes ± Microsoft Office :- Micosoft Excel

- Saisir le tableau suivant :

- Cliquer dans les cellules et saisir au clavier les données

Date Nature Recettes Dépenses


01-02 Salaire ¼
12-02 Achat pantalon ¼
15-02 Restaurant ¼

- Sauvegarder le fichier dans le dossier Documents sous le nom Comptabilité

- &OLTXHUO¶RQJOHW : Fichier ± Enregistrer sous


- Sélectionner le dossier : Documents
- Saisir le nom : Comptabilité
- Cliquer : Enregistrer

- Fermer Excel

- Cliquer la case de fermeture

- Créer un raccourci pour ce fichier

- 2XYULUO¶H[SORUDWHXU:LQGRZV
- Cliquer-droit le fichier pour lequel créer un raccourci ± Créer un raccourci
- Renommer éventuellement le raccourci

- Placer le raccourci dans le menu Démarrer

- Cliquer-glisser le raccourci dans le menu démarrer

3
- Tester le raccourci

- Cliquer le raccourci

- Supprimer le raccourci du menu Démarrer

- Cliquer-droit le raccourci ± Supprimer de cette liste

Compte utilisateur
Attention cet entraînement Q¶HVWUpDOLVDEOHTXHVLYRXVGLVSRVH]GHVGURLWVG¶DGPLQLVWUDWLRQVXUO¶RUGLQDWHXU

- Créer un compte concernant un utilisateur dont le prénom est : Camille


x Définir des droits standards
x Attribuer une image
x Saisir un mot de passe : Essai

- Démarrer ± Panneau de configuration


- &OLTXHUO¶RSWLRQ: Ajouter ou supprimer des comptes utilisateurs
- Cliquer le lien : Créer un nouveau compte
- Saisir le nom du compte puis cliquer le type de compte Standard (HQJpQpUDOF¶HVWO¶DGPLQLVWUDWHXUTXLFUppOHV
comptes. En conséquence, il crée des comptes standards)

- Cliquer le bouton : Créer un Compte

- Paramétrer une interdiction de jouer

- &OLTXHUO¶RSWLRn : Autoriser et bloquer des programmes spécifiques


- &OLTXHUO¶RSWLRQ : Jeux

- &OLTXHUO¶RSWLRQ : Non
- Cliquer : OK

4
- 3DUDPpWUHUXQHDXWRULVDWLRQG¶XWLOLVHUO¶RUGLQDWHXUXQLTXHPHQWGHKjKFKDTXHMRXU

- Démarrer ± Panneau de configuration


- &OLTXHUO¶RSWLRQ : Configurer le contrôle parental pour un utilisateur
- Dans la zone : Sélectionner un fournisseur, choisir : Aucun

- Cliquer le compte à paramétrer


- Cliquer chaque option et paramétrez les contrôle à appliquer.

Limites horaires

Jeux

Programmes

Limite de durées
- &OLTXHUO¶RSWLRQ : Limites horaires
- Cliquer-JOLVVHUOHVKHXUHVGHOLPLWDWLRQG¶DFFqV

- Cliquer : OK

5
- Tester le compte utilisateur

- Cliquer le compte utilisateur et tester les jeux

- Supprimer le compte utilisateur créé

- Démarrer ± Panneau de configuration


- &OLTXHUO¶RSWLRQ: Ajouter ou supprimer des comptes utilisateurs
- Cliquer le compte à modifier

- Cliquer le lien qui correspond à la modification désirée


- Paramétrer la modification
- Cliquer : OK

6
Windows - Entrainement dossier 2
Explorateur Windows
x 3DUDPpWUHUO¶DIILFKDJH
Objectifs x Créer des dossiers, copier et renommer des fichiers
x Supprimer puis récupérer des fichiers
Durée ¶
Support Clé USB ou dossier personnel sur serveur ou disque dur

1. &KDUJHU:LQGRZVSXLVO¶H[SORUDWHXU

- Cliquer le bouton : Démarrer


- &OLTXHUO¶RSWLRQ : Documents ou Ordinateur

2. Activer le dossier Documents de votre ordinateur

- Cliquer le dossier : Documents

3. Demander un affichage détaillé du contenu (nom, date, taille etc.)

- Cliquer le bouton Affichage RXFOLTXHUOHERXWRQGpURXODQWG¶Affichage HWVpOHFWLRQQHUO¶DIILFKDJH : Détail

4. Connecter une clé USB à O¶RUGLQDWHXU

- Connecter la clé au port USB qui se trouve sur la face avant, sur OHF{WpRXjO¶DUULqUHGHYRWUHRUGLQDWHXU

5. Créer sur la clé USB un dossier dont le nom sera Maitriser Office 2010

- Cliquer-GURLWO¶XQLWpRXOHGRVVLHUGHVWLQDWLRQ± Nouveau - Dossier


- Saisir le nom du dossier (maximum 256 caractères) : Maîtriser Office 2010

6. Créer dans le dossier Maitriser Office 2010 un sous-dossier : Word

- Cliquer-droit le dossier Maîtriser Office 2007 ± Nouveau - Dossier


- Saisir le nom du dossier (maximum 256 caractères) : Word

7. Créer dans le dossier Maitriser Office 2010 un sous-dossier : Excel

- Cliquer-droit le dossier Maîtriser Office 2010 ± Nouveau - Dossier


- Saisir le nom du dossier (maximum 256 caractères) : Excel

8. Ouvrir Word et saisir le texte suivant : La vie vaut-HOOHG¶rWUHYpFXHVDQVDPRXU ?

- Cliquer le haut de la page ou double-FOLTXHUjO¶HQGURLWRFRPPHQFHUODVDLVLH


- Saisir le texte : La vie vaut-HOOHG¶rWUHYpFXHsans amour ?

7
Rappel
Saisie majuscule : appuyer sur + la lettre désirée
Saisie nombre : taper le chiffre sur le pavé numérique ou appuyer sur et le chiffre
Déplacer le curseur : utiliser les touches ou cliquer l'endroit où activer le curseur
Retour à la ligne - avec nouveau paragraphe : taper sur [Entrée]
- dans le même paragraphe : taper sur [Alt] + [Entrée]
Effacer un caractère : à gauche du curseur
à droite du curseur [Suppr]

9. Sauvegarder ce texte sous le nom Javanaise sur la clé USB dans le dossier Maitriser Office
2007/Word

- Cliquer l'outil
- Sélectionner l'unité USB le dossier destination Word
- Saisir le nom du fichier : Javanaise
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

10. Fermer Word et afficher le contenu du dossier Maitriser Office 2010/Word de la clé USB dans
O¶H[SORUDWHXU

- Cliquer la case de la fenêtre

11. Copier le fichier Javanaise et le renommer : Gainsbourg

- Ouvrir le dossier Word et sélectionner les dossiers : Javanaise


- Cliquer-glisser la sélection avec [Ctrl]
- Cliquer-droit le fichier Javanaise (2) - Renommer
- Saisir : Gainsbourg - [Entrée]

12. Supprimer le fichier Javanaise qui se trouve dans le dossier Word

- Cliquer le fichier Javanaise à supprimer ± [Suppr] ou cliquer glisser le fichier dans la corbeille
- Confirmer la suppression en cliquant [Oui]

13. Récupérer le fichier Javanaise qui est dans la poubelle et le placer dans le dossier Word

- Cliquer la corbeille qui se trouve sur le bureau ou au bas de la zone gauche des dossiers

8
Windows ± Entraînement dossier 3
Internet Explorer
x Réaliser des recherches
Objectifs x Gérer les favoris
x Enregistrer et imprimer des pages
Durée ¶
Support Aucun

Dans ce corrigé, nous indiquons le nombre de pages trouvées en juin 2011. Celui-ci est susceptible
G¶pYROXHU/¶,QWHUQHWHVWXQUpVHDXqui vit et qui évolue.

1. Ouvrir Internet Explorer

2. Recherche sur différents moteurs

2.1 Recherche avec un moteur de recherche


- Activer le moteur Google : http://www.google.fr/
- Rechercher le mot : Albert Camus sur les sites français Nombre de pages : 3 750 000

2.2 Recherche avec le moteur Bing


- Activer le moteur bing : http://www.bing.com/
- Rechercher le mot : Albert Camus Nombre de pages : 2 110 000

2.3 Recherche avec le métamoteur Métacrawler


- Activer le moteur métacrawler : http://www.metacrawler.com français
- Rechercher le mot : Albert Camus

3 - Méthodologie de recherche

- Activer Google

Rechercher : Indemnités de déplacement Nombre de pages : 1 110 000

Rechercher : indemnités de déplacement salariés expatriés Nombre de pages : 31 200

Rechercher : indemnités de déplacement salariés expatriés -PDF Nombre de pages : 13 600

Rechercher : "indemnités de déplacement" "salariés expatriés" -PDF Nombre de pages : 5

Réaliser la recherche suivante :


,QGHPQLVDWLRQGXUDSDWULHPHQWGDQVOHFDVG¶DFFLGHQWVVXUYHQX jO¶RFFDVLRQG¶XQYR\DJHjO¶pWUDQJHU

Mots clés : Indemnités rapatriement accidents étranger

9
Windows - Dossier 4
Entrainement: Windows Live Mail
Objectifs &UpHUXQFRXUULHUHWO¶HQYR\HU
Durée ¶
Support Aucun

1 - Charger Windows Mail ou ouvrir votre boîte aux lettes personnelle

- &OLTXHUO¶RXWLO dans la barre des tâches ou sur le bureau


Ou
- Cliquer le bouton ou ± Windows Live Mail

2 - 2XYULUOHFDUQHWG¶DGUHVVHVGH:LQGRZV0DLO

- &OLTXHUO¶RXWLO

3 - Créer les contacts suivants (2.2)

Nom : Claude Terrier


Mel : webmaster@cterrier.com
23 rue du Paradis - 74000 ANNECY
Pays : France
Site : www.cterrier.com

- Cliquer le bouton :
- &OLTXHUO¶RQJOHW : Nom et adresse de messagerie
- Saisir les coordonnées et le Mel de la personne
- Cliquer le bouton Ajouter
- Compléter éventuellement les autres onglets
- Cliquer : OK

Nom : Isabelle Mohon


Mel : info@mochon.com
45 rue des Marquisats - 69002 Lyon

- Cliquer le bouton :
- &OLTXHUO¶RQJOHW : Nom et adresse de messagerie
- Saisir les coordonnées et le Mel de la personne
- Cliquer le bouton Ajouter
- Compléter éventuellement les autres onglets
- Cliquer : OK

4 - Supprimer le contact : Isabelle Mochon

- Cliquer-droit le contact à supprimer - Supprimer


- Cliquer : Oui dans la fenêtre de confirmation

5 - Fermer le carnet d'adresses

- Cliquer la case de la fenêtre

10
6 - Créer un courrier électronique avec une pièce jointe

Destinataire : Claude Terrier


Objet : Essai messagerie
Texte : Nous testons la messagerie de Windows Live Mail à partir du livre « Maitriser Microsoft
Office 2010 »

- &OLTXHUO¶RXWLO
- Cliquer dans la zone : A: HWVDLVLUO¶DGUHVVH0HOGX
destinataire ou cliquer le bouton A : et sélectionner le
destinataire : Claude Terrier
- Cliquer dans la zone Objet et saisir un résumé du message : Essai de
messagerie
- Cliquer dans la zone de saisie du message
- Saisir le message à envoyer : Nous testons la messagerie de Windows Mail à partir du livre
« Maitriser Microsoft Office 2010 »

- &OLTXHUO¶RXWLO : Joindre un fichier


- Sélectionner le dossier puis le fichier image à joindre au mel
- Cliquer le bouton : Ouvrir
- 5HFRPPHQFHUDYHFG¶DXWUHVSLqFHVpYHQWXHOOHV

7 - Envoyer le Mel

- Cliquer le bouton : Envoyer

8 - Fermer Windows Mail

- Cliquer la case de la fenêtre

11
Office 2010 - Entraînement
Dossier 5 ± 3ULVHHQPDLQVG¶2IILFH10
x 3DUDPpWUHUO¶DIILFKDJHpFUDQ
Objectifs
x Paramétrer les gadgets
Durée ¶
Support Aucun

1. Word
1.1 ± Ouvrir Word

1.2 ± 3DUDPpWUHUODEDUUHG¶RXWLOV$FFqVUDSLGHDILQTX¶HOOHDIILFKHOHVRXWLOVVXLYDQWV :
x Annuler
x Aperçu avant impression
x Courrier électronique
x Dessiner un tableau
x Enregistrer
x Impression rapide
x Nouveau document
x Orthographe et grammaire
x Ouvrir
x Rétablir

- Cliquer le bouton déroulant de la barre : Accès rapide


- Cliquer GDQVODOLVWHTXLV¶DIILFKHO¶RXWLOjLQVpUHUGDQVODEDUUHAccès rapide

1.3 - 2UJDQLVHUOHVRXWLOVGDQVO¶RUGUHVXLYDQW :

- Cliquer le bouton déroulant de la barre : Accès rapide


- Cliquer : $XWUHVFRPPDQGHV«
- &OLTXHUGDQVOD]RQHGHGURLWHO¶RXWLOjGpSODFHUSXLVFOLTXHUOHERXWRQGHGpSODFHPHQWGpVLUp
- 5HFRPPHQFHUDYHFG¶DXWUHVRXWLOV
- Cliquer : OK

1.4 ± Activer le paramétrage de Word et programmer un enregistrement automatique toutes les 15


minutes

- Cliquer l¶RQJOHW : Fichier - Options,


- &OLTXHUGDQVOD]RQHGHJDXFKHO¶RSWLRQ :
Enregistrement

- Paramétrer une durée de 15 minutes


- Cliquer OK

1.5 ± $IILFKHUODSDJHHQPRGH3OHLQpFUDQSXLVUHYHQLUDXPRGHG¶DIILFKDJH1RUPDO

- &OLTXHUOHPRGHG¶DIILFKDJHGpVLUpDXEDVGHO¶pFUDQ

- &OLTXHUOHPRGHG¶DIILFKDJHGpVLUpDXEDVGHO¶pFUDQ

12
2. Excel
2.1 ± Ouvrir Excel sans quitter Word

2.2 ± ParampWUHUODEDUUHG¶RXWLOV$FFqVUDSLGHDILQTX¶HOOHDIILFKHOHVRXWLOVVXLYDQWV :
x Annuler
x Aperçu avant impression
x Enregistrer
x Impression rapide
x Nouveau document
x Orthographe et grammaire
x Ouvrir
x Rétablir
x Tri croissant
x Tri décroissant

- Cliquer le bouton déroulant de la barre : Accès rapide


- Cliquer GDQVODOLVWHTXLV¶DIILFKHO¶RXWLOjLQVpUHUGDQVODEDUUHAccès rapide

2.3 - 2UJDQLVHUOHVRXWLOVGDQVO¶RUGUHVXLYDQW :

- Cliquer le bouton déroulant de la barre : Accès rapide


- Cliquer : $XWUHVFRPPDQGHV«
- &OLTXHUGDQVOD]RQHGHGURLWHO¶RXWLOjGpSODFHUSXLVFOLTXHUOHERXWRQGHGpSODFHPHQWGpVLUp
- 5HFRPPHQFHUDYHFG¶DXWUHVRXWLOV
- Cliquer : OK

2.4 ± $FWLYHU OH SDUDPpWUDJH G¶([FHO HW SURJUDPPHU XQ HQUHJLVWUHPHQW DXWRPDWLTXH toutes les 15
minutes

- Cliquer l¶RQJOHW : Fichier ± Options

- &OLTXHUGDQVOD]RQHGHJDXFKHO¶RSWLRQ :
Enregistrement

- Paramétrer une durée de 15 minutes


- Cliquer OK

2.5 ± Afficher la page en mode Mise HQSDJHSXLVUHYHQLUDXPRGHG¶DIILFKDJH1RUPDO

- &OLTXHUOHPRGHG¶DIILFKDJHGpVLUpDXEDVGHO¶pFUDQ

- &OLTXHUOHPRGHG¶DIILFKDJHGpVLUpDXEDVGHO¶pFUDQ

3. Word-Excel
3.1 ± Activer Word par la barre des tâches

- Cliquer dans la barre des taches le programme à activer

3.2 ± Fermer Word


3.3 ± Fermer Excel

13
Office 2010 - Entraînement
Dossier 6 ± Gestion des fichiers et documents
x Paramétrer le document sous Word et Excel
Objectifs x Juxtaposer des documents
x Activer plusieurs documents
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou sur le disque dur

Word

1. Charger Word
2. Créer un nouveau document
- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide

3. Saisir le texte suivant (VVDLQXPpURGHFUpDWLRQG¶XQGRFXPHQWGHformat A4

- Cliquer le haut de la page ou double-FOLTXHUjO¶HQGURLWRFRPPHQFHUODVDLVLH


- Saisir le texte : (VVDLQXPpURGHFUpDWLRQG¶XQGRFXPHQWGHIRUPDW$

Rappel
Saisie majuscule : appuyer sur + la lettre désirée
Saisie nombre : taper le chiffre sur le pavé numérique ou appuyer sur et le chiffre
Déplacer le curseur : utiliser les touches ou cliquer l'endroit où activer le curseur
Retour à la ligne - avec nouveau paragraphe : taper sur [Entrée]
- dans le même paragraphe : taper sur [Alt] + [Entrée]
Effacer un caractère : à gauche du curseur
à droite du curseur [Suppr]

4. Paramétrer une feuille de format A4

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOTaille
- Sélectionner la taille : A4

5. Paramétrer une marge de 2,5 cm sur les quatre côtés de la feuille

- &OLTXHUO¶RXWLOMarges
- &OLTXHUO¶RSWLRQ : 0DUJHVSHUVRQQDOLVpHV« et paramétrer une dimension de 2,5 cm
- Cliquer : OK ou [Entrée]

6. Paramétrer un orientation en mode Paysage

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQ : Paysage

7. Faire un aperçu avant impression du document

- Cliquer le bouton Office


- Cliquer OHERXWRQGpURXODQWGHO¶RSWLRQ,PSULPHU«
- &OLTXHUO¶RSWLRQ : Aperçu avant impression

8. 4XLWWHUO¶aperçu avant impression

- &OLTXHUO¶RXWLO : )HUPHUO¶DSHUoX

9. Sauvegarder le document sous le nom Essai 1 Word sur votre clé USB ou dans le dossier Mes
documents
- Cliquer l'outil
- Sélectionner l'unité USB le dossier destination Word
- Saisir le nom du fichier : Essai 1 Word

14
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

10. Créer un nouveau document

- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide

11. Saisir le texte suivant : Essai numéro 2 de créDWLRQG¶XQGRFXPHQWGHIRUPDW A6

- Cliquer le haut de la page ou double-FOLTXHUjO¶HQGURLWRFRPPHQFHUODVDLVLH


- Saisir le texte : (VVDLQXPpURGHFUpDWLRQG¶XQGRFXPHQWGHIRUPDW$6

12. Paramétrer une feuille de format A6

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOTaille
- Sélectionner la taille : A6

13. Paramétrer une marge de 1 cm sur les quatre côtés de la feuille

- &OLTXHUO¶RXWLOMarges
- &OLTXHUO¶RSWLRQ : 0DUJHVSHUVRQQDOLVpHV« et paramétrer une dimension de 1 cm
- Cliquer : OK ou [Entrée]

14. Paramétrer un orientation en mode Portrait

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQ : Portrait

15. Sauvegarder le document sous le nom Essai 2 Word sur votre clé USB ou dans le dossier Mes
documents

- Cliquer l'outil
- Sélectionner l'unité USB le dossier destination Word
- Saisir le nom du fichier : Essai 2 Word
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

16. Activer le fichier Essai 1 Word

- Cliquer dans la barre des tâches le fichier Essai 1

17. Activer le fichier Essai 2 Word

- Cliquer dans la barre des tâches le fichier Essai 2

18. -X[WDSRVHUOHVGRFXPHQWVjO¶pFUDQ

- &OLTXHUO¶RQJOHWAffichage
- &OLTXHUO¶RXWLO ou
- Afficher la fenêtre en plein écran en cliquant la case ou

19. Fermer les fichiers

- Cliquer la case de la fenêtre

15
20. Fermer Word
- Cliquer la case de la fenêtre

Excel
21. Charger Excel

22. Créer un nouveau document

- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide

ère
23. Saisir le texte suivant dans la 1 cellule: Essai 1 Excel

- Cliquer dans la cellule A1


- Saisir : Essai 1 Excel

24. Paramétrer une feuille de format A4

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOTaille
- Sélectionner la taille : A4

25. Paramétrer une marge de 2,5 cm sur les quatre côtés de la feuille

- &OLTXHUO¶RXWLOMarges
- &OLTXHUO¶RSWLRQ : 0DUJHVSHUVRQQDOLVpHV« et paramétrer une dimension de 2,5 cm
- Cliquer : OK ou [Entrée]

26. Paramétrer un orientation en mode Paysage

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQ : Paysage

27. Faire un aperçu avant impression du document

- Cliquer le bouton Office


- Cliquer OHERXWRQGpURXODQWGHO¶RSWLRQ,PSULPHU«
- &OLTXHUO¶RSWLRQ : Aperçu avant impression

28. 4XLWWHUO¶DSHUoXDYDQWLPSUHVVLRQ

- &OLTXHUO¶RXWLO : )HUPHUO¶DSHUoX

29. Sauvegarder le document sous le nom Essai 1 Excel sur votre clé USB ou dans le dossier Mes
documents

- Cliquer l'outil
- Sélectionner l'unité USB le dossier destination Word
- Saisir le nom du fichier : Essai 1 Excel
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

30. Créer un nouveau document

- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide

16
31. Saisir le texte suivant : Essai 2 Excel dans la cellule A1

- Cliquer dans la cellule A1


- Saisir : Essai 2 Excel

32. Paramétrer une feuille de format A6

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Taille
- Sélectionner la taille : A6

33. Paramétrer une marge de 1 cm sur les quatre côtés de la feuille

- &OLTXHUO¶RXWLOMarges
- &OLTXHUO¶RSWLRQ : 0DUJHVSHUVRQQDOLVpHV« et paramétrer une dimension de 1 cm
- Cliquer : OK ou [Entrée]

34. Paramétrer un orientation en mode Portrait

- &OLTXHUO¶onglet : Mise en page


- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQ : Portrait

35. Sauvegarder le document sous le nom Essai 2 Excel sur votre clé USB ou dans le dossier Mes
documents

- Cliquer l'outil
- Sélectionner l'unité USB le dossier destination Word
- Saisir le nom du fichier : Essai 2 Excel
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

36. Activer le fichier Essai 1 Excel

- Cliquer dans la barre des tâches le fichier Essai 1 Excel

37. Activer le fichier Essai 2 Excel

- Cliquer dans la barre des tâches le fichier Essai 2 Excel

38. -X[WDSRVHUOHVGRFXPHQWVjO¶pFUDQ

- &OLTXHUO¶RQJOHWAffichage
- &OLTXHUO¶RXWLO ou
- Afficher la fenêtre en plein écran en cliquant la case ou

39. Fermer les fichiers

- Cliquer la case de la fenêtre

40. Fermer Excel

- Cliquer la case de la fenêtre

17
Word 2010
Entraînement 7 : Saisie et correction de texte
x Paramétrer la page
Objectifs
x Saisir et corriger un texte
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word et paramétrer la page de la façon suivante :


x Taille de la page : A6
x Marges de 1 cm tout autour de la feuille
x Orientation : Portrait

- Charger une application office

- Cliquer le bouton Démarrer


- &OLTXHUGDQVODOLVWHG¶DFFqVUDSLGHOHSURJUDPPHjDFWLYHUV¶il a été utilisé récemment
Ou
- Cliquer le menu : Tous les programmes
- Cliquer le groupe de programmes : Microsoft Office
- Cliquer le programme souhaité : Word 2010

- Créer un document
- Cliquer O¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide
Ou
- Cliquer longlet : Fichier - 1RXYHDX«
- Sélectionner le type de document à créer
- Cliquer le bouton : Créer

- 3DUDPpWUHUOHIRUPDWGXGRFXPHQW WDLOOHPDUJHVRULHQWDWLRQ«

¾ Taille de la page
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOTaille
- Sélectionner une taille prédéfinie A6

¾ Marges
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOMarges
- &OLTXHUO¶RSWLRQ : 0DUJHVSHUVRQQDOLVpHV« et paramétrer la dimension désirée : 1 cm
- OK ou [Entrée]

¾ Orientation de la feuille
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQPortrait

18
2. Saisir la chanson suivante :

x Ne pas chercher à mettre le texte en forme,


x Les symboles sont des caractères
spéciaux de la police Wingdings
x Dans la ligne Á votre avis... la lettre Á en
capital doit avoir un accent

- Saisir des caractères normaux

¾ Activer le lieu ou commencer la saisie


- &OLTXHU OH KDXW GH OD SDJH j O¶HQGURLW R
commencer la saisie et taper au clavier le
texte de la chanson

Saisir le texte
La Javanaise [Entrée]
[Entrée]
J'avoue j'en ai bavé pas vous, mon amour [Entrée]
Avant d'avoir eu vent de vous, mon amour [Entrée]
[Entrée]
Ne vous déplaise, en dansant la Javanaise [Entrée]
Nous nous aimions, le temps d'une chanson [Entrée]
[Entrée]
Á votre avis qu'avons nous vu, de l'amour [Entrée]
De vous a moi vous m'avez eu, mon amour [Entrée]
[Entrée]
Hélas avril en vain me voue, a l'amour [Entrée]
J'avais envie de voir en vous, cet amour [Entrée]
[Entrée]
La vie ne vaut d'être vécue, sans amour [Entrée]
Mais c'est vous qui l'avez voulu, mon amour [Entrée]
[Entrée]
Serge Gainsbourg

Saisie majuscule : appuyer sur + la lettre désirée


Saisie nombre : taper le chiffre sur le pavé numérique ou appuyer sur et le chiffre
Déplacer le curseur : utiliser les touches ou cliquer l'endroit où activer le curseur
Retour à la ligne - avec nouveau paragraphe : taper sur [Entrée]
- dans le même paragraphe : taper sur [Alt] + [Entrée]
Effacer un caractère : à gauche du curseur
à droite du curseur [Suppr]

19
x Saisir les symboles
- Cliquer le lieu où insérer le symbole, devant le
titre
- &OLTXHUO¶RQJOHW : Insertion puis l¶RXWLOSymbole
- COLTXHUO¶RSWLRQ$XWUHVV\PEROHV«
- Cliquer la police désirée Wingdings
- Cliquer le caractère désiré au dessous
- Cliquer le bouton : Insérer
- Cliquer la case pour fermer la fenêtre
- Mettre en forme le symbole

- Copier-coller le symbole à droite du titre


Ou
- &OLTXHUjGURLWHGXWLWUHHWUHFRPPHQFHUO¶RSpUDWLRQ
précédente

- Cliquer à gauche du nom au bas de la chanson


- &OLTXHUO¶RQJOHW : Insertion puis l¶RXWLOSymbole
- COLTXHUO¶RSWLRQ$XWUHVV\PEROHV«
- Cliquer la police désirée Wingdings
- Cliquer le caractère désiré au dessous
- Cliquer le bouton : Insérer
- Cliquer la case pour fermer la fenêtre
- Mettre en forme le symbole

- Copier-coller le symbole à droite du nom


Ou
- Cliquer à droite du nom et recommencer
O¶RSpUDWLRQSUpFpGHQWH

&RUULJHUO¶RUWKRJUDSKHGHODFKDQVRQ

- Cliquer en haut du document


- &OLTXHUO¶RQJOHW : Révision
- &OLTXHUO¶RXWLO : Grammaire et orthographe
=> Word propose des FRUUHFWLRQVFOLTXHUO¶RSWLRQGpVLUpH

Ignorer => Ignore ce problème et reprend la correction


Ignorer tout => ignore ce problème et ne la propose plus en cas de répétition
Modifier => corrige la faute par la correction proposée
Modifier tout => corrige la faute par la correction proposée dans toutes les occurrences trouvées

4. Imprimer cette chanson


- Cliquer l'outil de la barre Accès rapide

20
5$IILFKHUO¶LQGLFHGHOLVLELOLWpGXWH[WH

- Activer les statistiques de lisibilité


- Cliquer l¶RQJOHW : Fichier - Options
- &OLTXHUO¶RSWLRQVérification à gauche
- Activer la case : Vérifier la grammaire et l'orthographe
- Activez la case : Afficher les statistiques de lisibilité
- Cliquer OK

6. Afficher les statistiques de lisibilité


- Réaliser une corUHFWLRQG¶RUWKRJUDSKHGXWH[WH/RUVTX¶HOOHHVW
terminée Word affiche les statistiques de lisibilité du texte

7. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
RXGHODFOp86%VRXVOHQRP/DMDYDQDLVH $WWHQWLRQVLFHGRVVLHUQ¶H[LVWHSDVYRXVGHYH]OH
créer su le support indiqué).

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Maitriser Office 2010
- Saisir le nom du fichier : La Javanaise
- Cliquer le bouton : Enregistrer

21
Word 2010
Entraînement 8 : Mise en forme de texte
x Paramétrer la page
Objectifs
x Saisir et corriger un texte
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word et paramétrer la page de la façon suivante :


x Taille de la page : A4
x Marges de 2,5 cm tout autour de la feuille
x Orientation : Portrait

- Paramétrer le format du document (taille, PDUJHVRULHQWDWLRQ«

¾ Taille de la page
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOTaille
- Sélectionner une taille prédéfinie A4

¾ Marges
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Marges
- &OLTXHUO¶RSWLRQ : Marges SHUVRQQDOLVpHV« et paramétrer la dimension désirée : 2,5 cm
- OK ou [Entrée]

¾ Orientation de la feuille
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQPortrait

2. Saisir et mettre en forme la recette suivante :

- Saisir le texte brut sans le mettre en forme


- &OLTXHUOHKDXWGHODSDJHjO¶HQGURLWRFRPPHQFHUODVDLVLHet taper au clavier le texte de la recette

Mousse au chocolat [Entrée]


[Entrée]
Cette recette sans sucre et sans matières grasses plaira particulièrement aux amateurs de chocolats.
[Entrée]
Temps de préparation : 10 min. [Entrée]
Temps de repos : 4 à 5 h. [Entrée]
[Entrée]
Ingrédients : [Entrée]
200 g à 250 g de chocolat noir pâtissier ou noir corsé selon votre passion du chocolat [Entrée]
°XIV [Entrée]
1 pincée de sel fin [Entrée]
[Entrée]
Préparation : [Entrée]
Dans une petite casserole à fond épais, casser le chocolat en morceaux, ajouter une cuillère d'eau ou de lait
HW IDLUH IRQGUH WUqV GRXFHPHQW HQ UHPXDQW MXVTX¶j FH TXH OH FKRFRODW GHYLHQQHQW FUpPHX[ HW KRPRJqQH
$MRXWHU pYHQWXHOOHPHQW XQ SHX GH ODLW RX G¶HDX V¶LO HVW WURS pSDLV $WWHQWLRQ LO QH GRLW SDV rWUH OLTXLGH
[Entrée]
6pSDUHUOHVMDXQHVGHVEODQFVG¶°XIVGDQVMDWWHV [Entrée]
9HUVHUOHFKRFRODWIRQGXVXUOHVMDXQHVG¶°XIVHQPpODQJHDQWUpJXOLqUHPHQWGHIDoRQjREWHQLUXQPpODQJH
homogène. [Entrée]
%DWWUHOHVEODQFVG
°XIVHQQHLJHIHUPHDYHFXQHSLQFpHGHVHOILQ[Entrée]
$MRXWHUOHVEODQFVHQQHLJHDXFKRFRODWMDXQHG¶°XIHQPpODQJHDQWGpOLFDWHPHQWOHWRXWGHIDoRQjQHSDV
casser les blancs. Ne pas les brasser trop sans quoi la mousse deviendra liquide si les blancs sont cassés.
Verser éventuellement la mousse dans des coupes, et mettre au frais 4 ou 5 h au réfrigérateur, avant de
servir.

22
- Mettre en forme le texte

¾ Le titre
- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner le nom de la recette par cliqué-glissé

- &OLTXHUO¶RXWLO : Centré
- Paramétrer une police Arial black et un corps de 20 à 22

¾ Le chapeau
- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner le texte du chapeau par cliqué-glissé &HWWHUHFHWWHVDQVVXFUHHWVDQVPDWLqUHJUDVVH«

- &OLTXHUO¶RXWLO Centré
- Paramétrer une police Bitstream ou autre et un corps de 14
- &OLTXHUO¶RXWLO : Bordures et sélectionner Bordure extérieures
- &OLTXHUO¶RXWLO : Trame de fond et paramétrer un fond Jaune

- Paramétrer un retrait de paragraphe à droite et à gauche du texte

¾ Temps de préparation et temps de repos


- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner le texte

- &OLTXHUO¶RXWLO Centré

- Mettre les titres en gras et en corps de 14

Ingrédients
- &OLTXHUO¶RQJOHW : Accueil

- Sélectionner le texte Ingrédient et le mettre en gras


- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLOPuces
- Sélectionner la puce désirée dans la liste au-dessous

¾ Préparation

- Sélectionner le texte Préparation et le mettre en gras


- Sélectionner tout le texte du bas par cliqué-glissé
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLONumérotation
- Sélectionner la numérotation désirée

- Paramétrer éventuellement des sauts de ligne entre les paragraphes

23
&RUULJHUO¶RUWKRJUDSKHGXWH[WH

- Cliquer en haut du document


- &OLTXHUO¶RQJOHW : Révision
- &OLTXHUO¶RXWLO : Grammaire et orthographe
!:RUGSURSRVHGHVFRUUHFWLRQVFOLTXHUO¶RSWLRQGpVLUpH

Ignorer => Ignore ce problème et reprend la correction


Ignorer tout => ignore ce problème et ne la propose plus en cas de répétition
Modifier => corrige la faute par la correction proposée
Modifier tout => corrige la faute par la correction proposée dans toutes les occurrences trouvées

4. Imprimer cette chanson

- Cliquer l'outil de la barre Accès rapide

5. Sauvegarder le document dans le dossier Maîtriser Office 2010, du dossier Document ou de la clé
86% VRXV OH QRP /D MDYDQDLVH $WWHQWLRQ VL FH GRVVLHU Q¶H[LVWH SDV YRXV GHYH] OH FUpHU VX OH
support indiqué).

- Cliquer l'outil
- Sélectionner l'unité puis le dossier Maîtriser Office 2010
- Saisir le nom du fichier : La Javanaise
- Cliquer le bouton : Enregistrer

24
Word 2010
Entrainement 9 : Saisie et mise en forme de texte
x Paramétrer la page
Objectifs
x Saisir et corriger un texte
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word

2. Charger la rHFHWWH GH OD PRXVVH DX FKRFRODW UpDOLVp GDQV O¶HQWUDvQHPHQW  ou saisir et mettre en
forme la recette suivante :
Paramètres de la page :
x Taille de la page : A4
x Marges de 2,5 cm autour de la feuille
x Orientation : Portrait

- &OLTXHUO¶RXWLO dans la barre Accès rapide


Ou
- Cliquer l¶RQJOHW : Fichier - 2XYULU«
- Sélectionner l'unité puis le dossier source CNED Bureautique
- Cliquer le nom du fichier à charger : Mousse au chocolat
- Cliquer le bouton : Ouvrir

- 3DUDPpWUHUOHIRUPDWGXGRFXPHQW WDLOOHPDUJHVRULHQWDWLRQ«

¾ Taille de la page
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLOTaille
- Sélectionner une taille prédéfinie A4

¾ Marges
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Marges
- &OLTXHUO¶RSWLRQ : 0DUJHVSHUVRQQDOLVpHV« et paramétrer la dimension désirée : 2,5 cm
- OK ou [Entrée]

¾ Orientation de la feuille
- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Orientation
- 6pOHFWLRQQHUO¶RULHQWDWLRQPortrait

3. Placer votre nom en en-tête de page ainsi que la date du travail

- &OLTXHUO¶RXWLOEn-tête ou Pied de page


- &OLTXHUGDQVODOLVWHO¶HQ-tête, le pied de page ou le numéro prédéfini désiré
=> Le ruban Outils des en-têtes et pieds de page est affiché :
- Double-cliquer O¶HQ-tête ou le pied de page
- Saisir et mettre en forme votre nom

- Cliquer le lieu où insérer la date


- &OLTXHUO¶RXWLODate et heure
- Cliquer la présentation souhaitée

4. Paramétrer un arrière-plan

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Couleur de page
- &OLTXHUO¶RSWLRQMotifs et textureV«
- Onglet : Texture ou Motifs
- Cliquer le motif ou la texture désiré
- Cliquer OK

25
5. Paramétrer une bordure de page

- &OLTXHUO¶RQJOHWMise en page
- &OLTXHUO¶RXWLO : Bordure de page
- Onglet : Bordure de page
- Sélectionner le type de bordure

- Paramétrer le style, la couleur et la taille de la


bordure
- Cliquer OK
- Cliquer OK

6. Imprimer la recette

- Cliquer l'outil de la barre Accès rapide

7. Tester la recette chez vous et en envoyer


XQSHWLWSHXjO¶DXWHXUSRXUOXLIDLUHplaisir

8. Sauvegarder le document dans le dossier


Maîtriser Office 2010 du serveur, du
dossier Document ou de la clé USB sous le
nom La javanaise (Attention si ce dossier
Q¶H[LVWH SDV YRXV GHYH] OH FUpHU VX OH
support indiqué).

- Cliquer l'outil
- Sélectionner l'unité puis le dossier Maitriser
Office 2010
- Saisir le nom du fichier : Mousse au chocolat
- Cliquer le bouton : Enregistrer

26
Word 2010
Entraînement 10 : Colonnes et tableaux
x Mettre un texte en colonne
Objectifs
x Créer un tableau
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word

2. Saisir et mettre en forme le document suivant :

- Saisir le texte
e
Dans ce 5 classement BrandZTM, les marques fortes ont prouvé leur résistance à la récession. Alors que
la plupart des indicateurs financiers clés chutent, on constate que la valeur des Marques du Top 100 a
DXJPHQWpGHO¶DQGHUQLHUSRXUDWWHLQGUHSOXVGHPLOOLDUGVGHGROODUV/HFODVVHPHQW%UDQG=70
7RS  HVW O¶XQLTXH pYDluation mondiale qui tienne compte des opinions des consommateurs sur les
marques ainsi que des valeurs monétaires.

Supériorité des Marques technologiques


Les marques technologiques ont démontré leur omniprésence dans notre vie quotidienne. Cette
RPQLSUpVHQFHWLHQWGHODWUqVIRUWHYDOHXUG¶XVDJHGHOHXUVVHUYLFHVHWGHO¶H[SDQVLRQIXOJXUDQWHVXUODWUqV
grande majorité des marchés à travers le monde. Cette année encore, Google est en tête du classement en
tant que marque mondiale la plus puissante avec une valorisation à 114 milliards de dollars. IBM est en
seconde position avec 86 milliards de dollars, soit une hausse de 30 %. En troisième place nous retrouvons
Apple dont la valeur a augmenté de 32 %, à 83 milliards de dollars. Microsoft se retrouve quatrième avec
une valeur de 76 milliards de dollars.

Des grandes Marques qui investissent les réseaux sociaux


Facebook, le plus populaire des réseaux sociaux, entre dans le classement du secteur des technologies
pour la première fois avec une valeur de la marque de 5,5 milliards de dollars. Ces marques leaders, de par
OHXU IRUFH EpQpILFLHQW G¶XQ DWRXW VXSSOpPHQWDLUH FDU HOOHV RQW XQH IRUFH G¶DWWUDFWLRQ LQpJDOpH SRXU OHV
FRQVRPPDWHXUV&LWRQVSDUH[HPSOH0F'RQDOG¶VTXLDSURPXDYHFVXFFqVVRQMHX0RQRSRO\VXUOHUpVHDX
7ZLWWHU/HV0DUTXHVVHUHWURXYHQWDXMRXUG¶KXLDYHFXQQRXYHOHVSDFHSRXUFRPPXQLTXHUGLIIpUHPPHQWHW
recréer du lien avec les consommateurs.

Source : http://www.marketing-professionnel.fr/

- 0HWWUHHQIRUPHOHWLWUHGHO¶DUWLFOH
- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner le WLWUHGHO¶DUWLFOH

- &OLTXHUO¶RXWLO : Centré
- Paramétrer une police Times New roman ou autre et un corps de 18
- &OLTXHUO¶RXWLO : Bordures et sélectionner Bordure extérieures

- Mettre le texte en colonne

¾ Créer les colonnes


- &OLTXHUO¶RQJOHW : Mise en forme
- Sélectionner le texte à mettre en colonne. /DPDUTXH0LFURVRIW««
Classement)
- &OLTXHUO¶RXWLO : Colonnes et sélectionner le nombre de colonnes à
créer

¾ Tracer un filet entre les colonnes


- Cliquer une colonne de texte
- &OLTXHUO¶RXWLO : Colonnes puis O¶RSWLRQ : Autres colonneV«au bas
de la liste

- Activer la case Ligne séparatrice


- Cliquer OK

27
- Concevoir le tableau

¾ Créer le tableau
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RSWLRQ : Insérer un tableau
- Saisir le nombre de lignes (10) et de colonnes (3) du tableau
- Cliquer OK
=> Le ruban Outils de tableau avec deux onglets : Création et
Disposition est ajouté à la barre des rubans :

¾ Saisir les données


- $FWLYHU OD FHOOXOH GDQV ODTXHOOH VDLVLU XQH GRQQpH HQ OD FOLTXDQW ,O HVW SRVVLEOH GH SDVVHU G¶XQH FHOOXOH j
O¶DXWUHSDU[Tab]
- La saisie et la modification de GRQQpHVGDQVXQWDEOHDXHVWFRPSDUDEOHjFHOOHG¶XQWH[WHKDELWXHOjFHWWH
GLIIpUHQFHTX¶HOOHHVWIDLWHGDQVXQHFHOOXOH

Top  10  mondial  des  marques  du  secteur  high-­‐tech  


Classement   Marques   Valeur  
en  milliards  de  $  
1   Google   114,260  
2   IBM   86,383  
3   Apple   83,153  
4   Microsoft   76,344  
5   Coca  cola   67,983  
6   McDonalds   66,005  
7   Marlboro   57,047  
8   China  Mobile   52,616  
9   GE   45,054  
10   Vodafone   44,404  

¾ Mise en forme rapide du tableau


- Cliquer le tableau
- &OLTXHUO¶RQJOHWCréation de la zone Outils de tableau
- Sélectionner le style prédéfini désiré

- 0HWWUHHQIRUPHOHVGRQQpHVjO¶LQWpULHXUGXWDEOHDX

Top 10 mondial des marques du secteur high-tech


Valeur
Classement Marques
en milliards de $
1 Google 114,260
2 IBM 86,383
3 Apple 83,153
4 Microsoft 76,344
5 Coca cola 67,983
6 McDonalds 66,005
7 Marlboro 57,047
8 China Mobile 52,616
9 GE 45,054
10 Vodafone 44,404

Corrigé  :  Maîtriser  Office  2010     Page  28  


3. Imprimer le document
- Cliquer l'outil de la barre Accès rapide

4. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom : &ODVVHPHQWGHVPDUTXHVPRQGLDOHV $WWHQWLRQVLFHGRVVLHUQ¶H[LVWH
pas vous devez le créer sur le support indiqué).

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Maitriser Office 2010
- Saisir le nom du fichier : Classement des marques mondiales
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  29  


Word 2010
Entraînement 11 : Thèmes et styles de paragraphes
x Utiliser un thème et des styles de paragraphes
Objectifs
x Créer une table des matières et un index
x ¶VLOHWH[WHHVWWpOpFKDUJp
Durée
x 1h 45 si le texte doit être saisi
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1 ± Saisir le texte suivant :

,OHVWSRVVLEOHGHOHWpOpFKDUJHUjO¶DGUHVVHVXLYDQWH : http://cterrier.com/souche_exercice/souche-pnl-maitriseroffice2007.htm et de le
copier coller dans un document Word

/¶DQDO\VHWUDQVDFWLRQQHOOH $7
/¶DQDO\VHWUDQVDFWLRQQHOOHDpWpFUppHSDU(ULF%(51( à la fin des années 50. Médecin psychiatre américain, il a mis au point une approche
pragmatique et simple des rapports humains expliquée est vulgarisée dans 2 ouvrages de référence : (Des jeux et des hommes, 1966 ; Que dite vous
après avoir dit bonjour ? 1977)
Source image : http://www.ta-tutor.com/eric54.htm
/¶$7DFRQQXXQVXFFqVLPSRUWDQWDXSUqVGXSXEOLFDYDQWG¶rWUHUHFRQQXHSDUOHVSURIHVVLRQQHOOHV$XMRXUG¶KXLFHWWHDSSURFKHFRPSRUWHPHntaliste des
relations humaines est très utilisée pour étudier les relations dans les organisations, les HQWUHSULVHVO¶pGXFDWLRQ
/¶$7UHSRVHVXUWURLVFRQFHSWV
Nous abritons simultanément trois personnages en nous : un parent, un enfant un adulte et selon les situations, les personnes rencontrées nous adoptons
tel ou tel personnage,
Certains comportements sont répétitifs et donnent naissances à des jeux,
Nous avons tous en nous un plan de vie que nous nous sommes définit très jeune et dont le déroulement donne naissance à un scénario de vie.
Sources : http://wiki.crao.net/index.php/EricBerne, http://www.freewarriors.org/at1.htm

/H3DUHQWVO¶(QIDQWO¶$GXOWH

1.1 Les différents états du moi : P, A, E


'HODQDLVVDQFHjO¶kJHDGXOWHO¶rWUHJUDQGLWHVW SDVVHSDUGHVpWDWVGLIIpUHQWV(ULF%(51(DPRQWUpTXHO¶LQGLYLGXQHGpSDVVHSDVOHVGLIIpUHQWVpWDWVSDU
OHVTXHOVLOHVWSDVVpPDLVTX¶LOOHVLQWqJUH$XVVL
x Le Parent est la partie du "moi" qui s'est constitué dans l'enfance sous l'influence du modèle parental et de l'entourage.
x L'Adulte est le dernier état du "moi" qui se développe. C'est lui qui observe, comprend, agit décide, analyse...
x L'Enfant HVWOHSUHPLHUpWDWGXPRLTXLV¶HVWFRQVWLWXpDSUqVODQDLVVDQFHLOH[SULPHVDQVUpVHUYHO¶DIIHFWLYLWpOHVEHVRLQVOHVVHQVDWLRQVOHV
émotions de la personne.

1.1.1 Enfant libre ou naturel (EL) - Ressenti


&¶HVWOHSUHPLHUpWDWO¶HQIDQWH[SULPHVDQVUpVHUYHVRQUHVVHQWLVHVGpVLUVEHVRLns, émotions, peurs, craintes, plaisirs, colères, souffrances. Les
UpDFWLRQVREVHUYDEOHVVRQWLPPpGLDWHVHWVSRQWDQpHV,OQ¶DSDVG¶LQWHUGLWHWGHOLPLWHFHVRQWGHVUpDFWLRQVEUXWHVHWOLEUHs.
Exemple M¶DLIDLPMHSOHXUHM¶DLHQYLHGHERQERQVMHPHVerre
&KH]O¶DGXOWHO¶HQIDQWOLEUHHVWUHSpUDEOHORUVTXHODSHUVRQQHH[SULPHVDQVGpWRXUVVHVpPRWLRQV VDXWHPEUDVVDGHVpFODWVde rire, cris de terreur,
pleurs...)
'DQVO¶(QIDQW1DWXUHOVHWURXYHODVRXUFHGHQRVpPRWLRQVOHVSOXVDXWKHQWLTXHV Nous sommes dans notre Enfant Naturel lorsque nous pleurons à gros
sanglots ou lorsque nous rions aux éclats. Il est assez rare de voir des personnes adultes dans leur Enfant Naturel car la société en perçoit surtout les
aspects négatifs (les émotions ne doivent pas venir gêner le bon fonctionnement de l'adulte ni les désirs instinctifs contrecarrer les instructions du
Parent).
L'Enfant Libre est aussi appelé l'Enfant spontané, il se caractérise par un comportement immédiat dans l'expression des sentiments. Nous sommes dans
OHPRQGHGHO
pPRWLRQ/DSHXUODFROqUHODMRLHOHGpVLU«
'DQVVRQYHUVDQWSRVLWLIO¶(QIDQW/LEUHHVWJDLVpGXLVDQWDWWDFKDQWQDWXUHOGDQVVRQYHUVDQWQpJDWLILOGHYLHQWDYLGHRUJXHLOOHX[pJRwVWHEOHVVDQW«
Très tôt l'enfant apprend à s'adapter aux diverses demandes et comportements de ses parents. Suivant les cas il s'y adapte de 2 façons, soit en s'y
VRXPHWWDQWSRXUDYRLUODSDL[&
HVWO¶(QIDQW$GDSWp6RXPLV 6RLWHQVHUHEHOODQWF¶HVWO¶HQIDQWDGDSWpUHEHl.

1.1.2 Enfant Adapté Soumis (EAS)


)DFHDX[UpDFWLRQVGHVSDUHQWVO¶HQIDQWDSSUHQGjVHFRQWU{OHULOVHVRFLDELOLVH/HVUpDFWLRQVQHVRQWSOXVQDWXUHOOHVPDLVUpIOpFKLHV/¶HQIDQWV¶DGDSWH
au milieu ambiant et aux exigences des parents, ce qui le conduit à éprouver des sentiments nouveaux : culpabilité, honte, jalousie, malaise, frustration,
fierté qui viennent compliquer ses réactions.
/¶HQIDQWGHYLHQWXQrWUHjSDUWHQWLqUHDYHFVRQGpEXWGHSHUVRQQDOLWpPDODGUoite.
Exemple M¶DLIDLPMHGHPDQGHjPDQJHUHWMHQHPHsers SDVVDQVDXWRULVDWLRQM¶DLHQYLHGHERQERQVMHGHPDQGHVLMHSHX[PHVHUYLU
/HVDWWLWXGHVHWFRPSRUWHPHQWVVHIRQWGHIDoRQLQWXLWLYHSDUXQHUpIOH[LRQEURXLOORQQHUpVXOWDWGHFHTXHO¶RQappel petit professeur ou (Enfant créateur).
,OSUHVVHQWODPHLOOHXUHFRQGXLWHjDGRSWHUVDQVrWUHWRWDOHPHQWVRXPLV/HVDFWHVLQIOXHQFpVSDUO¶pPRWLRQVRQWSDUIRLVDEHrrants. Ils essayent de se
FRQIRUPHUjFHTX¶LOSHQVHrWUHODPHLOOHXUHVROXWLRQ,OHVWGDQVOHPRQGHGHO
LPDJLQDWLRQGHO
LQYHQWLRQGHO¶LQWXLWLRQ'DQVVRQYHUVDQWQpJDWLIVD
capacité à créer l'adhésion autour de ses thèses peut le conduire à des excès préjudiciables aux buts de l'organisation dans laquelle il évolue.
Les attitudes adoptées durant cette période sont importantes car il ne les perdra pas toutes en grandissant. Chaque fois que la personne a affaire à des
SHUVRQQHVG¶DXWRULWp LGHQWLILpVDX[SDUHQWV ,ODWHQGDQFHjUpDJLUGHODPrPHIDoRQTX¶DXFRXUVGHO¶HQIDQFH/
($6acquiescera aux propos d'un
supérieur, sans même y croire, se forcera à être poli et souriant, par crainte des conséquences, alors qu'il aurait envie de s'emporter,
Exemple : /RUVTXHMHVXLVPDODGHRQV¶RFFXSHGHPRL !-HVXLVPDODGHSRXUTXHO¶RQV¶RFFXpe de moi. Mes parents aiment que je sois gentil => Je suis
JHQWLOSRXUTXHO¶RQP¶DLPH

Corrigé  :  Maîtriser  Office  2010     Page  30  


1.1.3 Enfant Adapté Rebel (EAR)
La rébellion reste une forme d'adaptation aux exigences d'une autorité (parentale ou autre). L'opposition, la révolte dure ou douce, exprime sous une
forme ou une autre nos désaccords. Devenu adulte, l'EAR se révoltera contre l'autorité, simplement parce que c'est l'autorité. Il est évident qu'il est
parfois prudent et utile de se soumettre ou de se révolter et que notre Enfant adapté à un rôle à jouer. Mais s'il domine une personnalité nous aurons des
personnes sans aucune personnalité ou revers de la médaille des opposants perpétuels.

1.1.4 Parent O¶DSSULV)


,OVHGpYHORSSHjSDUWLUGHO¶HQIDQFH&HWpWDWHQUHJLVWUHOHVDWWLWXGHVOHVIDoRQVG¶rWUHOHVSUpFHSWHVOHVVHQWLPHQWVDIILFKpVSDUOHVILJXUHVG¶DXWRULWé que
VRQWQRWDPPHQWOHVSDUHQWV&¶HVWXQpWDWDSSULVHWLPLWp&HVRQWFHVPrPHVUqJOHVTXHO¶RQYDDSSOLTXHUjO¶pWDWDGXOWHHWsouvent transmettre de
génération en génération.

Adulte le comportement parental est facilement identifiable. Il se manifeste dans les situations où la personne est investie G¶XQSRXYRLUSDUHQWDORX
G¶DXWRULWpORUVTX¶LOVHVHQWFRQVHLOJXLGHRXSURWHFWHXUG¶DXWUXL,OVHWUDGXLWSDUGHVSKUDVHVWRXWHVIDLWHVGHVDIILUPDWLRQVGpILQLWLYHVGHVJpQpUDOLWpV
des vérités premières, sans démonstration et sans preuve : « Les femmes», «les hommes», «les étranger», «la famille», «il faut», «toujours», «jamais»,

1.1.5 Adulte (le réfléchi)


&¶HVWO¶pWDWTXLVHFRQVWUXLWOHSOXVWDUGLYHPHQW/¶HQIDQWDXFRQWDFWGXPRQGHHWGHVSDUHQWVDSSUHQGjUDLVRQQHUjVWUXcturer sa penser, il perçoit les
causalités des choses et vérifLHOHVHIIHWVGHVHVDFWHV/¶DGXOWHREVHUYHV¶LQIRUPHUpIOpFKLWHWSUHQGGHVGpFLVLRQVDYHFPpWKRGHDXYXGHVGLIIpUHQWV
éléments dont il dispose.

,OHVWOHVHXOpWDWVXVFHSWLEOHG¶pYROXHUPrPHWDUGLYHPHQWHVWGHSUHQGUHOHGHVVXVDYHFOHWHPSVHWGH la volonté sur les deux autres états du moi.

/HWUDYDLOHQ$7FRQVLVWHjGpEUDQFKHUOHVpWDWV3DUHQWVHW(QIDQWVSRXUSHUPHWWUHjO¶$GXOWHGHV¶H[SULPHU
&¶HVWDORUVTXHO¶$GXOWHSRXUUDODLVVHUTXDQGLOOHVRXKDLWHOHVpWDWV3DUHQWVHW(QIDQWV¶H[SULPHr.

1.2 Les relations entre les différents états du moi


Les trois états se développent chronologiquement, puis coexistent en nous. Ils peuvent avoir des relations harmonieuses. Mais LODUULYHTX¶XQpWDWSUHQQH
la siWXDWLRQHQPDLQ/RUVTX¶LOV¶DJLWGHO¶$GXOWHF¶HVWHQJpQpUDOODSOXVVDWLVIDLVDQWH0DLVLODUULYHTXHFHVRLWOHSOXVDSWH à faire face à la situation et
FHSHXWrWUHO¶(QIDQWRXOH3DUHQW
Exemple 8QHSHUVRQQHPHIDLWXQUHSURFKH !MHQ¶RVHSDVPHMustifier ou alors je me justifie par des mensonges (état enfant). Je fais un reproche à
TXHOTX¶XQ !MHQHOHODLVVHSDVVHMXVWLILHUHWQHFKHUFKHSDVjVDYRLUOHVFDXVHVGXSUREOqPH pWDWSDUHQW
3DUIRLVOH3DUHQWSROOXHO¶$GXOWH'DQVQRWUHIDPLOOHRQDWRXMRXUVFXLVLQpDXEHXUUHHWV¶HVW bon pour la santé car etc. (,O\DUHPLVHHQFDXVHG¶XQH
habitude familiale)
3DUIRLVO¶(QIDQWSROOXHO¶$GXOWHHQFDVGHGLIILFXOWpODSHUVRQQHFKRLVLHODIXLWHHWMXVWLILHOHVYHUWXVGHFHOOH-ci.
Exemple : Je ne VXSSRUWHSDVODUHODWLRQDYHFPDPqUH !-HSDUVYLYUHDLOOHXUV/DVXSHUVWLWLRQHVWXQHFRQWDPLQDWLRQGHO¶$GXOWHSDUO¶(QIDnt

2 ± Sélectionner le thème : Module (ou un autre si vous le préféré)

- &OLTXHUO¶RQJOHW : Mise en page


- Cliquer le bouton : Thèmes puis glisser la sur les thèmes pour visualiser la
mise en forme correspondante sur le texte en arrière plan
- Cliquer le thème désiré : Module

3 ± Mettre en forme le texte (Voir pages suivantes)

- La mise en page ne pose pas de problèmes particuliers

4 ± Créer la table de matières (Voir pages suivantes)

¾ Paramétrer les titres à placer dans la table


- Sélectionner chaque titre à placer dans la table des matières
- &OLTXHUO¶RXWLO
- Sélectionner le niveau du titre

Corrigé  :  Maîtriser  Office  2010     Page  31  


¾ Créer la table de matières
- Cliquer le lieu où placer la table des matières
- &OLTXHUO¶RXWLO : Table des matières
- Sélectionner le format de la table de matière

5 ± &UpHUO¶LQGH[TXLHVWHQILQGHGRFXPHQW 9RLUSDJHVVXLYDQWHV

¾ Créer une entrée G¶LQGH[


- &OLTXHUO¶RQJOHW : Références
- Sélectionner chaque PRWjSODFHUGDQVO¶LQGH[
- &OLTXHUO¶RXWLO : Entrée +
=> Le mot sélectionné est affiché dans une fenêtreWHOTX¶LODSSDUDLWUD
GDQVO¶LQGH[

- Ajouter éventuellement un capital à la première lettre


- Cliquer le bouton : Marquer
- Cliquer le bouton : Fermer
- 5HFRPPHQFHUDYHFFKDTXHPRWjDIILFKHUGDQVO¶LQGH[
!:RUGDIILFKHOHVFDUDFWqUHVFDFKpVHWHQWUHFURFKHWVOHO¶HQWUpHG¶LQGH[
&HWH[WHQ¶HVWSDVYLVLEOHHQPRGHG¶DIILFKDJHQRUPDO

¾ CréHUO¶LQGH[
- &OLTXHUOHOLHXRFUpHUO¶LQGH[
- &OLTXHUO¶RXWLO :
- Sélectionner le format GHO¶LQGH[
- Activer la case : Aligner les numéros de page à
droite
- Sélectionner le type de points de suite à afficher
- Paramétrer le nombre de colonnes sur lequel
DIILFKHUO¶LQGH[
- Cliquer : OK
- 0HWWUHHQIRUPHO¶LQGH[

7. Imprimer le document
- Cliquer l'outil de la barre Accès rapide

8. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom La PNL

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Maitriser Office 2010
- Saisir le nom du fichier : La PNL
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  32  


Corrigé  :  Maîtriser  Office  2010     Page  33  
Corrigé  :  Maîtriser  Office  2010     Page  34  
Word 2010
Entraînement 12 : modèle Word
Objectifs x Créer et utiliser un modèle
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word

2. Saisir et mettre en forme le document suivant :

¾ Créer un tableau personnalisé


- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO : Tableau et sélectionner dans la grille par
cliqué-glissé 16 lignes par 5 colonnes

¾ Fusionner les cellules


- Sélectionner les cellules à fusionner
- Cliquer-droit la sélection ± Fusionner les cellules

- Saisir les données dans les cellules du tableau

Corrigé  :  Maîtriser  Office  2010     Page  35  


3. Sauvegarder le document dans le dossier Maîtriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom Modèle facture.

- &OLTXHUO¶RQJOHW : Fichier - (QUHJLVWUHUVRXV«


- &OLTXHUO¶RSWLRQ : Modèle Word
- Sélectionner le type : Modèle Word
- 6pOHFWLRQQHUOHFKHPLQG¶DFFqVGXGRVVLHUGHVWLQDWLRQ : Maitriser Office 2010
- Saisir le nom du modèle : Modèle facture
- Cliquer le bouton : Enregistrer

4. Imprimer le document

- Cliquer l'outil de la barre Accès rapide

5. Fermer le modèle de document

5. Créer une facture à partir du modèle créé précédemment, en saisissant les données suivantes :

Destinataire : Sphinx SA - 34 rue du Solliet - 26000 Valence


date facture : 15/10/2008
N° facture : 100
Référence Désignation PU Quantité
ASUS100 Micro ordinateur portable ASUS 100 ¼ 1
HP C6180 Imprimante multifonction HP C6180 ¼ 1

- Cliquer le bouton Office


- Cliquer : 1RXYHDX«
- Sélectionner dans la zone GHJDXFKHO¶RSWLRQ Mes Modèles«(Pour FUpHUXQGRFXPHQWjSDUWLUG¶XQ
modèle personnel sauvegardé dans le dossier Templates)
- Cliquer le modèle de document à utiliser
- Cliquer : OK

6. Sauvegarder le document dans le dossier Maîtriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom Facture 100.

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Maîtriser Office 2010
- Saisir le nom du fichier : Facture 100
- Cliquer le bouton : Enregistrer

7. Imprimer la facture

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  36  


Corrigé  :  Maîtriser  Office  2010     Page  37  
Word 2010 ± Entrainement
Dossier 13 : Formulaires Word
x Créer et utiliser un formulaire
Objectifs
x Saisir et corriger un texte
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word

2. Saisir et mettre en forme le formulaire suivant :

¾ $FWLYHUO¶RQJOHW'pYHORSSHXU
- Onglet : Fichier - Options au bas de la fenêtre
- Cliquer : Personnaliser le ruban dans le volet droit
- Activer la case : Développeur

- Cliquez : OK
- &OLTXHUO¶RQJOHW : Développeur
=> /¶RQJOHWDIILFKHOHVRXWLOVGHFUpDWLRQGHIRUPXODLUH :

¾ Créer le premier tableau dans lequel placer les contrôles de formulaire


- Cliquer O¶RQJOHW : Insertion
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO : Tableau et sélectionner dans la grille par
cliqué-glissé 5 lignes par 2 colonnes

¾ Fusionner les cellules de droite des 4 dernières lignes


- Sélectionner les cellules à fusionner
- Cliquer-droit la sélection ± Fusionner les cellules

- Saisir les textes fixes dans les cellules du tableau

¾ Créer le deuxième tableau dans lesquels placer les contrôles de formulaire


- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO : Tableau et sélectionner dans la grille par
cliqué-glissé 6 lignes par 2 colonnes

Corrigé  :  Maîtriser  Office  2010     Page  38  


- Saisir les textes fixes dans les
cellules du tableau

¾ Saisir les champs de formulaire


- Cliquer l'onglet : Développeur
- $FWLYHUO¶RXWLO
- Cliquez le lieu où placer le contrôle
- &OLTXH]VXUO¶RXWLO : Texte enrichi ou Texte .
- Cliquer dans le contrôle et modifier éventuellement le texte affiché dans le contrôle avant la saisie
- 'pVDFWLYHUO¶RXWLO
- &OLTXH]OHFRQWU{OHSXLVO¶RXWLO
- Saisir éventuellement le titre qui sera affiché au dessus du contrôle

- Saisir éventuellement les balises qui encadreront le contrôle


- cliquer la case : Utiliser un style pour mettre le contenu en forme puis sélectionner le style utilisé pour
afficher le contenu du contrôle
- Pour interdire la suppression du contrôle, activer la case : Ne pas supprimer le contrôle du contenu
- Pour interdire la modification du contenu du contrôle activer la case : Ne pas modifier le contenu
- Cliquer : OK

Corrigé  :  Maîtriser  Office  2010     Page  39  


3. Enregistrer ce document dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom Formulaire matériel.

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Formulaire matériel
- Cliquer le bouton : Enregistrer

4. Imprimer le formulaire vierge

- Cliquer l'outil de la barre Accès rapide

5. Saisir les données suivantes dans le formulaire


x Référence : V2007-01
x Désignation : Volvo RDE 485
x Date : 12/06/2008
x Numéro de série : 015678/2008
x Raison sociale : Volvo Truck Marseille 248 rue du Merle 13000 Marseille
x Tél : 06 75 48 58 69
x Mel : Truck@volvomarseille.fr
x 3UL[G¶DFKDW77& ¼
x TVA : 11 760 e
x Prix HT 60 ¼

6. Imprimer le formulaire

- Cliquer l'outil de la barre Accès rapide

7. Enregistrer ce document dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom Formulaire matériel.

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Formulaire VOLVO RDE 486
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  40  


Word 2010 ± Entraînement
Dossier 14 : Graphique Word
Objectifs x Paramétrer des tableaux et des graphiques
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Word

2. Saisir et mettre en forme le document suivant :

- Saisir et mettre en forme les textes du document hors tableaux et graphiques

¾ Créer le 1er tableau


- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO :
Tableau et sélectionner dans la grille
par cliqué-glissé 7 lignes par 4
colonnes

¾ Fusionner les cellules de la


1er ligne
- Sélectionner les cellules à fusionner
- Cliquer-droit la sélection ± Fusionner
les cellules

- Saisir les données dans les cellules


du tableau

¾ Créer le 2e tableau
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO :
Tableau et sélectionner dans la grille
par cliqué-glissé 7 lignes par 3
colonnes

¾ Fusionner les cellules de la


1er ligne
- Sélectionner les cellules à fusionner
- Cliquer-droit la sélection ± Fusionner les cellules

- Saisir les données dans les cellules du tableau

- Créer le premier graphique

¾ Créer un graphique
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RXWLO : Graphique
- Cliquer le type de graphique (à gauche) puis le sous type (à droite) à créer
er
- Remplacer les données du tableau prédéfini par les données du 1 tableau

Corrigé  :  Maîtriser  Office  2010     Page  41  


¾ Modifier le type du graphique
- &OLTXHUO¶RQJOHW : Création de la zone : Outils graphique
- &OLTXHUO¶RXWLO : Modifier le type de graphique
- Cliquer le type de graphique à gauche, puis le sous-type à droite

- Créer le deuxième graphique

¾ Créer un graphique
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RXWLO : Graphique
- Cliquer le type de graphique (à gauche) puis le sous-type (à droite) à créer
e
- Remplacer les données du tableau prédéfini par les données du 2 tableau

¾ Modifier le type du graphique


- &OLTXHUO¶RQJOHW : Création de la zone : Outils graphique
- &OLTXHUO¶RXWLO : Modifier le type de graphique
- Cliquer le type de graphique à gauche, puis le sous type à droite

3. Imprimer le document

- Cliquer l'outil de la
barre Accès rapide

4. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom Bilan social 2012.

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Bilan social 2012
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  42  


Word 2010 ± Entraînement
Dossier 15 : Publipostage
x Paramétrer la page
Objectifs
x Saisir et corriger un texte
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Excel puis saisir et mettre en forme le fichier clients suivant :

- Saisir les données dans les cellules du tableau

2. Imprimer le fichier

- Cliquer l'outil de la barre Accès rapide

3. Sauvegarder le document dans le dossier Maîtriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom Fichier clients.

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Fichier client
- Cliquer le bouton : Enregistrer

4. Ouvrir Word puis saisir et mettre en forme la lettre type suivante en insérant les champs de fusion à
partir du fichier clients conçu sous Excel précédemment :

¾ Créer la matrice
- &OLTXHUO¶RQJOHW : Publipostage de Word
- &OLTXHUO¶RXWLO : Démarrer la fusion et le publipostage
- Cliquer l'option : Lettres

¾ Sélectionner les destinataires


- &OLTXHUO¶RXWLO : Sélection des destinataires
- &OLTXHUO¶RSWLRQ8WLOLVHUODOLVWHH[LVWDQWH«
- Sélectionner l'unité, le dossier puis le fichier Excel ou Access source
- Cliquer le bouton : Ouvrir
- Cliquer la feuille Excel ou la table
- Cliquer : OK

Corrigé  :  Maîtriser  Office  2010     Page  43  


Champs de fusion

Texte conditionnelle

- Cliquer dans la lettre le lieu où placer un champ de fusion


- Cliquer le bas de l'outil : Insérer un champ de fusion puis cliquer le champ à insérer
- Recommencer pour tous les champs à Insérer

- Mettre en forme la lettre et les champs de fusion puis insérer des espaces entre les noms de champs

5. Imprimer le document

- Cliquer l'outil de la barre Accès rapide

6. Envoyer les lettres uniquement aux clients de LYON ou GRENOBLE dont le CA est > à 1 ¼

- &OLTXHUO¶RXWLO : Modifier la liste de destinataires


- COLTXHUOHERXWRQGpURXODQWG¶XQFKDPS puis cliquer le bouton : (Avancées...)
- Sélectionner le champ : Ville
- Sélectionner l'élément de comparaison : Egal à
- Saisir le texte sur lequel porte la condition : LYON
- Sélectionner la relation : Ou
- Sélectionner le champ : Ville
- Sélectionner l'élément de comparaison : Egal à
- Saisir le texte sur lequel porte la condition : GRENOBLE
- Sélectionner la relation : ET
- Sélectionner le champ : CA
- Sélectionner l'élément de comparaison : Supérieur à
- Saisir la valeur : 1000
- Cliquer : OK
=> La fenêtre affiche les enregistrements filtrés.
- Cliquer : OK

Corrigé  :  Maîtriser  Office  2010     Page  44  


7. Imprimer les lettres types

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  45  


8. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou
de la clé USB sous le nom : Publipostage paypal

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Maitriser Office 2010
- Saisir le nom du fichier : Publipostage paypal
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  46  


Excel 2010 ± Entraînement
Dossier 16 FUpDWLRQG¶XQWDEOHDX
Objectifs x Créer un tableau
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Excel puis saisir le tableau suivant :

- Cliquer le bouton Démarrer ± Tous les programmes ± Microsoft Office


- Cliquer : Microsoft Excel 2010

- Activer la cellule dans laquelle faire la saisie puis


saisir la donnée au clavier (voir ci-dessous)
- Valider par [Entrée] ou cliquer une autre cellule ou

utiliser les touches


([Ctrl] + [Entrée] permet de valider une donnée
sans changer de cellule active).

2. Nommer la feuille (Onglet) : CA Annuel

- Double-FOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : CA Annuel puis valider par [Entrée]

3. Imprimer le tableau

- Cliquer l'outil de la barre Accès rapide

4. Activer une nouvelle feuille par son onglet et saisir la feuille suivante :

- Cliquer l'onglet de la feuille à activer au bas de l'écran : Feuil2

5. Nommer la feuille (Onglet) : CA par poste

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : CA par poste puis valider par [Entrée]

6. Imprimer le tableau

- Cliquer l'outil de la barre Accès rapide

7. Sauvegarder le classeur dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou de
la clé USB sous le nom &KLIIUHG¶DIIDLUHVDQQXHO

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : &KLIIUHG¶DIIDLUHVDQQXHO
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  47  


Excel 2010 ± Entraînement
Dossier 17 : Mise en forme
Objectifs x Créer et mettre en forme un tableau
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Excel puis charger le classeur conçu dans le dossier 17 et sauvegardé sous le nom : Chiffre
G¶DIIDLUHVDQQXHO

- Cliquer le bouton Démarrer ± Tous les programmes ± Microsoft Office


- Cliquer : Excel

¾ Ouvrir un document
- &OLTXHUO¶RXWLO dans la barre Accès rapide
Ou
- Cliquer le bouton Office
- Cliquer : 2XYULU«
- Sélectionner l'unité puis le dossier source
- Cliquer le nom du fichier à charger : &KLIIUHG¶DIIDLUHVDQQXHO
- Cliquer le bouton : Ouvrir

2. Activer la feuille CA Annuel et mettre en forme le tableau de la façon suivante :

- Cliquer l'onglet de la feuille à activer au bas de l'écran : CA Annuel


re
-1 ligne

¾ Fusionner les cellules de la 1re ligne


re
- Sélectionner les cellules sur de la 1 ligne de A1 à D1
- Cliquer l'outil RXFOLTXHUOHERXWRQGpURXODQWGHO¶RXWLOSXLVO¶RSWLRQGpVLUpH : Fusionner et
centrer

- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner les cellules fusionnées
- &OLTXHUO¶RXWLOGHPLVHHQIRUPHGpVLUpRXOHERXWRQGpURXODQWGHO¶RXWLOHW
VpOHFWLRQQHUO¶RSWLon désirée

e
-2 ligne
- Sélectionner les cellules A2 à D2

¾ Incliner les données


- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO puis cliquer
O¶RULHQWDWLRQGpVLUpH
Ou
- COLTXHUO¶RSWLRQ : Format de cellule - Alignement puis
SDUDPpWUHUO¶LQFOLQDLVRQGpVLUpH

- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner les cellules fusionnées
- &OLTXHUO¶RXWLOGHPLVHHQIRUPHGpVLUpRXOHERXWRQGpURXODQWGHO¶RXWLOHW
sélectionner les options désirées

¾ Appliquer une trame de fond à des cellules (Remplissage)


- Sélectionner la ou les cellules à traiter
- Cliquer le bouton déroulant de l'outil : Remplissage
- &OLTXHUODFRXOHXUGpVLUpHRXFOLTXHUO¶RSWLRQ : $XWUHVFRXOHXUV« SRXUGLVSRVHUG¶XQ
choix plus important

Corrigé  :  Maîtriser  Office  2010     Page  48  


¾ Tracer une bordure ou un encadrement
- Sélectionner les cellules A1 à D14 le long desquelles tracer une bordure
- &OLTXHUO¶RQJOHW Accueil
- Cliquer le bouton déroulant de l'outil : Bordure puis cliquer la bordure désirée
dans la liste affichée

¾ Format nombre, date, heure


- Sélectionner la ou les cellules à traiter : B3 à D14
- &OLTXHUO¶RQJOHW : Accueil
- Dans la zone : Nombre, cliquer le bouton déroulant des formats puis le format : Monétaire dans la liste au-
dessous
- Modifier éventuellement le format par les outils de la zone : Nombre
Pourcent Séparateur Décimal +
Monétaire Décimal -

3. ,PSULPHUOHWDEOHDXHQDMRXWDQWYRWUHQRPODGDWHHWOHQRPGXILFKLHUGDQVO¶HQ-tête

¾ En-tête et pied de page


- &OLTXHUO¶RQJOHWInsertion
$IILFKHUO¶HQ-tête ou le pied de page
- &OLTXHUO¶RXWLOEn-tête et pied de page

=> Le ruban : Outils des en-têtes et pieds de page HVWDFWLYpHWO¶DIILFKDJHSDVVHHQPRGH : Mise en page

$MRXWHUGHVpOpPHQWVGDQVO¶HQ-tête ou le pied de page


- $FWLYHUO¶HQ-tête ou le pied de page
- Cliquer dans la zone où insérer un élément

- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjO¶pOpPHQWjSODFHU
- Saisir éventuellement du texte au clavier pour séparer des éléments

0HWWUHHQIRUPHO¶HQ-tête ou le pied de page


- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner le texte à traiter puis le mettre en forPHFRPPHG¶DXWUHVWH[WHV

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  49  


4. Activer la feuille CA par poste et mettre en forme le tableau de la façon suivante :

- Cliquer l'onglet de la feuille à activer au bas de l'écran : CA par poste

¾ Fusionner les cellules de la 1re ligne


re
- Sélectionner les cellules sur de la 1 ligne de A1 à B1
- Cliquer l'outil RXFOLTXHUOHERXWRQGpURXODQWGHO¶RXWLOSXLVO¶RSWLRQGpVLUpH : Fusionner et
centrer

- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner les cellules fusionnées
- &OLTXHUO¶RXWLOGHPLVHHQIRUPHGpVLUpRXOHERXWRQGpURXODQWGHO¶RXWLOHW
VpOHFWLRQQHUO¶RSWLRQGpVLUpH

e
-2 ligne
- Sélectionner les cellules A2 à B2

- &OLTXHUO¶RQJOHW : Accueil
- Sélectionner les cellules fusionnées
- &OLTXHUO¶RXWLOGHPLVHHQIRUPHGpVLUpRXOHERXWRQGpURXODQWGHO¶RXWLOHW
sélectionner les options désirées

¾ Appliquer une trame de fond à des cellules (Remplissage)


- Sélectionner les cellules à traiter : A1 à B2
- Cliquer le bouton déroulant de l'outil : Remplissage
- &OLTXHUODFRXOHXUGpVLUpHRXFOLTXHUO¶RSWLRQ : $XWUHVFRXOHXUV« SRXUGLVSRVHUG¶XQ
choix plus important

¾ Tracer une bordure ou un encadrement


- Sélectionner les cellules A1 à B13 le long desquelles tracer une bordure
- &OLTXHUO¶RQJOHW Accueil
- Cliquer le bouton déroulant de l'outil : Bordure puis cliquer la bordure désirée
dans la liste affichée

¾ Format nombre, date, heure


- Sélectionner la ou les cellules à traiter : B3 à B13
- &OLTXHUO¶RQJOHW : Accueil
- Dans la zone : Nombre, cliquer le bouton déroulant des formats puis le format : Monétaire dans la liste au
dessous
- Modifier éventuellement le format par les outils de la zone : Nombre
Pourcent Séparateur Décimal +
Monétaire Décimal -

,PSULPHUOHWDEOHDXHQDMRXWDQWYRWUHQRPODGDWHHWOHQRPGXILFKLHUGDQVO¶HQ-tête

- Cliquer l'outil de la barre Accès rapide

6. Sauvegarder le classeur

- Cliquer l'outil

Corrigé  :  Maîtriser  Office  2010     Page  50  


Excel 2010 ± Entraînement 1
Dossier 18 : Formules de calcul
Objectifs x Programmer des formules de calcul
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

1. Ouvrir Excel et saisir le tableau suivant :

- La saisie et la mise en forme du tableau ne posent pas


de problèmes particuliers

2. Programmer le calcul de la TVA (taux de 19,6 %, ou utiliser le taux en vigueur le jour de la réalisation
de O¶HQWUDLQHPHQW et le calcul du prix de vente TTC

TVA

¾ Saisir le formule de la TVA


- Pointer la cellule D2 qui doit recevoir le résultat et taper =
re
- Pointer la 1 cellule utilisée dans la formule : C2
- 6DLVLUO¶RSpUDWHXUGHODIRUPXOH : *
- Saisir le taux de TVA  RXOHWDX[HQYLJXHXUOHMRXUGHODUpDOLVDWLRQGHO¶HQWUDLQHPHQW 
- Appuyer sur [Entrée] pour valider la formule

¾ Format nombre, date, heure


- Sélectionner la cellule à traiter : D2
- &OLTXHUO¶RQJOHW : Accueil
- Dans la zone : Nombre, cliquer le bouton déroulant des formats puis le format : Monétaire dans la au-
dessous
- Modifier éventuellement le format par les outils de la zone : Nombre
Pourcent Séparateur Décimal +
Monétaire Décimal -

¾ Recopier la formule
- Pointer la cellule D2 à recopier
- Cliquer-glisser le bouton de recopie sur la dernière cellule de la zone destination : D18

PV TTC

¾ Saisir le formule du PV TTC


- Pointer la cellule E2 qui doit recevoir le résultat et taper =
re
- Pointer la 1 cellule utilisée dans la formule : C2
- 6DLVLUO¶RSpUDWHXUGHODIRUPXOH : +
re
- Pointer la 1 cellule utilisée dans la formule : D2
- Appuyer sur [Entrée] pour valider la formule

Corrigé  :  Maîtriser  Office  2010     Page  51  


¾ Format nombre, date, heure
- Sélectionner la cellule à traiter : E2
- &OLTXHUO¶RQJOHW : Accueil
- Dans la zone : Nombre, cliquer le bouton déroulant des formats puis le format : Monétaire dans la liste au
dessous
- Modifier éventuellement le format par les outils de la zone : Nombre
Pourcent Séparateur Décimal +
Monétaire Décimal -

¾ Recopier la formule
- Pointer la cellule E2 à recopier
- Cliquer-glisser le bouton de recopie sur la dernière cellule de la zone destination : E18

3. Nommer la feuille Fichier articles

- Double-FOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : Fichier articles puis valider par [Entrée]

4. Imprimer la feuille et les formules de calcul

- Cliquer l'outil de la barre Accès rapide

- &OLTXHUO¶RQJOHWFormules
- &OLTXHUO¶RXWLO
- Cliquer l'outil de la barre Accès rapide
- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHU les résultats

Corrigé  :  Maîtriser  Office  2010     Page  52  


5. Sauvegarder le classeur dans le dossier Maîtriser Office 2010 du serveur, du dossier Document ou de
la clé USB sous le nom Facturation

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : Facturation
- Cliquer le bouton : Enregistrer

6. Activer une nouvelle feuille par son onglet et saisir la facture suivante :

- Cliquer l'onglet de la feuille à activer au bas de l'écran : Feuil2

- La saisie et la mise en forme du tableau ne posent


SDVGHSUREOqPHVSDUWLFXOLHUV/¶LQVHUWLRQGX&OLpArt
est étudiée ci-dessous. (Vous pouvez utiliser une
autre image)

¾ Insérer un clipart
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RXWLO : Images Clipart...
- Cliquer dans la zone : Rechercher et saisir le nom
du clipart recherché
- Cliquer : OK
- Cliquer au dessous le clipart à insérer
- &OLTXHUJOLVVHUO¶LPDJHGDQVO¶DQJOH
Cliqué glissé une poignée de taille pour en modifier
la taille

7. Nommer cette feuille Facture

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : Facture puis valider par [Entrée]

8. Programmer toutes les formules de calcul


Attention :
x Désignation et PU sont copiés à partir de la feuille Fichier articles par une fonction RECHERCHE
x Taux de remise
Brut < 1000 = 0%
1000 < Brut > 2000 = 5 %
Brut > 2000 = 10 %

9. Imprimer la facture vierge et les formules de calcul

- Cliquer l'outil de la barre Accès rapide

- &OLTXHUO¶RQJOHWFormules
- &OLTXHUO¶RXWLO
- Cliquer l'outil de la barre Accès rapide
- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHUOHVUpVXOWDWV

Corrigé  :  Maîtriser  Office  2010     Page  53  


10. Copier la facture sur une nouvelle feuille et la nommer Facture001

- &OLTXpJOLVVpOµRQJOHWGHODIHXLOOHHQDSSX\DQWVXU[Ctrl] Référence Quantité


- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU DIM9400   1  
- Saisir le nom de la feuille : Facture 1 puis valider par [Entrée] MVISTA   1  
MOPRO   1  

11. Tester la facture avec la commande suivante :


Destinataire :
Société AZURAL, 85 route des Creuses, 38000 GRENOBLE
'DWHOHMRXUGHO¶H[HUFLFH
N° Facture : 001

12. Imprimer la facture

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  54  


Excel 2010 ± Entrainement 2
Dossier 18 : Formules de calcul
Objectifs x Programmer des formules de calcul financières
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

 2XYULU ([FHO SXLV VDLVLU HW SURJUDPPHU OH WDEOHDX G¶DPRUWLVVHPHQW OLQpDLUH G¶XQH LPPRELOLVDWLRQ
suivant qui concerne O¶DFKDWG¶XQYpKLFXOHXWLOLWDLUH :

2. Nommer la feuille (Onglet) : Amortissement linéaire

- Double-FOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : Amortissement linéaire puis valider par [Entrée]

3. Imprimer le tableau puis imprimer les formules de calcul

- &OLTXHUO¶RXWLO
- Cliquer l'outil de la barre Accès rapide
- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHUOHVUpVXOWDWV
- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  55  


4. Activer une nouvelle feuille par VRQ RQJOHW SXLV VDLVLU HW SURJUDPPHU OH WDEOHDX G¶DPRUWLVVHPHQW
G¶HPSUXQW VXLYDQW TXL FRQFHUQH O¶DFKDW GX YpKLFXOH XWLOLWDLUH GRQW OH WDEOHDX G¶DPRUWLVVHPHQW D pWp
réalisé ci-dessus :

5. Nommer la feuille (Onglet) : Emprunt

- Double FOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : Emprunt puis valider par [Entrée]

6. Imprimer le tableau puis imprimer les formules de calcul

- &OLTXHUO¶RQJOHWFormules
- &OLTXHUO¶RXWLO

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  56  


- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHUOHVUpVXOWDWV

- Cliquer l'outil de la barre Accès rapide

7. Sauvegarder le classeur dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou de
la clé USB sous le nom Fiat Combo

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : Facturation
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  57  


Excel 2010 ± Entraînement
Dossier 19 : Grapheur
Objectifs x Programmer des formules de calcul
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

2XYULU([FHOHWFKDUJHUOHWDEOHDX&KLIIUHG¶DIIDLUHVDQQXHOUpDOLVpDXFRXUVGXGRVVLHU18

2. Activer la feuille CA Annuel

- Cliquer O¶RQJOHWGHODIHXLOOHCA Annuel

&RQFHYRLUHWPHWWUHHQIRUPHOHO¶KLVWRJUDPPH'
suivant au-dessous du tableau

¾ Sélectionner les données à utiliser


- Sélectionner les séries y compris les titres de colonnes et de
lignes. (Sélectionner des zones discontinues en appuyant sur
[Ctrl])

¾ Tracer le graphique
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer le type de graphe à créer puis cliquer dans
la liste au-dessous la présentation désirée

¾ Modifier la taille du graphique


- Cliquer le graphique puis cliquer-glisser une poignée de taille

¾ Déplacer le graphique
- Cliquer le graphique puis cliquer-glisser la bordure du graphique en dehors des poignées de taille

¾ Modifier la disposition des titres et de la légende


- &OLTXHUO¶RQJOHW : Création
- Cliquer la disposition désirée dans la zone : Dispositions du graphique

¾ Couleur et bordure des aires


- Cliquer-droit O¶DLUHjSDUDPpWUHU
- &OLTXHUO¶RQJOHW : Mise en forme
- Cliquer dans la zone : Style de forme la présentation avec effet
3D prédéfini désiré

¾ 3DUDPpWUHUXQGpJUDGpG¶arrière-plan
- &OLTXHUO¶RQJOHW : Mise en forme
- &OLTXHUO¶pOpPHQWGXJUDSKLTXHjWUDLWHU VpULH]RQHGHWUDoDJH]RQH
de graphique, titre etc.)
- &OLTXHUO¶RXWLO - Dégradé
- Cliquer le dégradé désiré
Ou
- &OLTXHUO¶RSWLRQ : 3OXVGHGpJUDGpV«et paramétrer le dégradé désiré
puis cliquer le bouton : Fermer

Corrigé  :  Maîtriser  Office  2010     Page  58  


4. Imprimer le graphique seul puis sur la même feuille le tableau et le graphique

- Cliquer le graphique
- Cliquer l'outil de la barre Accès rapide

- Cliquer le tableau
- Cliquer l'outil de la barre Accès rapide

5. Activer la feuille CA Annuel

- &OLTXHUO¶RQJOHWGHODIHXLOOHCA Annuel

6. Concevoir et mettre en forme le graphique secteur 3D suivant au-dessous du tableau

¾ Sélectionner les données à utiliser


- Sélectionner les séries y compris les titres de colonnes et
de lignes. (Sélectionner des zones discontinues en
appuyant sur [Ctrl])

¾ Tracer le graphique
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer le type de graphe à créer puis cliquer dans
la liste au-dessous la présentation désirée

¾ Modifier la taille du graphique


- Cliquer le graphique puis cliquer-glisser une poignée de taille

¾ Déplacer le graphique
- Cliquer le graphique puis cliquer-glisser la bordure du graphique en dehors des poignées de taille

¾ Légende
- &OLTXHUO¶RQJOHW : Disposition
- &OLTXHUO¶RXWLO : Légende
- &OLTXHUO¶RSWLRQ : Aucune

¾ Etiquettes de données
Ajouter des étiquettes de données
- Cliquer-droit la série pour laquelle afficher les étiquettes
- Cliquer : Ajouter des étiquettes de données
Ou
- &OLTXHUO¶RQJOHW : Disposition
- &OLTXHUO¶RXWLO : Etiquettes de données SXLVO¶RSWLRQGpVLUpH
Paramétrer les étiquettes
- Cliquer-droit les étiquettes à paramétrer
- Cliquer : 0LVHHQIRUPHGHVpWLTXHWWHVGHGRQQpHV«
- 3DUDPpWUHUOHW\SHG¶pWLTXHWWHV
- Sélectionner la position des étiquettes
- Cliquer : Fermer

Corrigé  :  Maîtriser  Office  2010     Page  59  


¾ 3DUDPpWUHUXQGpJUDGpG¶DUULqUHSODQ
- &OLTXHUO¶RQJOHW : Mise en forme
- &OLTXHUO¶pOpPHQWGXJUDSKLTXHjWUDLWHU VpULH]RQHGHWUDoDJH]RQH
de graphique, titre etc.)
- &OLTXHUO¶RXWLO - Dégradé
- Cliquer le dégradé désiré
Ou
- &OLTXHUO¶RSWLRQ : 3OXVGHGpJUDGpV«et paramétrer le dégradé désiré
puis cliquer le bouton : Fermer

7. Imprimer sur la même feuille le tableau et le graphique

- Cliquer le graphique
- Cliquer l'outil de la barre Accès rapide

- Cliquer le tableau
- Cliquer l'outil de la barre Accès rapide

8. Activer une feuille vierge et saisir le tableau suivant :

-La saisie et la mise en forme du


tableau ne pose pas de problèmes.

&RQFHYRLUHWPHWWUHHQIRUPHOHO¶KLVWRJUDPPH'VXLYDQWHQLQVpUDQWXQHLPDJHHQDUULqUHSODQet en
représentant des textures dans les séries

¾ Sélectionner les données à utiliser


- Sélectionner les séries y compris les titres de colonnes et de
lignes. (Sélectionner des zones discontinues en appuyant sur
[Ctrl])

¾ Tracer le graphique
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer le type de graphe à créer puis cliquer dans
la liste au-dessous la présentation désirée

¾ Modifier la taille du graphique


- Cliquer le graphique puis cliquer-glisser une poignée de taille

¾ Déplacer le graphique
- Cliquer le graphique puis cliquer-glisser la bordure du graphique en dehors des poignées de taille

¾ Légende
- &OLTXHUO¶RQJOHW : Disposition
- &OLTXHUO¶RXWLO : Légende
- &OLTXHUO¶RSWLRQ : Aucune

Corrigé  :  Maîtriser  Office  2010     Page  60  


¾ Couleur et bordure des aires
- Cliquer-GURLWODO¶DLUHjSDUDPpWUHU
- &OLTXHUO¶RQJOHW : Mise en forme
- Cliquer dans la zone : Style de forme la présentation avec effet
3D prédéfinie désirée

¾ ,QVpUHUO¶LPDJH en arrière plan


- &OLTXHUO¶RQJOHW : Mise en forme
- &OLTXHUO¶pOpPHQWGXgraphique : zone de graphique dans lequel insérer une image
- &OLTXHUO¶RXWLO - ,PDJH«
- 2XYULUOHGRVVLHUSXLVFOLTXHUO¶LPDJHGpVLUpH
- Cliquer le bouton : Insérer

10. Imprimer le graphique seul

-Cliquer le graphique
- Cliquer l'outil de la barre Accès rapide

11. Sauvegarder le classeur

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : Facturation
- Sélectionner le type de fichier
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  61  


Excel 2010 ± Entraînement 1
Dossier 20 : Tableau et base de données
Objectifs x Programmer des formules de calcul
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

¾ Travail à faire :
1. Charger Excel puis saisir et mettre en forme le tableau de données suivant :

- La saisie et la mise en forme ne pose aucune difficultés

2. Nommer la feuille (Onglet) : Fichier salariés

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHjUHQRPPHU
- Saisir le nom de la feuille : Fichier salariés puis valider par [Entrée]

3. Afficher une ligne de statistiques au bas du tableau et afficher le salaire total

- 3URJUDPPHUXQHIRQFWLRQVWDWLVWLTXHVXUODGHUQLqUHOLJQHG¶XQHFRORQQH VRPPHRXDXWUHV«
- Cliquer le bouton déroulant qui est à droite de la cellule pour afficher une autre statistique
- Cliquer la statistique souhaitée

Corrigé  :  Maîtriser  Office  2010     Page  62  


4. Imprimer le tableau de données

- Cliquer l'outil de la barre Accès rapide

4. Filtres
- Filtrer les habitants de Lyon

- Cliquer le bouton déroulant du champ à filtrer


- 'pVDFWLYHUO¶RSWLRQ(Sélectionner tout)
- Cliquer la donnée recherchée : LYON
- Cliquer : OK
- Cliquer l'outil de la barre Accès rapide

- Filtrer et imprimer les Cadres et les Agents de maîtrise

- Cliquer le bouton déroulant du champ : Statut


- &OLTXHUO¶RSWLRQ : Filtres textuels
- 6pOHFWLRQQHUO¶RSWLRQEst égal à
- Dans la boîte de dialogue Filtre automatique personnalisé, paramétrer les critères de filtrage
- Saisir la donnée recherchée : Cadre
- Sélectionner : Ou
- 6pOHFWLRQQHUO¶RSWLRQEst égal à
- Saisir la donnée recherchée : Agent de maîtrise
- Cliquer : OK

- Cliquer l'outil de la barre Accès rapide

- Filtrer et imprimer les OS et les OP

- Cliquer le bouton déroulant du champ : Statut


- &OLTXHUO¶RSWLRQ : Filtres textuels
- 6pOHFWLRQQHUO¶RSWLRQjDSSOLTXHUGDQVODOLVWHGpURXODQWHjGURLWHGXPHQX : Est égal à
- Dans la boîte de dialogue Filtre automatique personnalisé, paramétrer les critères de filtrage
- Saisir la donnée recherchée : OS
- Sélectionner : Ou
- 6pOHFWLRQQHUO¶RSWLRQEst égal à
- Saisir la donnée recherchée : OP
- Cliquer : OK

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  63  


- Filtrer et imprimer les Responsables GRQWO¶DUULqUHSODQHVWMDXQH

- Cliquer le bouton déroulant du champ : Responsable


- &OLTXHUO¶RSWLRQ : Filtrer par couleur
- Cliquer la couleur Jaune dans la liste affichée à droite

- Cliquer l'outil de la barre Accès rapide

5. Tri
- Trier et imprimer la base de données sur le salaire classé par ordre décroissant

- &OLTXHUO¶RQJOHW : Données
- Cliquer la colonne : Salaire

- Cliquer le bouton
- Cliquer l'outil de la barre Accès rapide

6. Totaux et sous totaux


- Désactiver le tableau de données

- &OLTXHUO¶RQJOHW : Création

- &OLTXHUO¶RXWLO
- Cliquer : Oui dans la fenêtre de confirmation

- Trier le tableau sur le statut et afficher les totaux et sous totaux


¾ Trier les données
- &OLTXHUO¶RQJOHW : Données
- Cliquer la colonne : Statut
- Cliquer le bouton

Corrigé  :  Maîtriser  Office  2010     Page  64  


¾ Afficher les totaux et sous totaux
- &OLTXHUO¶RQJOHW : Données
- &OLTXHUXQHFHOOXOHGHODOLVWHGHGRQQpHVSXLVFOLTXHUO¶RXWLO : Sous Total
- Zone : A chaque changement de : sélectionner le critère Statut
- Zone : Utiliser la fonction : sélectionner le type de calcul à réaliser : Somme
- Zone : Ajouter un sous total à : cliquer les cases du champ : Salaire pour lesquels calculer un sous total
- Cliquer : OK

- Imprimer le tableau

- Cliquer l'outil de la barre Accès rapide

7. Sauvegarder le classeur dans le dossier Maitriser Office 2010 du serveur, du dossier Document ou de
la clé USB sous le nom Fichier salariés

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : Fichier salariés
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  65  


Excel 2010 ± Entraînement 2
Dossier 21 : Tableau et graphique croisés dynamique
Objectifs x Programmer des formules de calcul
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

¾ Travail à faire :
1. Charger Excel puis saisir et mettre en forme le tableau de données suivant :

2. Nommer la feuille (Onglet) : CA par magasin

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHHWODQRPPHU : CA par magasin

3. Créer et imprimer le tableau croisé dynamique et le


graphique croisé dynamique suivants :

¾ Tableau croisé dynamique


- Cliquer O¶RQJOHWInsertion
- Sélectionner le tableau de données par cliqué-glissé en incluant les titres de colonnes mais sans la ligne de
statistiques éventuelle : A1 à F25
- &OLTXHUO¶RXWLO : Tableau croisé dynamique
- &OLTXHUO¶RSWLRQ : Nouvelle feuille de calcul
- Cliquer : OK

Corrigé  :  Maîtriser  Office  2010     Page  66  


- Paramétrer les données de la façon suivante :

- Cliquer l'outil de la barre Accès rapide

Corrigé  :  Maîtriser  Office  2010     Page  67  


¾ Graphique croisé dynamique
- &OLTXHU O¶RQJOHW : Options des Outils de tableau croisé
dynamique
- &OLTXHUO¶RXWLO
- Cliquer le type de graphique désiré
=> Paramétrer les fenêtres de la façon suivantes :

- Cliquer l'outil de la barre Accès rapide

4. Sauvegarder le classeur dans le dossier Maîtriser Office 2010 du serveur, du dossier Document ou de
la clé USB sous le nom Tableau croisé CA semestre

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : Tableau croisé CA semestre
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  68  


Excel 2010 ± Entraînement
Dossier 21 ± Feuilles liées et consolidées
x Lier des feuilles de données
Objectifs
x Consolider des feuilles de données
Durée ¶
Support Clé USB ou espace personnel sur le serveur ou le disque dur

¾ Travail à faire :
1. Charger Excel puis saisir et mettre en forme les quatre tableaux suivants sur quatre feuilles différentes dans un
même classeur :

2. Nommer chaque feuille en utilisant le titre des tableaux

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHTXLFRQWLHQW les données de Lyon


- Saisir le nom de la feuille : CA Lyon puis valider par [Entrée]

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHTXLFRQWLHQWOHVGRQQpHVGH Grenoble
- Saisir le nom de la feuille : CA Grenoble puis valider par [Entrée]

- Double cliquer O¶RQJOHWGHODIHXLOOHTXLFRQWLHQWOHVGRQQpHVGH Valence


- Saisir le nom de la feuille : CA Valence puis valider par [Entrée]

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOHTXLFRQWLHQWOHVGRQQpHVGH Villeurbanne
- Saisir le nom de la feuille : CA Villeurbanne puis valider par [Entrée]

Feuilles liées
3. Concevoir le tableau de synthèse suivant et le lier aux quatre feuilles précédentes afin que les totaux
de lignes de chaque feuille apparaissent avec une liaison dans la feuille de synthèse.

-Saisir et mettre en forme le tableau suivant sur une


nouvelle feuille:

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOH
- Saisir le nom de la feuille : CA récapitulatif puis valider par [Entrée]

Corrigé  :  Maîtriser  Office  2010     Page  69  


Feuille Grenoble
- Activer la feuille source : CA Grenoble
- Sélectionner les cellules F3 à F8
- &OLTXHUO¶RXWLORX[Ctrl] [C] ou cliquer-droit - Copier
- Activer la feuille destination (par son onglet)
- Cliquer-droit la cellule B3 de la zone où afficher le contenu de la feuille source - Collage spécial...
- Cliquer le bouton : Coller avec liaison

Feuille Lyon
- Activer la feuille source : CA Lyon
- Sélectionner les cellules F3 à F8
- &OLTXHUO¶RXWLORX[Ctrl] [C] ou cliquer-droit - Copier
- Activer la feuille destination (par son onglet)
- Cliquer-droit la cellule C3 de la zone où afficher le contenu de la feuille source - Collage spécial...
- Cliquer le bouton : Coller avec liaison

Feuille Valence
- Activer la feuille source : CA Valence
- Sélectionner les cellules F3 à F8
- &OLTXHUO¶RXWLORX[Ctrl] [C] ou cliquer-droit - Copier
- Activer la feuille destination (par son onglet)
- Cliquer-droit la cellule D3 de la zone où afficher le contenu de la feuille source - Collage spécial...
- Cliquer le bouton : Coller avec liaison

Feuille Villeurbanne
- Activer la feuille source : CA Villeurbanne
- Sélectionner les cellules F3 à F8
- &OLTXHUO¶RXWLORX[Ctrl] [C] ou cliquer-droit - Copier
- Activer la feuille destination (par son onglet)
- Cliquer-droit la cellule E3 de la zone où afficher le contenu de la feuille source - Collage spécial...
- Cliquer le bouton : Coller avec liaison

-Cliquer la cellule F3 et saisir la formule : =somme(B3 :E3)


- [Entrée]
- Recopier la formule sur les cellules du bas

4. Imprimer les feuilles sources et la feuille destination puis imprimer les formules de calcul de la feuille
destination

- Cliquer chaque feuille puis cliquer l'outil de la barre Accès rapide

- Cliquer le feuille : CA récapitulatif


- &OLTXHUO¶RQJOHWFormules
- &OLTXHUO¶RXWLO
- Cliquer l'outil de la barre Accès rapide
- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHUOHVUpVXOWDWV

Corrigé  :  Maîtriser  Office  2010     Page  70  


Feuilles consolidées
5. Concevoir le tableau consolidé suivant et consolider les quatre feuilles sources

-Saisir et mettre en forme le tableau suivant sur une


nouvelle feuille:

- 'RXEOHFOLTXHUO¶RQJOHWGHODIHXLOOH
- Saisir le nom de la feuille : CA consolidé puis valider par [Entrée]
- Activer la feuille CA consolidé (par son onglet)
- &OLTXHUO¶RQJOHWDonnées
- Sélectionner la ou les cellules qui doivent recevoir le résultat de la consolidation B3 à E8
- &OLTXHUO¶RXWLO
- Sélectionner la nature du lien de consolidation : Somme
re
- Activer la 1 feuille source (Par son onglet) : CA Grenoble
- Sélectionner la ou les cellules sources : C3 à F8
- Cliquer le bouton : Ajouter
re
- Activer la 1 feuille source (Par son onglet) : CA Lyon
- Sélectionner la ou les cellules sources : C3 à F8
- Cliquer le bouton : Ajouter
re
- Activer la 1 feuille source (Par son onglet) : CA Valence
- Sélectionner la ou les cellules sources : C3 à F8
- Cliquer le bouton : Ajouter
re
- Activer la 1 feuille source (Par son onglet) : CA Villeurbanne
- Sélectionner la ou les cellules sources : C3 à F8
- Cliquer le bouton : Ajouter

- Cliquer la case : Lier aux données source


-Cliquer : OK ou [Entrée]

6. Imprimer la feuille consolidée puis les formules de calcul de la feuille consolidée

- &OLTXHUO¶RQJOHWFormules
- &OLTXHUO¶RXWLO
- Cliquer l'outil de la barre Accès rapide

Ou

Corrigé  :  Maîtriser  Office  2010     Page  71  


- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHUOHVUpVXOWDWV
- Cliquer l'outil de la barre Accès rapide

Ou

7. Sauvegarder le classeur dans le dossier Maîtriser Office 2010 du serveur, du dossier Document ou de
la clé USB sous le nom : CA Consolidé

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : CA Consolidé
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  72  


Excel 2010 ± Entraînement
Dossier 22 ± Valeurs cibles et scénarios
x Déterminer des valeurs cibles et utiliser le solveur
Objectifs
x Elaborer un scénario
Durée 45¶
Support Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Charger Excel

2. Saisir et mettre en forme le tableau suivant :

3. Programmer les formules de calcul suivantes :

Résultat

4. Sauvegarder le classeur sous le nom : CA Prévisionnel

- Cliquer l'outil
- Sélectionner l'unité puis le dossier : Documents
- Saisir le nom du fichier : CA prévisionnel
- Cliquer le bouton : Enregistrer

5. imprimer le tableau et les formules de calcul

- &OLTXHUO¶RXWLO
- &OLTXHUO¶RQJOHWFormules
- &OLTXHUO¶RXWLO
- Cliquer l'outil de la barre Accès rapide
- 5HFRPPHQFHUO¶RSpUDWLRQSRXUDIILFKHUOHVUpVXOWDWV
- &OLTXHUO¶RXWLO

Corrigé  :  Maîtriser  Office  2010     Page  73  


Valeur cible

6. En utilisant la fonction valeur cible, calculer :


- le chiffre d'affaires Création de logiciel 2012 que l'entreprise aurait dû réaliser pour que l'évolution 11-
12 soit de 10 %.

- &OLTXHUO¶RQJOHW : Données
- &OLTXHUO¶RXWLO : Analyse de scénarios
- &OLTXHUO¶RSWLRQ9DOHXUFLEOH«

- Zone : Valeur cible : cliquer la cellule D3 qui reçoit le résultat


- Zone : Valeur à atteindre : saisir le résultat désiré : 0,10
- Zone : Cellule à modifier : pointer ou saisir les références de la cellule à
modifier : C3
- Cliquer : OK

Solution :

- le chiffre d'affaires Négoce de logiciel 2012 que l'entreprise aurait dû réaliser pour que l'évolution 12-
13 soit de 10 %.

- &OLTXHUO¶RQJOHW : Données
- &OLTXHUO¶RXWLOAnalyse de scénarios
- &OLTXHUO¶RSWLRQ9DOHXUFLEOH«

- Zone : Valeur cible : cliquer la cellule qui reçoit le résultat : D5


- Zone : Valeur à atteindre : saisir le résultat désiré : 0,10
- Zone : Cellule à modifier : pointer ou saisir les références de la cellule à
modifier : C5
- Cliquer : OK

Solution :

Corrigé  :  Maîtriser  Office  2010     Page  74  


Solveur

7. La société souhaite étudier le scénario qui permet d'obtenir un chiffre d'affaires total 2013 de : 4 100
000 avec une évolution 12-13 du poste création de site de 70 % et une évolution 12-13 du poste
maintenance de site de 70 %. Les autres valeurs doivent être déterminées par le solveur

71. Paramétrer les données suivantes :

- &OLTXHUO¶RQJOHW : Données
- &OLTXHUO¶RXWLO
- Cliquer dans la zone : Cellule cible à définir et saisir la référence : F9
- Cliquer le type de résultat désiré pour la valeur cible : Valeur
- Cliquer dans la zone de droite et saisir la valeur cible : 4100000

- Cliquer dans la zone : Cellules variables et sélectionner sur la feuille de calcul les cellules à modifier : E3 à
E8

- Cliquer le bouton : Ajouter


- Cliquer la cellule : E4
- Sélectionner le critère : =
- Saisir la quantité : 0,7
- Cliquer le bouton : Ajouter
- Cliquer la cellule : E6
- Sélectionner le critère : =
- Saisir la quantité : 0,7
- Cliquer : OK
=> La fenêtre affiche les contraintes :

- Cliquez : Résoudre
=> La solution trouvée est affichée dans le tableau et la fenêtre suivante apparaît

72. Sauvegarder ce scénario sous le nom : Site + 70 % sans modifier la feuille initiale

- Cliquer : Enregistrer le scénario...


- Saisir le nom du scénario : Site + 70 %
- Cliquer : OK ou [Entrée]

Corrigé  :  Maîtriser  Office  2010     Page  75  


73. Créer et imprimer un rapport de synthèse

- &OLTXHUO¶RXWLOAnalyse de scénarios - Gestionnaire de scénarios


- Cliquer le bouton : Synthèse...
- Cliquer : OK ou [Entrée]
=> La feuille : Synthèse de scénarios est créée. Cliquer son onglet pour la visualiser. Elle se présente ainsi :

8. Sauvegarder le classeur

- Cliquer l'outil

Corrigé  :  Maîtriser  Office  2010     Page  76  


Excel 2010 ± Entraînement
Dossier 23 ± Macro-commande
x Créer une macro commande simple
Objectifs
x Paramétrer un bouton macro
Durée 45¶
Support Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

&KDUJHU([FHOHWDFWLYHUO¶H[pFXWLRQGHVPDFURFRPPDQGHVSXLVDIILFKHUO¶RQJOHW : Développeur

¾ $XWRULVHUO¶H[pFXWLRQGHVPDFUR-commandes
- Cliquer O¶RQJOHW : Développeur

- Cliquer l¶RXWLO

- $FWLYHUO¶RSWLRQ : Activer toutes les macros (non recommandé ULVTXHG¶H[pFXWLRQ«


- Cliquer OK
- Sauvegarder éventuellement le classeur TXLFRQWLHQWODPDFURTXLUHIXVHGHV¶H[pFXWHUpuis rouvrir le classeur
pour activer O¶RSWLRQ

¾ $FWLYHUO¶RQJOHW'pYHORSSHXU
- &OLTXHUO¶RQJOHW : Fichier - Options

- Cliquer : Personnaliser le ruban

- Activer la case : Développeur dans la zone de droite


ruban

- Cliquer OK

!/¶RQJOHWDéveloppeur est ajouté au rXEDQG¶RXWLOV :

2. Saisir les tableaux dans un nouveau classeur et sur quatre feuilles différentes

Corrigé  :  Maîtriser  Office  2010     Page  77  


3. Créer la macro-commande qui calcule les totaux de lignes et met en forme le tableau de la façon
suivante :

¾ Enregistrer la macro-commande
- &OLTXHUO¶RQJOHW : Développeur

- &OLTXHUO¶RXWLO
- Saisir le nom de la macro sans espace : Format_données_semestriels
- Saisir éventuellement la touche qui sera associée à [Ctrl] pour exécuter directement la macro
- Sélectionner le lieu où sauvegarder la feuille macro (Il est conseillé de la sauvegarder dans le classeur qui
contient les feuilles de calcul auxquelles s'applique la macro)
- Cliquer : OK

- Effectuer le travail à enregistrer dans la macro-commande


x Fusionner et centrer le titre
x Mettre le titre en gras et définir le corps des caractères
x Mettre les titres des colonnes en gras et les centrer
x Tracer un arrière plan de couleur aux titres
x Tracer une bordure aux cellules
x Appliquer un format monétaire sans décimal aux valeurs numériques

- &OLTXHUO¶RQJOHW : Développeur SXLVFOLTXHUO¶RXWLO lorsque le travail à enregistrer est


terminé

4. Appliquer la macro commande aux trois autres feuilles Valence, Lyon et Villeurbanne

- Activer la feuille : Valence


- $FWLYHUO¶RQJOHW : Développeur
- &OLTXHUO¶RXWLO : Macros
- Cliquer la macro à exécuter
- Cliquer : Exécuter

5. Sauvegarder le classeur dans le dossier Maitriser Office 2007 du serveur, du dossier Document ou de
la clé USB sous le nom : CA semestriel avec macro au format .xlm

- Cliquer l'outil
- Cliquer dans la zone : Type : et sélectionner : Classeur Excel (prenant en charge les macros) (.xlsm)
- Saisir le nom du classeur dans la zone : Nom de fichiers : CA semestriel avec macro
- Cliquer : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  78  


6. Imprimer le classeur : CA Semestriel avec macro

- &OLTXHUO¶RXWLO

7. Imprimer la macro-commande (Activer la macro-commande en mode Visual Basic comme pour une
modification puis Fichier-,PSULPHU«

- &OLTXHUO¶RQJOHW : Développeur
- Cliquer l'outil : Macros
- Cliquer le bouton : Modifier
- Fichier ± ,PSULPHU«
- Cliquer : OK

Corrigé  :  Maîtriser  Office  2010     Page  79  


Corrigé  :  Maîtriser  Office  2010     Page  80  
Access 2010 ± Entraînement 1
Garage Renault
Dossier 24 ± MCD
Objectifs x Concevoir une modèle conceptuel de données pour Access
Duréex 45¶
Supportx Papier

Travail à faire :

1. Concevoir le dictionnaire des données.

2. Présenter le MCD Access

Corrigé  :  Maîtriser  Office  2010     Page  81  


Access 2010 ± Entraînement 2
Bibliothèque
Dossier 24 ± MCD
Objectifs x Concevoir une modèle conceptuel de données pour Access
Duréex 45¶
Supportx Papier

Travail à faire :

1. Concevoir le dictionnaire des données.

2. Présenter le MCD Access

Corrigé  :  Maîtriser  Office  2010     Page  82  


Access 2010 ± Entraînement 3
Location de résidences de vacances - MAIVA
Dossier 24 ± MCD
Objectifs x Concevoir un modèle conceptuel de données pour Access
Duréex 45¶
Supportx Papier

Travail à faire :

1. Concevoir le dictionnaire des données.

2. Présenter le MCD Access

Corrigé  :  Maîtriser  Office  2010     Page  83  


Access 2010 ± Entraînement
Dossier 25 ± créer et paramétrer une base de données
Objectifs Créer et paramétrer une base de données
Duréex 1h30¶
Supportx Clé USB ou espace personnel sur le serveur oui le disque dur

Travail à faire :

1. Charger Access et créer la base de données : Télide informatique dans le dossier Maîtriser Office
2010 du serveur, du dossier Document ou de la clé USB

- Cliquer l¶RQJOHW : Fichier - Nouveau


Ou
- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide
- Cliquer le bouton : Parcourir et sélectionner l'unité puis le dossier destination
- Saisir le nom de la base de données : Télide Informatique
- Cliquer : Créer
=> Access crée automatiquement une table en mode : Table sans assistant.

- Activer le mode création et paramétrer les champs


- Cliquer l'onglet : Créer
- Cliquer l'outil : Création de table

2. Créer la table Salariés suivante :

¾ Saisir les champs

- Cliquer dans la zone : Nom du champ et saisir le nom du champ : Matricule


- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : Numérique
e
- Cliquer la 2 ligne
- Cliquer dans la zone : Nom du champ et saisir le nom du champ : Civilité
- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : Texte
- Cliquer dans la zone : Taille du champ au bas de la fenêtre et saisir la taille du champ : 20

- Recommencer pour chaque champ de la table ci-dessus

¾ Indiquer la clé primaire


- Cliquer le champ qui servira de clé primaire : Matricule
- &OLTXHUO¶RXWLO : Clé primaire

Corrigé  :  Maîtriser  Office  2010     Page  84  


3. Paramétrer les listes déroulantes suivantes :
x Champ : Civilité => Monsieur, Madame ou Mademoiselle

- Cliquer le champ : Civilité


- Cliquer l'option : Je taperai les valeurs souhaitées
- Cliquer le bouton : Suivant >
- Saisir le nombre de colonnes de la liste (souvent 1)
re
- Cliquer dans la zone de saisie et saisir la 1 donnée de la liste : Madame
e
- Cliquer la ligne au-dessous et saisir la 2 donnée de la liste : Mademoiselle
e
- Cliquer la ligne au-dessous et saisir la 3 donnée de la liste : Monsieur
- Cliquer le bouton : Suivant >
- Saisir le nom de l'étiquette du champ
- Cliquer le bouton : Terminer

x Champ : Sexe => Masculin ou Féminin

- Cliquer le champ : Sexe


- Cliquer l'option : Je taperai les valeurs souhaitées
- Cliquer le bouton : Suivant >
- Saisir le nombre de colonnes de la liste (souvent 1)
re
- Cliquer dans la zone de saisie et saisir la 1 donnée de la liste : Masculin
e
- Cliquer la ligne au-dessous et saisir la 2 donnée de la liste : Féminin
- Cliquer le bouton : Suivant >
- Saisir le nom de l'étiquette du champ
- Cliquer le bouton : Terminer

x Champ : Situation familiale => Célibataire, Marié, Veuf ou Divorcé.

- Cliquer le champ : Situation de famille


- Cliquer l'option : Je taperai les valeurs souhaitées
- Cliquer le bouton : Suivant >
- Saisir le nombre de colonnes de la liste (souvent 1)
re
- Cliquer dans la zone de saisie et saisir la 1 donnée de la liste : Célibataire
e
- Cliquer la ligne au-dessous et saisir la 2 donnée de la liste : Marié
e
- Cliquer la ligne au-dessous et saisir la 3 donnée de la liste : Veuf
e
- Cliquer la ligne au-dessous et saisir la 4 donnée de la liste : Divorcé
- Cliquer le bouton : Suivant >
- Saisir le nom de l'étiquette du champ
- Cliquer le bouton : Terminer

4. Paramétrer les masques de saisie prédéfinis pour les champs suivants :


x N° de SS
- Sauvegarder la table
- Cliquer le champ à traiter : N° SS
- Cliquer la zone Masque de saisie au bas de la fenêtre
- Cliquer le bouton de l'assistant à droite de la ligne
- Sélectionner le masque prédéfini: N° Sécurité
sociale
- Cliquer le bouton : Suivant >
- Sélectionner le caractère de substitution à afficher à la place
des caractères à saisir
- Cliquer le bouton : Terminer

Corrigé  :  Maîtriser  Office  2010     Page  85  


x Code Postal
- Sauvegarder la table
- Cliquer le champ à traiter : CP
- Cliquer la zone Masque de saisie au bas de la fenêtre
- Cliquer le bouton de l'assistant à droite de la ligne
- Sélectionner le masque prédéfini: Code postal
- Cliquer le bouton : Suivant >
- Sélectionner le caractère de substitution à afficher à la place des caractères à saisir
- Cliquer le bouton : Terminer

x Téléphone
- Sauvegarder la table
- Cliquer le champ à traiter : Tél perso
- Cliquer la zone Masque de saisie au bas de la fenêtre
- Cliquer le bouton de l'assistant à droite de la ligne
- Sélectionner le masque prédéfini : Numéro de téléphone
- Cliquer le bouton : Suivant >
- Sélectionner le caractère de substitution à afficher à la place des caractères à saisir
- Cliquer le bouton : Terminer

5. Ajuster la taille des champs texte en fonction des contenus qu'ils sont susceptibles de recevoir
Exemple : civilité : 15 c, nom, prénom, ville, fonction : 30 c, rue : 100 c, agence : 20 c, sexe : 10 c,
etc.

- Cliquer chaque champ de type texte puis cliquer dans la zone : Taille du champ au bas de la fenêtre et
saisir la taille du champ indiqué ci-dessus

6. Fermer la table
- Cliquer la case fermeture de la table

7. Créer la table Sociétés suivante :

- Activer le mode création et paramétrer les champs


- Cliquer l'onglet : Créer
- Cliquer l'outil : Création de table

¾ Saisir les champs

- Cliquer dans la zone : Nom du champ et saisir le nom du champ : N°_Ese


- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : NuméroAuto
e
- Cliquer la 2 ligne
- Cliquer dans la zone : Nom du champ et saisir le nom du champ : Raison sociale
- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : Texte
- Cliquer dans la zone : Taille du champ au bas de la fenêtre et saisir la taille du champ : 20

- Recommencer pour chaque champ de la table ci-dessus

¾ Indiquer la clé primaire


- Cliquer le champ qui servira de clé primaire : N°_Ese
- &OLTXHUO¶RXWLO : Clé primaire

Corrigé  :  Maîtriser  Office  2010     Page  86  


8. Paramétrer une liste de choix pour le champ Matricule qui affiche le matricule et le nom des
salariés de la table Salariés.

- Cliquer le champ Matricule en mode création


- Sélectionner le type : Liste de choix
- Sélectionner l'option : En provenance d'une autre table
- Cliquer le bouton : Suivant >
- Sélectionner la table : Salariés
- Cliquer le bouton : Suivant >
- Sélectionner les champs : Matricule et Nom
- Conserver l'option : Clé caché
- Cliquer le bouton : Suivant >
- Saisir pour étiquette : Matricule
- Cliquer le bouton : Terminer

9. Fermer la table
- Cliquer la case fermeture de la table

10. Créer la table visites suivante :

- Activer le mode création et paramétrer les champs


- Cliquer l'onglet : Créer
- Cliquer l'outil : Création de table

¾ Saisir les champs

- Cliquer dans la zone : Nom du champ et saisir le nom du champ : N°_Visite


- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : NuméroAuto
e
- Cliquer la 2 ligne
- Cliquer dans la zone : Nom du champ et saisir le nom du champ : N° Ese
- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : Numérique

- Recommencer pour chaque champ de la table ci-dessus

¾ Indiquer la clé primaire


- Cliquer le champ qui servira de clé primaire : N° Visite
- &OLTXHUO¶RXWLO : Clé primaire

11. Paramétrer une liste de choix pour le champ N° Ese qui affiche les noms des sociétés de la table
Sociétés.

- Cliquer le champ N° Ese en mode création


- Sélectionner le type : Liste de choix
- Sélectionner l'option : En provenance d'une autre table
- Cliquer le bouton : Suivant >
- Sélectionner la table : Société
- Cliquer le bouton : Suivant >
- Sélectionner les champs : N° Ese et Raison sociale
- Conserver l'option : Clé caché
- Cliquer le bouton : Suivant >
- Saisir pour étiquette : Sociétés
- Cliquer le bouton : Terminer

Corrigé  :  Maîtriser  Office  2010     Page  87  


11. Paramétrer les relations suivantes :

- Fermer la ou les tables à relier


- &OLTXHUO¶RQJOHW : Outils de base de données
- &OLTXHUO¶RXWLO : Relation
=> Un fenêtre affiche les tables de la base de données :
re
- Cliquer la 1 table : Salariés puis cliquer le bouton : Ajouter
e
- Cliquer la 2 table : Sociétés puis cliquer le bouton : Ajouter
e
- Cliquer la 3 table : Visites puis cliquer le bouton : Ajouter
- Cliquer le bouton : Fermer

- Cliquer-glisser le champ : Matricule de la table Salariés sur le champ : Matricule de la table : Sociétés
- Cliquer la case : Appliquer l'intégrité référentielle
- Cliquer la case : Mettre à jour en cascade.... (Pour mettre à jour les enregistrements filles lors de la mise
jMRXUG¶XQHQUHJLVWUHPHQWPqUH
- Cliquer la case : Effacer en cascade... (Pour supprimer les enregistrements filles lors de la suppression
G¶XQHQUHJLVWUHPHQWPqUH
- Cliquer le bouton : Créer

- Cliquer-glisser le champ : N° Ese de la table Sociétés sur le champ : N° Ese de la table : Visites
- Cliquer la case : Appliquer l'intégrité référentielle
- Cliquer la case : Mettre à jour en cascade.... (Pour mettre à jour les enregistrements filles lors de la mise
jMRXUG¶XQHQUHJLVWUHPHQWPqUH
- Cliquer la case : Effacer en cascade... (Pour supprimer les enregistrements filles lors de la suppression
G¶XQHQUHJLVWUHPHQWPqUH
- Cliquer le bouton : Créer

- Cliquer l'outil

- &OLTXHUO¶RXWLO de la fenêtre relation

Corrigé  :  Maîtriser  Office  2010     Page  88  


Access 2010 ± Entraînement 1
Dossier 27 ± Utiliser une base de données
Objectifs Créer et paramétrer une base de données
Duréex 1 h 30¶
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Charger la base de données : Télide informatique

- &OLTXHUO¶RQJOHW : Fichier puis cliquer la base dans la liste affichée au-dessous dans le volet gauche
Ou :
- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide
- 6pOHFWLRQQHUO¶XQLWpOHGRVVLHUSXLVODEDVHGHGRQQpV : Télide informatique
- Cliquer le bouton : Ouvrir

2. Ouvrir la table : Salariés et saisir les enregistrements suivants :

- Double-FOLFVXUO¶pOpPHQWjRXYULUGDQVOHYROHWGHQDYLJDWLRQ sur la table : Salariés


- Cliquer le champ de saisie RXDFWLYHUOHjO¶DLGHGHVWRXFKHV[Tab] ou [->]
- Saisir les données suivantes :

Suite du tableau

3. Imprimer les 3 premiers enregistrements

- Cliqué-glisser sur le bouton de sélection des trois premiers enregistrements


- &OLTXHUO¶RXWLO

4. Fermer la table : Salariés

- Cliquer la case de la table : Salariés

Table : Sociétés

5. Ouvrir la table : Sociétés et saisir les enregistrements suivants :

- Double-FOLFVXUO¶pOpPHQWjRXYULUGDQVOHYROHWGHQDYLJDWLRQ sur la table : Sociétés


- Cliquer le champ de saisie RXDFWLYHUOHjO¶DLGHGHVWRXFKHV[Tab] ou [->]
- Saisir les données suivantes :

Corrigé  :  Maîtriser  Office  2010     Page  89  


6. Fermer la table : Salariés

- Cliquer la case de la table : Salariés

Table : Visites

7. Ouvrir la table : Visites et saisir les enregistrements suivants :

- Double-FOLFVXUO¶pOpPHQWjRXYULUGDQVOHYROHWGHQDYLJDWLRQ sur la table : Visites


- Cliquer le champ de saisie RXDFWLYHUOHjO¶DLGHGHVWRXFKHV[Tab] ou [->]
- Saisir les données suivantes :

8. Imprimer le contenu de la table : Visites

- CliqueUO¶RXWLO

9. Quitter la table : Visites

- Cliquer la case de la table : Salariés

10. Quitter la base de données : Télide Informatique

Corrigé  :  Maîtriser  Office  2010     Page  90  


Access 2010 ± Entraînement 2
Dossier 27 ± Utiliser une base de données
Objectifs Modifier, trier, filtrer des enregistrements
Duréex 1 h 30¶
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

1. Charger la base de données : Télide informatique

2. Modifier la table : Sociétés à l'aide des informations suivantes

Le directeur commercial vous remet de nouvelles cartes. Ajouter ces deux fiches à la table
sociétés.

- Double-FOLFVXUO¶pOpPHQWjRXYULUGDQVOHYROHWGHQDYLJDWLRQ sur la table : Sociétés


- Cliquer le champ de saisie RXDFWLYHUOHjO¶DLGHGHVWRXFKHV[Tab] ou [->]
- Saisir les données suivantes :

3. Trier et imprimer la feuille de données sur le nom des sociétés

- &OLTXHUO¶RQJOHW : Accueil
- Cliquer le champ sur lequel trier les enregistrements : Sociétés
- &OLTXHUO¶RXWLO : Tri croissant

- &OLTXHUO¶RXWLO

4. Trier et imprimer la feuille sur les noms de villes

- Cliquer le champ sur lequel trier les enregistrements : Ville


- &OLTXHUO¶RXWLO : Tri croissant

- &OLTXHUO¶RXWLO

Corrigé  :  Maîtriser  Office  2010     Page  91  


5. Imprimer les champs suivants : - Nom de la société
- Nom du contact
- Fonction
- N° de Téléphone

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Désactiver la case des champs à masquer
- Cliquer : Fermer
- &OLTXHUO¶RXWLO

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Activer la case des champs à afficher
- Cliquer : Fermer

6. Fermer la table Sociétés

- Cliquer la case de la table : sociétés

7. Ouvrir et mettre à jour la table : Salariés en ajoutant les salariés suivants.

- Double-FOLFVXUO¶pOpPHQWjRXYULUGDQV le volet de navigation sur la table : Salariés


- Cliquer le champ de saisie RXDFWLYHUOHjO¶DLGHGHVWRXFKHV[Tab] ou [->]
- Saisir les données suivantes :

,PSULPHUO¶LQWpJUDOLWpGHODWDEOH

- &OLTXHUO¶RXWLO

9. Trier et imprimer le fichier sur les noms des salariés

- Cliquer le champ sur lequel trier les enregistrements : Nom


- &OLTXHUO¶RXWLO : Tri croissant

Corrigé  :  Maîtriser  Office  2010     Page  92  


- &OLTXHUO¶RXWLO

10. Imprimer les champs suivants de la feuille de données : Matricule ; Nom ; Téléphone

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Désactiver la case des champs à masquer
- Cliquer : Fermer
- &OLTXHUO¶RXWLO

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Activer la case des champs à afficher
- Cliquer : Fermer

11. Trier la feuille sur les dates de naissance

- Cliquer le champ sur lequel trier les enregistrements : Date nais


- &OLTXHUO¶RXWLO : Tri croissant
- &OLTXHUO¶RXWLO

12. Imprimer les champs suivants : Nom ; date de naissance ; lieu de naissance

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Désactiver la case des champs à masquer
- Cliquer : Fermer
- &OLTXHUO¶RXWLO

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Activer la case des champs à afficher
- Cliquer : Fermer

13. Quitter la base de données : Télide Informatique

Corrigé  :  Maîtriser  Office  2010     Page  93  


Access 2010 ± Entraînement
Dossier 27 ± Les requêtes
Objectifs Créer et paramétrer des requêtes
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Charger la base de données : Télide informatique

Table Sociétés
2 - Requête sélection : Société de Lyon
2.1 Créer la requête qui sélectionne les sociétés dont le siège social est à Lyon. (Faire apparaître
tous les champs)

- &OLTXHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLOCréation de requête
- Cliquer la table : Sociétés à utiliser puis cliquer le bouton : Ajouter
- Recommencer pour chaque table à utiliser
- Cliquer le bouton : Fermer
- Double cliquer les champs à utiliser dans les table pour les transférer en bas dans la grille de paramétrage

2.2 Sauvegarder cette requête sous le nom : Sociétés de Lyon

- &OLTXHUO¶RXWLO
- Saisir le nom de la requête : Société de Lyon

2.3 Imprimer le résultat de la requête

- &OLTXHUO¶RXWLOAffichage ou Exécuter
- &OLTXHUO¶RXWLO

Corrigé  :  Maîtriser  Office  2010     Page  94  


3 - Requête sélection : Sociétés de Savoie

3.1 Créer la requête qui affiche les sociétés dont le siège sociale est en Savoie. Faire une sélection
par le code postal (=73* ou 74*) ou (Savoie = 73 et Haute Savoie = 74). Afficher uniquement les
champs suivants (nom ; nom de la société ; téléphone)

- ClLTXHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLOCréation de requête
- Cliquer la table : Sociétés à utiliser puis cliquer le bouton : Ajouter
- Cliquer le bouton : Fermer
- Double cliquer les champs à utiliser dans les table pour les transférer en bas dans la grille de paramétrage

3.2 Sauvegarder cette requête sous le nom : Sociétés de Savoie

- &OLTXHUO¶RXWLO
- Saisir le nom de la requête : Société de Savoie

3.3 Imprimer le résultat de la requête

- &OLTXHUO¶RXWLOAffichage ou Exécuter
- Cliquer O¶RXWLO

Corrigé  :  Maîtriser  Office  2010     Page  95  


Table Salariés

4. Imprimer en mode feuille de données les champs suivants : matricule ; nom ; salaire

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Désactiver la case des champs à masquer
- Cliquer : Fermer
- Cliquer O¶RXWLO

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Activer la case des champs à afficher
- Cliquer : Fermer

5 - Requête sélection : Salariés de Lyon


5.1 Créer la requête qui sélectionne les salariés qui habitent à Lyon et dont le salaire est compris
eQWUHHW¼ $IILFKHUOHVFKDPSVVXLYDQWVFLYLOLWpQRPUXH&3YLOOHWpOpSKRQHVDODLUH

- &OLTXHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLOCréation de requête
- Cliquer la table : Salariés à utiliser puis cliquer le bouton : Ajouter
- Cliquer le bouton : Fermer
- Double cliquer les champs à utiliser dans les table pour les transférer en bas dans la grille de paramétrage

Corrigé  :  Maîtriser  Office  2010     Page  96  


5.2 Sauvegarder cette requête sous le nom : Salariés de Lyon entre 2500 et 3000

- &OLTXHUO¶RXWLO
- Saisir le nom de la requête : Salariés de Lyon entre 2500 et 3000

5.3 Imprimer le résultat de la requête

- &OLTXHUO¶RXWLOAffichage ou Exécuter
- &OLTXHUO¶RXWLO

6. Requête mise à jour

Le directeur a décidé de procéder à une augmentation de salaire de 4 % pour tous les salariés de la
société.

6.1 Créer la requête mise à jour qui augmente les salaires

- &OLTXHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLOCréation de requête
- Cliquer la table : Salariés à utiliser puis cliquer : Ajouter
- Recommencer pour chaque table à utiliser
- Cliquer le bouton : Fermer

- Placer le champ salaire qui ferra O¶REMHWG¶XQHPLVHjMRXU

- Cliquer l'outil : Mise à jour


- Cliquer dans la ligne : Mise à jour et saisir
l'expression ou la formule à utiliser (placer le nom
du champ entre crochet [Alt Gr] [5] ou [°])

Corrigé  :  Maîtriser  Office  2010     Page  97  


6.2 Exécuter la requête

- &OLTXHUO¶RXWLOExécuter pour réaliser la mise à jour des champs


!8QHIHQrWUHGHPDQGHFRQILUPDWLRQHWVLJQDOHTX¶LOQHVHUDSDVSRVVLEOHG¶DQQXOHUO¶RSpUDWLRQ

- Cliquer : Oui pour valider la mise à jour

- &OLTXHUO¶RXWLO$IILFKDJHSRXUYLVXDOLVHUOHUpVXOWDW

6.3 Fermer la requête sans la sauvegarder

6.4 Imprimer en mode feuille de données les champs suivants : matricule ; nom ; salaire

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Désactiver la case des champs à masquer
- Cliquer : Fermer
- &OLTXHUO¶RXWLO

- Cliquer-GURLWOHQRPG¶XQFKDPS- Afficher les colonnes...


- Activer la case des champs à afficher
- Cliquer : Fermer

Corrigé  :  Maîtriser  Office  2010     Page  98  


Access 2010 ± Entraînement 1
Dossier 28 ± Les formulaires
Objectifs Créer et paramétrer des formulaires
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Charger la base de données : Télide informatique

Formulaire instantané

2. Créer le formulaire instantané suivant pour la table sociétés en XWLOLVDQWO¶RXWLO)RUPXODLUH


(Placer un saut de page en mode création au bas du formulaire)

- &OLTXHUO¶RQJOHW : Créer
- Activer la table ou la requête pour laquelle créer un formulaire dans le volet de navigation
- &OLTXHUO¶RXWLOTXLFRUUHVSRQGDXformulaire à créer

3. Enregistrer ce formulaire (nom = Formulaire Société)

- &OLTXHUO¶RXWLO
- Saisir le nom du formulaire : Formulaire sociétés

6DLVLUOHVILFKHVVXLYDQWHVjO¶DLGHGXIRUPXODLUH

Corrigé  :  Maîtriser  Office  2010     Page  99  


5. Imprimer les entreprises précédentes à l'aide du formulaire

Corrigé  :  Maîtriser  Office  2010     Page  100  


Formulaire personnalisé

6. Créer le formulaire personnalisé suivant à partir de la table Salariés

- Taille : 15 cm par 11 cm
- Placer un saut de page en mode création au bas du formulaire

¾ Créer un formulaire
- $FWLYHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLOCréation de formulaire
Modifier la taille du formulaire
- Cliquer-glisser la bordure basse ou droite du formulaire
Placer les champs d'une table dans un formulaire
- &OLTXHUO¶RXWLOAjouter des champs existant
- Développer la liste des champs en cliquant les boutons [+]
- Cliquer-glisser les champs sur le formulaire vierge

Corrigé  :  Maîtriser  Office  2010     Page  101  


¾ Modifier et paramétrer le formulaire
Activer le mode création du formulaire
- Cliquer le bouWRQGpURXODQWGHO¶RXWLO : Affichage et sélectionner : Mode création
Ou
- Cliquer-droit le formulaire : Mode création
Sélectionner les contrôles
* Un : cliquer le contrôle
* Plusieurs : cliquer chaque contrôle en appuyant sur [Maj] ou délimiter une zone par un cliqué-glissé qui
intègre les contrôles à sélectionner ou cliquer-glisser dans la règle
Supprimer un contrôle ou une étiquette
- Cliquer l'élément à supprimer - [Suppr]
Modifier le texte d'une étiquette
- Cliquer l'étiquette à modifier puis cliquer dans l'étiquette
- Modifier le contenu de l'étiquette
Activer/Désactiver la grille magnétique
- &OLTXHUO¶RQJOHW : Organiser
- &OLTXHUO¶RXWLO
Déplacer les contrôles
- Cliquer-glisser la poignée de déplacement du contrôle
Modifier la WDLOOHG
XQFRQWU{OHRXG¶XQHpWLTXHWWH
- Cliquer-glisser une poignée de taille du contrôle
Insérer la date le N° de page ou un titre
- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjO¶pOpPHQWjLQVpUHU HWSDUDPpWUHUO¶pOpPHQW
Ajouter un commentaire

- Cliquer l'outil puis tracer le contrôle par un cliqué-glissé de la souris sur le formulaire
- Saisir le texte à afficher et valider par [Entrée]
Insérer un saut de page
Insérer un saut de page
- CliquHUO¶RQJOHW : Création
- Cliquer l'outil : Saut de page de la boite à outils
- Tracer le saut de page sur le formulaire par un cliqué-glissé horizontal de la souris à
O¶HQGURLWRSODFHUOHVDXWGHSDJH
=> Le saut de page est matérialisé par une suite de petits points
Déplacer un saut de page
- Cliquer-glisser le saut de page
Supprimer un saut de page
- Cliquer le saut de page - [Suppr]

¾ Mettre en forme le formulaire


Mise en forme automatique
- &OLTXHUO¶RQJOHW : Organiser
- &OLTXHUO¶RXWLO : Mise en forme auto.
- Cliquer la mise en forme désirée dans la liste affichée

Modifier la disposition des champs


Ces options permettent de transformer les champs en tableau ou de
superposer les champs et les contrôles
- &OLTXHUO¶RQJOHW : Organiser
- Sélectionner les contrôle par cliqué glissé
- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjODPLVHHQIRUPHGpVLUpH : Tabulaire ou Empilé

Corrigé  :  Maîtriser  Office  2010     Page  102  


Mettre en forme le WH[WHO¶DUULqUH-plan et les contrôles
- &OLTXHUO¶RQJOHW : Format
- Cliquer le contrôle RXO¶pWLTXHWWHjSDUDPpWUHU
Texte
- &OLTXHUO¶pOpPHQWjSDUDPpWUHUSXLVSDUDPpWUHUODPLVHHQ
Bordure et arrière-plan de contrôles
- Paramétrer la mise en forme désirée

Tracer un trait ou un rectangle


- &OLTXHUO¶RQJOHW : Création
- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjO
REMHWjWUDFHU5HFWDQJOH ou Trait
- Tracer le trait ou le rectangle par un cliqué-glissé sur le formulaire. Le rectangle peut se superposer aux
autres objets et les cacher. Dans ce cas il faut le faire passer en arrière-plan (voir ci-dessous)
Placer un objet en arrière-plan/premier plan
- &OLTXHUO¶RQJOHW : Organiser
- Cliquer l'objet à placer en arrière ou au premier plan puiVFOLTXHUO¶RXWLOGpVLUp

7. Enregistrer ce formulaire (nom = Formulaire Salariés)

- &OLTXHUO¶RXWLO
- Saisir le nom du formulaire : Formulaire salariés

8. Imprimer toutes les fiches des salariés à l'aide du formulaire.

Insérer un saut de page au bas du formulaire


- &OLTXHUO¶RQJOHW : Création
- Cliquer l'outil : Saut de page de la boite à outils
- Tracer le saut de page sur le formulaire par un cliqué-glissé horizontal de la souris à
O¶HQGURLWRSODFHUOHVDXWGHSDJH
=> Le saut de page est matérialisé par une suite de petits points
Déplacer un saut de page
- Cliquer-glisser le saut de page
Supprimer un saut de page
- Cliquer le saut de page - [Suppr]

- &OLTXHUO¶RXWLO

Corrigé  :  Maîtriser  Office  2010     Page  103  


Access 2010 ± Entraînement 2
Dossier 28 ± Les formulaires
Objectifs Créer et paramétrer un formulaire avec sous formulaire
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

1. Charger la base de données : Télide informatique

2. Concevoir le formulaire avec sous formulaire suivant qui affiche pour chaque vendeur la liste des
entreprises dont il est responsable. (Placer un saut de page en mode création au bas du formulaire)

- $FWLYHUO¶RQJOHW : Créer
- Cliquer l'outil : Assistant formulaire

- Sélectionner dans la zone : Tables/Requêtes, la table Salariés qui contient les champs à placer dans le formulaire
- Cliquer le champ : Matricule dans la zone de gauche (Champs disponibles) puis cliquer le bouton
- Cliquer le champ : Nom dans la zone de gauche (Champs disponibles) puis cliquer le bouton
- Cliquer le champ : Fonction dans la zone de gauche (Champs disponibles) puis cliquer le bouton

- Sélectionner dans la zone : Tables/Requêtes, la table Sociétés qui contient les champs à placer dans le formulaire
- Cliquer le champ : 1RPGHO¶HQWUHSULVH dans la zone de gauche (Champs disponibles) puis cliquer le bouton
- Cliquer le champ : Contact dans la zone de gauche (Champs disponibles) puis cliquer le bouton
- Cliquer le bouton : Suivant >

- Cliquer O¶RUJDQLVDWLRQ des données désirées (si les champs proviennent de plusieurs tables il y aura un formulaire avec
sous formulaire)
- Cliquer le bouton : Suivant >

- Cliquer la disposition désirée


- Cliquer le bouton : Suivant >

- Cliquer le style désiré pour les contrôles et le texte


- Cliquer le bouton : Suivant >

- Modifier éventuellement le nom du formulaire et le nom du sous formulaire

- Noms du formulaire et du sous-formulaire


Formulaire = Salariés
Sous-formulaire = Liste des entreprises par vendeur

- Sélectionner l'option de travail souhaitée en


cochant les boutons correspondants
- Cliquer le bouton : Terminer

3 - Activer le formulaire : Liste des entreprises par représentant

4 - Imprimer les formulaires avec sous formulaire de chaque représentant (un par page)
- &OLTXHUO¶RXWLO

5 - Fermer la base de données

Corrigé  :  Maîtriser  Office  2010     Page  104  


Access 2010 ± Entraînement 3
Dossier 28 ± Les formulaires
Objectifs &UpHUHWSDUDPpWUHUXQIRUPXODLUHDYHFJURXSHG¶RSWLRQV
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Créer la base de données : Salon Simodec dans le dossier Maitriser Office 2010 du serveur, du
dossier Document ou de la clé USB sous le nom

2. Créer et paramétrer la table : Inscriptions suivantes :


Le champ : Taille stand correspond à la surface en m² du stand

- Cliquer l¶RQJOHW : Fichier - Nouveau


Ou
- &OLTXHUO¶RXWLO GDQVOD%DUUHG¶RXWLOVAccès rapide
- Cliquer le bouton : Parcourir et sélectionner l'unité puis le dossier destination
- Saisir le nom de la base de données : Salon Simodec
- Cliquer : Créer
- Activer le mode création et paramétrer les champs
- Cliquer l'onglet : Créer
- Cliquer l'outil : Création de table

¾ Saisir les champs


- Cliquer dans la zone : Nom du champ et saisir le nom du champ : N° Inscription
- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : NuméroAuto
e
- Cliquer la 2 ligne
- Cliquer dans la zone : Nom du champ et saisir le nom du champ : Contact
- [Tab], [->] ou [Entrée] pour aller à la colonne : Type de données
- Zone : Type de données : cliquer le bouton déroulant puis le type : Texte
- Cliquer dans la zone : Taille du champ au bas de la fenêtre et saisir la taille du champ : 20

- Recommencer pour chaque champ de la table ci-dessus


¾ Indiquer la clé primaire
- Cliquer le champ qui servira de clé primaire : N° Inscription
- &OLTXHUO¶RXWLO : Clé primaire

&UpHUOHIRUPXODLUHVXLYDQWDYHFXQJURXSHG¶RSWLRQVSRXUVDLVLUODFDWpJRULHHWGHVFKDPSV
calculés pour calculer le prix à payer pour la participation au Salon

- $FWLYHUO¶RQJOHW : Créer
- Cliquer l'outil : Assistant formulaire

- Sélectionner dans la zone : Tables/Requêtes, la table Inscription qui contient les champs à placer dans le
formulaire
- 7UDQVIpUHUWRXVOHVFKDPSVjO¶DLGHGXERXWRQ
- Cliquer le bouton : Suivant >

- Cliquer O¶RUJDQLVDWLRQGHVGRQQpHVGpVLUpHV VLOHVFKDPSVSURYLHQQHQWGHSOXVLHXUVWDEOHVLO\DXUDXQ


formulaire avec sous formulaire)
- Cliquer le bouton : Suivant >

- Cliquer la disposition désirée


- Cliquer le bouton : Suivant >

- Cliquer le style désiré pour les contrôles et le texte


- Cliquer le bouton : Suivant >

Corrigé  :  Maîtriser  Office  2010     Page  105  


- Modifier éventuellement le nom du formulaire et le nom du sous-formulaire

¾ Modifier et paramétrer le formulaire


Activer le mode création du formulaire
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO : Affichage et sélectionner : Mode création
Ou
- Cliquer-droit le formulaire : Mode création
Modifier la taille du formulaire
- Cliquer-glisser la bordure basse ou droite du formulaire
Sélectionner les contrôles
* Un : cliquer le contrôle
* Plusieurs : cliquer chaque contrôle en appuyant sur [Maj] ou délimiter une zone par un cliqué-glissé qui
intègre les contrôles à sélectionner ou cliquer-glisser dans la règle
Supprimer un contrôle ou une étiquette
- Cliquer l'élément à supprimer - [Suppr]
Modifier le texte d'une étiquette
- Cliquer l'étiquette à modifier puis cliquer dans l'étiquette
- Modifier le contenu de l'étiquette
Déplacer les contrôles
- Cliquer-glisser la poignée de déplacement du contrôle
Modifier la WDLOOHG
XQFRQWU{OHRXG¶XQHpWLTXHWWH
- Cliquer-glisser une poignée de taille du contrôle
Ajouter un commentaire

- Cliquer l'outil puis tracer le contrôle par un cliqué-glissé de la souris sur le formulaire
- Saisir le texte à afficher et valider par [Entrée]
Insérer un saut de page
Insérer un saut de page
- &OLTXHUO¶RQJOHW : Création
- Cliquer l'outil : Saut de page de la boite à outils
- Tracer le saut de page sur le formulaire par un cliqué-glissé horizontal de la souris à
O¶HQGURLWRSODFHUOHVDXWGHSDJH
=> Le saut de page est matérialisé par une suite de petits points
Déplacer un saut de page
- Cliquer-glisser le saut de page

¾ Mettre en forme le formulaire


Mettre en forme le WH[WHO¶DUULqUH plan et les contrôles
- &OLTXHUO¶RQJOHW : Format
- &OLTXHUOHFRQWU{OHRXO¶pWLTXHWWHjSDUDPpWUHU
Texte
- &OLTXHUO¶pOpPHQWjSDUDPpWUHUSXLVSDUDPpWUHUOa mise en
Bordure et arrière-plan de contrôles
- Paramétrer la mise en forme désirée
Tracer un trait ou un rectangle

- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjO
REMHWjWUDFHU5HFWDQJOH ou Trait
- Tracer le trait ou le rectangle par un cliqué-glissé sur le formulaire. Le rectangle peut se superposer aux
autres objets et les cacher. Dans ce cas il faut le faire passer en arrière-plan (voir ci-dessous)
Placer un objet en arrière-plan/premier plan
- &OLTXHUO¶RQJOHW : Organiser
- &OLTXHUO
REMHWjSODFHUHQDUULqUHRXDXSUHPLHUSODQSXLVFOLTXHUO¶RXWLOGpVLUp

Corrigé  :  Maîtriser  Office  2010     Page  106  


Insérer une image
- &OLTXHUO¶RQJOHW : Création
- &OLTXHUO¶RXWLO : Logo
- 6pOHFWLRQQHUO¶LPDJHSXLVFOLTXHU : Ouvrir
- 3RVLWLRQQHUHWSDUDPpWUHUO¶LPDJHSDUFOLTXpJOLVVp

¾ Créer un groupe de boutons ou cases à cocher


- Activer le mode Création du formulaire
- &OLTXHUO¶RQJOHW Création des Outils formulaire

- $FWLYHUO¶RXWLl : Assistant GDQVOHUXEDQG¶RXWLOV

- Cliquer l'outil Groupe d'options et tracer le contrôle sur le formulaire par un cliqué-glissé de la souris
r
- Saisir le texte des boutons ou cases à cocher en changeant de ligne par [Tab]
- Cliquer le bouton : Suivant >

- Sélectionner éventuellement une valeur par défaut à retenir


- Cliquer le bouton : Suivant >

- Modifier éventuellement la valeur numérique affectée à chaque option (La valeur est obligatoirement une donnée
numérique).
- Cliquer le bouton : Suivant >

- Sélectionner le champ de la table dans lequel enregistrer la donnée


- Cliquer le bouton : Suivant >

- Sélectionner le type de contrôle et le style désiré


- Cliquer le bouton : Suivant >

- Saisir le nom de l'étiquette du groupe d'options


- Cliquer le bouton : Terminer

- &OLTXHUO¶RXWLO

Corrigé  :  Maîtriser  Office  2010     Page  107  


/HVWDQGHVWIDFWXUp¼OHPð

3UL[+7 7DLOOHVWDQG ¼


Prix TTC = Prix HT*1,196 (Utiliser le taux de TVA en vigueur le jour du travail)
Ou
Prix TTC = Taille Stand*100*1,196 (Utiliser le taux de TVA en vigueur le jour du travail)

¾ Créer un contrôle calculé


Créer le contrôle

- Cliquer l'outil et tracer le contrôle sur le formulaire par un cliqué-glissé


- Cliquer dans le contrôle et saisir le signe =
- Saisir la formule en plaçant les noms de champs entre des crochets sans espace. ([Alt gr] [5] ou [°])
Paramétrer le format et le nom du champ
- Cliquer-droit le contrôle calculé ± Propriétés
- Cliquer la ligne : Format GHO¶RQJOHW : Format
- Sélectionner le format souhaité
3DUDPpWUHUO¶pWLTXHWWH
- Cliquer dans l'étiquette et saisir le texte de l'étiquette
- [Entrée]

4. Saisir les clients VXLYDQWVGDQVODWDEOHjO¶DLGHGXIRUPXODLUH

Corrigé  :  Maîtriser  Office  2010     Page  108  


5. Imprimer à l'aide du formulaire les distributeurs (catégorie 3)

¾ Filtrer par formulaire


Créer et paramétrer un filtre
- &OLTXHUO¶RQJOHWAccueil
- &OLTXHUO¶Rutil SXLVO¶RSWLRQFiltrer par formulaire...
- Cliquer le champ sur lequel paramétrer le filtre où saisir un critère de filtre puis le bouton déroulant qui
affiche les données contenues dans le champ et sélectionner la donnée à afficher
Ou
- Cliquer dans le champ est saisir le critère de filtre désiré
Afficher les enregistrements filtrés
- Cliquer l'outil pour afficher les enregistrements
Afficher tous les enregistrements
- Cliquer l'outil SXLVO¶RSWLRQEffacer tous les filtres

- &OLTXHUO¶RXWLO

6. Quitter Access

Corrigé  :  Maîtriser  Office  2010     Page  109  


Access 2010 ± Entraînement (1)
Dossier 29 ± Les états
Objectifs Créer et paramétrer des états simples jSDUWLUG¶XQHWDEOH
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Charger Access et la base de données : Télide informatique

2. Créer un état à partir de la table : Sociétés qui imprime la liste des entreprises

7LWUHGHO
pWDWHWQRPGHO¶pWDW/LVWHGHV&OLHQWV
Présentation en mode paysage

- &OLTXHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLO
- Sélectionner la table Société qui contient les champs à placer dans l'état
- Cliquer et transférer dans la zone de droite le champ : Raison sociale. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Contact. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Fonction. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Rue. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : CP. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Ville. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Tel. Réaliser le transfert avec le bouton
- Cliquer le bouton : Suivant >

- 6LOHVFKDPSVSURYLHQQHQWGHSOXVLHXUVWDEOHVLQGLTXHUO¶RUJDQLVDWLRQGHVGRQQpHVGpVLUpH
- Cliquer le bouton : Suivant >

- Ajouter éventuellement des niveaux de regroupement en cliquant dans la zone de gauche le champ de regroupement
puis en cliquant le bouton
- Cliquer le bouton : Suivant >

- Sélectionner éventuellement le champ sur lequel trier les données puis cliquer le bouton de droite pour sélectionner le
tri (croissant ou décroissant)
- Cliquer le bouton : Suivant >

- Cliquer la présentation désirée


- Cliquer l'orientation désirée (Portrait, Paysage)
- Cliquer le bouton : Suivant >

- Cliquer le style désiré


- Cliquer le bouton : Suivant >

- 6DLVLUOHWLWUHGHO¶pWDW
- Sélectionner l'option de travail désirée
- Cliquer le bouton : Terminer

!/¶pWDWHVWDIILFKpHQPRGHaperçu avant impression.

- FHUPHUO¶DSHUoX HQFOLTXDQWO¶RXWLO : )HUPHUO¶DSHUoX avant impression«

¾ Modifier la taille de la feuille


- &OLTXHUO¶RXWLO : Taille
- Sélectionner ou paramétrer la taille de la feuille

¾ Modifier les marges


- &OLTXHUO¶RXWLO : Marges
- Sélectionner ou paramétrer les marges de la feuille

Corrigé  :  Maîtriser  Office  2010     Page  110  


¾ Modifier l'orientation
- &OLTXHUO¶RXWLO : Portrait ou Paysage

¾ 0RGLILHUODODUJHXUG¶XQHFRORQQH
- Cliquer le FRQWU{OHRXO¶pWLTXHWWHjSDUDPpWUHUSXLVFOLTXp- glissé la bordure droite ou gauche du contrôle ou de
O¶pWLTXHWWHYHUVO¶LQWpULHXURXO¶H[WpULHXUVHORQTXHODFRORQQHGRLWrWUHUpGXLWHRXpODUJLH

6DXYHJDUGHUO¶pWDWVRXVOHQRP : Liste des Clients

- &OLTXHUO¶RXWLO
- 6DLVLUOHQRPGHO¶pWDW: Liste des clients

4. Imprimer l'état

- Cliquer l'outil

Corrigé  :  Maîtriser  Office  2010     Page  111  


Access 2010 ± Entraînement (2)
Dossier 29 ± Les états
Objectifs Créer et paramétrer un état avec regroupement de données
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Charger Access et la base de données : Télide informatique

2. Créer un état à partir des tables : Salariés et de la table : Sociétés qui imprime la liste des
entreprises regroupées par salarié - Vendeur

7LWUHGHO
pWDWHWQRPGHO¶pWDW/LVWHGHVFOLHQWVSDUYHQGHXU
Présentation en mode portrait

- &OLTXHUO¶RQJOHW : Créer
- &OLTXHUO¶RXWLO
- Sélectionner la table Salariés qui contient les champs à placer dans l'état
- Cliquer et transférer dans la zone de droite le champ : Nom. Réaliser le transfert avec le bouton

- Sélectionner la table Société qui contient les champs à placer dans l'état
- Cliquer et transférer dans la zone de droite le champ : Raison sociale. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Contact. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Fonction. Réaliser le transfert avec le bouton
- Cliquer et transférer dans la zone de droite le champ : Tel. Réaliser le transfert avec le bouton
- Cliquer le bouton : Suivant >

- 6LOHVFKDPSVSURYLHQQHQWGHSOXVLHXUVWDEOHVLQGLTXHUO¶RUJDQLVDWLRQdes données désirée : Par salarié


- Cliquer le bouton : Suivant >

- Cliquer le bouton : Suivant >

- Sélectionner le champ : Raison sociale sur lequel trier les données puis cliquer le bouton de droite pour sélectionner
le tri (croissant ou décroissant)
- Cliquer le bouton : Suivant >

- Cliquer la présentation désirée


- Cliquer l'orientation désirée (Portrait, Paysage)
- Cliquer le bouton : Suivant >

- Cliquer le style désiré


- Cliquer le bouton : Suivant >

- 6DLVLUOHWLWUHGHO¶pWDW
- Sélectionner l'option de travail désirée
- Cliquer le bouton : Terminer

- FHUPHUO¶DSHUoX HQFOLTXDQWO¶RXWLO : )HUPHUO¶DSHUoX avant impression«

¾ Modifier la taille de la feuille


- &OLTXHUO¶RXWLO : Taille
- Sélectionner ou paramétrer la taille de la feuille

¾ Modifier les marges


- &OLTXHUO¶RXWLO : Marges
- Sélectionner ou paramétrer les marges de la feuille

¾ Modifier l'orientation
- &OLTXHUO¶RXWLO : Portrait ou Paysage

Corrigé  :  Maîtriser  Office  2010     Page  112  


¾ 0RGLILHUODODUJHXUG¶XQHFRORQQH
- &OLTXHUOHFRQWU{OHRXO¶pWLTXHWWHjSDUDPpWUHUSXLVFOLTXp- glissé la bordure droite ou gauche du contrôle ou de
O¶pWLTXHWWHYHUVO¶LQWpULHXURXO¶H[WpULHXUVHORQ que la colonne doit être réduite ou élargie.

6DXYHJDUGHUO¶pWDWVRXVOHQRP : Liste des clients par vendeur

- &OLTXHUO¶RXWLO
- 6DLVLUOHQRPGHO¶pWDW: Liste des clients par vendeur

4. Imprimer l'état

- Cliquer l'outil

Corrigé  :  Maîtriser  Office  2010     Page  113  


Access 2010 ± Entraînement
Dossier 30 ± import export de tables ou données
Objectifs ,PSRUWHUGHVGRQQpHVG¶([FHOVRXV$FFHVV
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

1. Ouvrir Excel et saisir le tableau suivant :

2. Sauvegarder le document dans le dossier


Maitriser Office 2007 du serveur, du dossier
Document ou de la clé USB sous le nom :
Fichier articles

3. Fermer Excel

4. Ouvrir la base de données : Télide Informatique

5. Importer dans une nouvelle table le : Fichier articles conçu précédemment sous Excel
La clé primaire sera mise sur la référence
Utiliser les titres de colonne pour nom de champ

- &OLTXHUO¶RQJOHW : Données externes


- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjO¶DSSOLFDWLRQVRXUFH

- Cliquer le bouton : Parcourir


- Sélectionner l'unité, le dossier puis le fichier source : Fichier articles
- Cliquer le bouton : Ouvrir

- &OLTXHUO¶RSWLRQImporter les données sources dans une nouvelle table


- Cliquer : OK

- Sélectionner la feuille à importer


- Cliquer le bouton : Suivant >
re
- Indiquer si la 1 ligne contient les noms des champs
- Cliquer le bouton : Suivant >

- Cliquer chaque champ et paramétrer le type de données


- Cliquer le bouton : Suivant >

- Paramétrer la clé primaire


- Cliquer le bouton : Suivant >

- Saisir le nom de la table


- Cliquer le bouton : Terminer

- Cliquer : Fermer

Corrigé  :  Maîtriser  Office  2010     Page  114  


Access 2010 ± Entraînement
Dossier 31 ± Bouton macro et menu de gestion
Objectifs Initiation à la création de boutons macro et de menu de gestion
Duréex 1h
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Ouvrir Access et la base de données : Télide informatique

Bouton de commande

2. Ajouter les boutons de commande suivants dans les formulaires : Salariés et Sociétés qui
permettent de fermer le formulaire et G¶LPSULPHUO¶HQUHJLVWUHPHQW actif :

o /¶LPSUHVVLRQHVWXQHRSpUDWLRQVXUHQUHJLVWUHPHQW

- Ouvrir le formulaire dans lequel créer le bouton de commande en Mode création


- &OLTXHUO¶RQJOHW : Création
- Activer l'assistant
- Cliquer l'outil : Bouton et créer le bouton sur le formulaire par un cliqué-glissé

- Sélectionner la catégorie d'action à réaliser


- Sélectionner l'action à réaliser
- Cliquer : Suivant >

- Cliquer le contenu du bouton (Texte ou image)


- Saisir le texte ou sélectionner l'image à afficher dans le bouton
- Cliquer : Suivant >

- Saisir le nom à attribuer au bouton de commande


- Cliquer : Terminer

Corrigé  :  Maîtriser  Office  2010     Page  115  


o La fermeture du formulaire est une opération sur formulaire

- Ouvrir le formulaire dans lequel créer le bouton de commande en Mode création


- &OLTXHUO¶RQJOHW : Création
- Activer l'assistant
- Cliquer l'outil : Bouton et créer le bouton sur le formulaire par un cliqué-glissé

- Sélectionner la catégorie d'action à réaliser


- Sélectionner l'action à réaliser
- Cliquer : Suivant >

- Cliquer le contenu du bouton (Texte ou image)


- Saisir le texte ou sélectionner l'image à afficher dans le bouton
- Cliquer : Suivant >

- Saisir le nom à attribuer au bouton de commande


- Cliquer : Terminer

3. Tester le bon fonctionnement des boutons

Menu

4. Créer et mettre en forme le menu général


suivant :

¾ Créer un menu général


- &OLTXHUO¶RQJOHW : Outils de base de données
- &OLTXHUO¶RXWLO
=> Une fenêtre propose de créer un menu général.

- Cliquer : Oui
- Cliquer le bouton : Modifier
- Saisir le nom du menu : Menu de gestion Télide
informatique
Paramétrer les commandes
- Cliquer le bouton : 1RXYHDX«
- Saisir le texte qui apparaîtra à côté du bouton :
Ajouter un salarié

- Sélectionner la commande à réaliser : Ouvrir


formulaire en mode ajout

- Sélectionner le formulaire : Salariés


- Cliquer : OK ou [Entrée]

- Recommencer la même opération pour les deux autres menus

Corrigé  :  Maîtriser  Office  2010     Page  116  


=> La fenêtre affiche la liste des commandes du menu.

Paramétrer l'ordre des commandes


- Cliquer la commande à déplacer
- Cliquer le bouton : Monter ou Descendre
Fermer la fenêtre de paramétrage
- Cliquer le bouton : Fermer

- Cliquer le bouton : Fermer dans la fenêtre générale


=> Le menu est sauvegardé dans OHFDGUHG¶XQIRUPXODLUHGRQWOHQRPHVWPHQXJpQpUDO,OVHUD
DXWRPDWLTXHPHQWPLVHQ°XYUHORUVGXSURFKDLQFKDUJHPHQWGHODEDVHGHGRQQpHVSRXUODTXHOOHLOD
été conçu.

5. Vérifier le bon fonctionnement du menuet son interaction avec les boutons de commande créés
précédemment

- Double cliquer le formulaire : Menu général


- Déplacer vous entre les formulaires par les boutons macro et le menu général

6. Quitter Access

Corrigé  :  Maîtriser  Office  2010     Page  117  


PowerPoint 2010 ± Entraînement (1)
Dossier 32 ± créer un diaporama
Objectifs x Concevoir et paramétrer un document au format A4
Duréex 30¶
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à Faire :

1. Ouvrir PowerPoint et concevoir le document suivant au format A4

¾ Paramétrer la destination
- &OLTXHUO¶RQJOHW : Création
- &OLTXHUO¶RXWLO : Mise en page
- Sélectionner la destination du diaporama : Papier
- 3DUDPpWUHUO¶RULHQWDWLRQ
- Cliquer : OK

¾ Gestion du texte
- Cliquer dans un cadre de texte prédéfini et saisir le texte au clavier (La saisie du texte est identique à Word)

¾ Sélectionner du texte
- un texte : cliquer-glisser sur le texte à sélectionner
- un mot : double clic sur un mot pour le sélectionner
- un paragraphe : triple clic pour sélectionner un paragraphe

¾ Modifier un attribut de mise en forme

- &OLTXHUO¶Rnglet : Accueil
Style de caractères
- Paramétrer les attributs de style souhaités
Alignement des caractères
- Paramétrer les alignements désirés

¾ Paramétrer des Puces et numéros


Ajouter des Puces ou des numéros
- Sélectionner le texte devant lequel mettre des puces ou numéros par cliqué-glissé
- Cliquer les outils : Puces Numérotation pour activer ou désactiver la fonction

Modifier la puce ou les numéros


- Sélectionner le texte qui contient des puces ou numéros à modifier
- Cliquer le bouton déroulant des outils HWVpOHFWLRQQHUO¶RSWLRQGpVLUpH

¾ Copier une mise en forme


- &OLTXHUO¶RQJOet : Accueil
- Cliquer le texte dont la mise en forme est à copier
- &OLTXHUO¶RXWLO puis sélectionner le texte destination à mettre en forme

¾ Modifier les interlignes


- Sélectionner le texte à traiter
- &OLTXHUO¶Rnglet : Accueil
- &OLTXHUO¶RXWLO Interligne et sélectionner O¶LQWHUOLJQHGpVLUp

Corrigé  :  Maîtriser  Office  2010     Page  118  


¾ Sélectionner et mettre en forme un cadre
- Cliquer le centre du cadre pour faire apparaître la bordure et les poignées
- &OLTXHUO¶Rnglet : Format
- Sélectionner dans la zone : Styles de forme un style prédéfini
Ou
- 3DUDPpWUHUXQVW\OHSHUVRQQDOLVpjO¶aide des outils Remplissage, Contour et Effets de forme
Couleur unie
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO : Remplissage de forme
- Cliquer la couleur désirée
Ou
- Cliquer : Autres couleurs de remplissage... pour activer une palette plus riche
- Cliquer la couleur désirée dans la palette ± Cliquer : OK
Dégradé
- &OLTXHUO¶RXWLO : Remplissage de forme - Dégradé
- Cliquer le dégradé désiré ou cliquer : 3OXVGHGpJUDGp«et paramétrer le dégradé désiré
- Cliquer : OK

2. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous le nom : Rencontres telecom

- Cliquer l'outil
- SpOHFWLRQQHUO¶XQLWpHWOHGRVVLHU : Maitriser Office 2010
- Saisir le nom du fichier : Rencontres telecom
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  119  


PowerPoint 2010 ± Entraînement (2)
Dossier 32 ± Créer un diaporama
Objectifs x Concevoir et paramétrer des diapositives de texte
Duréex 45¶
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à Faire :

1. Ouvrir PowerPoint et concevoir les deux diapositives suivantes

¾ Sélectionner une mise en forme générale pour toutes les diapositives

- &OLTXHUO¶RQJOHW : Création
- Cliquer dans la zone : Thèmes la présentation désirée

- 3HUVRQQDOLVHUODFRXOHXUODSROLFHRXOHVHIIHWVjO¶DLGHGHVRXWLOVVXLYDQWV

¾ Gestion du texte
- Cliquer dans un cadre de texte prédéfini et saisir le texte au clavier (La saisie du texte est
identique à Word)

¾ Sélectionner du texte
- un texte : cliquer-glisser sur le texte à sélectionner
- un mot : double clic sur un mot pour le sélectionner
- un paragraphe : triple clic pour sélectionner un paragraphe

¾ Modifier un attribut de mise en forme

- &OLTXHUO¶Rnglet : Accueil
Style de caractères
- Paramétrer les attributs de style souhaités
Alignement des caractères
- Paramétrer les alignements désirés

¾ Paramétrer des Puces et numéros


Ajouter des Puces ou des numéros
- Sélectionner le texte devant lequel mettre des puces ou numéros par cliqué-glissé
- Cliquer les outils : Puces Numérotation pour activer ou désactiver la fonction

Modifier la puce ou les numéros


- Sélectionner le texte qui contient des puces ou numéros à modifier
- Cliquer le bouton déroulant des outils HWVpOHFWLRQQHUO¶RSWLRQGpVLUpH

¾ Copier une mise en forme


- &OLTXHUO¶RQJOHW : Accueil
- Cliquer le texte dont la mise en forme est à copier
- &OLTXHUO¶RXWLO puis sélectionner le texte destination à mettre en forme

¾ Modifier les interlignes


- Sélectionner le texte à traiter
- &OLTXHUO¶RQJOHW : Accueil
- &OLTXHUO¶RXWLO,QWHUOLJQH HWVpOHFWLRQQHUO¶LQWHUOLJQHGpVLUp

Corrigé  :  Maîtriser  Office  2010     Page  120  


¾ En tête et pied de page
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RXWLO : En-tête et pied de page
- Paramétrer les éléments à afficher
- Cliquer : OK

¾ Insérer une diapositive


- Activer la diapositive après laquelle insérer
la nouvelle diapositive
- &OLTXHUO¶RQJOHW : Accueil
- &OLTXHUO¶RXWLO : Nouvelle diapositive
- Cliquer le type de diapositive à insérer

- Paramétrer la diapositive en utilisant les mêmes


procédures que pour la diapositive précédente

'LIIXVHUjO¶pFUDQOHGLDSRUDPD

¾ $IILFKHUOHGLDSRUDPDjO¶pFUDQ

- Cliquer le mode : Diaporama HQEDVGHO¶pFUDQjGURLWH


Ou
- &OLTXHUO¶RQJOHW : Affichage SXLVO¶RXWLO : Diaporama

- 8WLOLVHUOHFODYLHUSRXUPHWWUHHQ°XYUHOHGLDSRUDPD

3. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous le nom : Diaporama associés
- Cliquer l'outil
- SpOHFWLRQQHUO¶XQLWpHWOHGRVVLHU : Maitriser Office 2010
- Saisir le nom du fichier : Diaporama associés
- Cliquer le bouton : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  121  


PowerPoint 2010 ± Entraînement
Dossier 33 ± tableau, graphique, Wordart, SmartArt, dessins, vidéo, son, etc.
Objectifs x Image, tableau, graphique, WordArt, SmartArt, son
Duréex 45¶
Supportx Clé USB ou espace personnel sur le serveur ou sur le disque dur

1. Ouvrir PowerPoint et le fichier : Diaporama associés

2. Modifier les 2 premières diapositives et concevoir les trois diapositives suivantes :

¾ Insérer un clipart à partir de la bibliothèque


- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RXWLO : Images Clipart...

=> Le volet Image FOLSDUWHVWDIILFKpjGURLWHGHO¶pFUDQ :

- Cliquer dans la zone : Rechercher et saisir le nom du


clipart recherché
- Cliquer : OK
- Cliquer au-dessous le clipart à insérer

- Cliquer-glisser le clipart jO¶HQGURLWGpVLUp


- Cliquer-glisser une poignée G¶DQJOHSRXUHQPRGLILHUODWDLOOH

Corrigé  :  Maîtriser  Office  2010     Page  122  


¾ Insérer une diapositive
- Activer la diapositive après laquelle insérer
la nouvelle diapositive
- &OLTXHUO¶RQJOHW : Accueil
- &OLTXHUO¶RXWLO : Nouvelle diapositive
- Cliquer le type de diapositive à insérer
- Paramétrer la diapositive en utilisant les mêmes procédures
que pour la diapositive précédente

¾ Créer un tableau
- &OLTXHUO¶REMHW : Tableau
- Saisir le nombre de ligne et de colonne du tableau
- Cliquer : OK
ou
- &OLTXHUO¶RQJOHW : Insertion
- CliquHUO¶RXWLO : Tableau puis cliquer glisser au dessous et sélectionner le nombre de lignes et
colonnes désiré

¾ Saisir le contenu
- $FWLYHU ODFHOOXOHGDQVODTXHOOHVDLVLUXQH GRQQpHHQODFOLTXDQW,O HVWSRVVLEOHGHSDVVHUG¶XQHFHOOXOH j
O¶DXWUHSDU[Tab]
- /DVDLVLHHWODPRGLILFDWLRQGHGRQQpHVGDQVXQWDEOHDXHVWFRPSDUDEOHjFHOOHG¶XQWH[WHKDELWXHOjFHWWH
GLIIpUHQFHTX¶HOOHHVWIDLWHGDQVXQHFHOOXOH

¾ Modifier la structure du tableau


- &OLTXHUO¶RQJOHW : Disposition du ruban : Outils de tableau
- Utiliser les outils correspondants au travail à réaliser ou les menus contextuels voir ci-dessous
Insérer des cellules, lignes, colonnes
- Cliquer-droit la ligne ou la colonne qui suivra la ligne/colonne insérée - Insérer
- 6pOHFWLRQQHUO¶RSWLRQGpVLUpH
Supprimer des cellules, lignes, colonnes
- Sélectionner les éléments à supprimer
- Cliquer-droit la VpOHFWLRQSXLVVpOHFWLRQQHUGDQVOHPHQXFRQWH[WXHOO¶RSWLRQGpVLUpH : Supprimer les
FHOOXOHV« ou Supprimer les lignes ou Supprimer les colonnes
Fusionner les cellules
- Sélectionner les cellules à fusionner
- Cliquer-droit la sélection ± Fusionner les cellules
Fractionner des cellules
- Cliquer-droit la cellule à fractionner ± )UDFWLRQQHUOHVFHOOXOHV«
- Paramétrer le nombre de cellules à créer en saisissant le nombre de colonnes et de lignes à créer
- Cliquer : OK ou [Entrée]

¾ Mettre en forme les cellules


Mise en forme rapide
- Cliquer le tableau
- &OLTXHUO¶RQJOHW : Création de la zone : Outils de tableau
- Sélectionner les options de style à gauche puis le style à appliquer à droite

Bordures
- Sélectionner les cellules à traiter
- Cliquer O¶RQJOHW : Accueil RXO¶RQJOHW : Création des Outils de tableau
- Cliquer le bouton déroulant de l'outil Bordures
- Cliquer la bordure désirée
Ou :
- &OLTXHUO¶RSWLRQ : Bordure HWWUDPH«
- Paramétrer la bordure - Cliquer : OK

Corrigé  :  Maîtriser  Office  2010     Page  123  


Trame de fond
- Sélectionner les cellules à traiter
- Cliquer O¶RQJOHW : Accueil RX O¶RQJOHW : Création des Outils de
tableau
- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO et sélectionner la couleur désirée

Le graphique est conçu à partir des


données du tableau de la
diapositive précédente.

Faire un copié collé du tableau


dans le tableau qui sert à concevoir
le graphique

¾ Insérer une diapositive


- Activer la diapositive après laquelle insérer
la nouvelle diapositive
- &OLTXHUO¶RQJOHW : Accueil
- &OLTXHUO¶RXWLO : Nouvelle diapositive
- Cliquer le type de diapositive à insérer

¾ Créer un graphique
- &OLTXHUO¶REMHW : Graphique
ou
- Onglet : Insertion - FOLTXHUO¶RXWLO : Graphique
- Sélectionner le type de graphique à créer
- Cliquer : OK
- Remplacer les données du tableau prédéfini par vos données personnelles (Réaliser un copié collé à partir
du tableau de la diapositive précédente).

¾ Modifier le type du graphique


- &OLTXHUO¶RQJOHW : Création de la zone : Outils graphique
- &OLTXHUO¶RXWLO : Modifier le type de graphique
- Cliquer le type de graphique à gauche, puis le sous type à droite (Voir page précédente)

¾ Activer le graphique
- Cliquer le graphique

¾ Taille du graphique
- Cliquer-JOLVVHUXQHSRLJQpHG¶DQJOHGHWDLOOH

¾ Disposition des titres et de la légende


- &OLTXHUO¶RQJOHW : Création de la zone : Outils graphique
- Cliquer la disposition désirée dans la zone : Disposition graphique
- Cliquer les titres et saisir le texte
- Déplacer les éléments par cliqué - glissé

¾ Axes (Abscisse/Ordonnée)
- Cliquer-droit l'axe à paramétrer - 0LVHHQIRUPHGHO¶D[H«
- Sélectionner à gauche le bouton de l'élément à modifier
- Paramétrer les modifications désirées dans la zone de droite
- Cliquer : Fermer

Corrigé  :  Maîtriser  Office  2010     Page  124  


¾ Quadrillage
Quadrillage secondaire
- &OLTXHUO¶RQJOHW : Disposition
- &OLTXHUO¶RXWLO : Quadrillage
- Cliquer le type de quadrillage à paramétrer
- &OLTXHUO¶RSWLRQGpVLUpH
Ou
- Cliquer-GURLWO¶D[HDXTXHODMRXWHUXQTXDGULOODJHHWFOLTXHUOHTXDGULOODJHGpVLUp
Paramétrer un quadrillage
- Cliquer-droit le quadrillage à paramétrer - Format du quadrillage
- Sélectionner à gauche le bouton de l'élément à modifier
- Paramétrer les modifications désirées dans la zone de droite
- Cliquer : Fermer
Supprimer un quadrillage
- Cliquer le quadrillage ± [Suppr]

¾ Etiquettes de données
Ajouter des étiquettes de données
- Cliquer-droit la série pour laquelle afficher les étiquettes
- Cliquer : Ajouter des étiquettes de données
Paramétrer les étiquettes de données
- Cliquer-droit les étiquettes à paramétrer
- Cliquer : 0HWWUHHQIRUPHOHVpWLTXHWWHVGHGRQQpHV«
- Sélectionner à gauche : 2SWLRQVG¶pWLTXHWWHV
- Paramétrer dans la zone de droite les options désirées
- Cliquer : Fermer

¾ Bordures et remplissage des aires


- Cliquer droit la série à paramétrer
- Cliquer : Mettre en forme une série de données
- &OLTXHUO¶RSWLRQ désirée : Remplissage ou Styles de bordure
- Réaliser les paramétrages souhaités
- Cliquer : Fermer

¾ Légende
Ajouter ou supprimer
- &OLTXHUO¶RQJOHW : Disposition de la zone : Outils de graphiques
- &OLTXHUO¶RXWLO : Légende
- &OLTXHUO¶RSWLRQGpVLUpH
Déplacer la légende
- Cliquer-glisser la bordure de la légende sur le graphique
Mettre en forme la légende
- Cliquer-droit la légende - )RUPDWGHODOpJHQGH«
- &OLTXHUO¶RQJOHW désiré puis réaliser les modifications
- Cliquer : Fermer

¾ Titres
Ajouter un titre au graphique ou aux axes
- &OLTXHUO¶RQJOHW : Disposition du ruban : Outils de graphiques
- &OLTXHUO¶RXWLO : Titre du graphique ou Titre des axes
- 6pOHFWLRQQHUO¶RSWLRQGpVLUpH
Modifier un titre
- Cliquer le titre à modifier et effectuer la modification
- Cliquer en dehors du bloc du titre
Mettre en forme un titre
- Cliquer-droit le titre à mettre en forme
- Cliquer : 0LVHHQIRUPHGXWLWUH«
- &OLTXHUO¶RSWLRQ désirée dans la zone de gauche puis réaliser les modifications dans la zone de droite
- Cliquer : Fermer

Corrigé  :  Maîtriser  Office  2010     Page  125  


Déplacer un titre
- Cliquer-glisser la bordure du titre à déplacer
Supprimer un titre
- Cliquer le titre à supprimer - [Suppr]

¾ Insérer une diapositive


- Activer la diapositive après laquelle insérer
la nouvelle diapositive
- &OLTXHUO¶RQJOHW : Accueil
- &OLTXHUO¶RXWLO : Nouvelle diapositive
- Cliquer le type de diapositive à insérer

¾ Créer un SmartArt
- &OLTXHUO¶REMHW : Insérer un graphique SmartArt
ou
- Onglet : Insertion - FOLTXHUO¶RXWLO : SmartArt
- Cliquer la catégorie de SmartArt à créer dans la zone de gauche
- Cliquer le SmartArt à créer dans la liste de droite
- Cliquer : OK

¾ Créer un SmartArt
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer l'outil : SmartArt
- Cliquer la catégorie de SmartArt à créer dans la zone de gauche
- Cliquer le SmartArt à créer dans la liste de droite

Corrigé  :  Maîtriser  Office  2010     Page  126  


- Cliquer : OK
- Saisir les textes dans le volet de
texte
Ou
- Cliquer dans les zones de texte et saisir le texte désiré dans le cartouche
- $FWLYHUGpVDFWLYHUOHYROHWGHWH[WHjO¶DLGHGHO¶RXWLO :

¾ Modifier la disposition du SmartArt


- Cliquer le SmartArt puis cliquer dans la zone : Dispositions O¶RSWLRQ
désirée

¾ Modifier la structure du SmartArt


Ajouter une forme
- Cliquer-GURLWO¶pOpPHQWSULQFLSDOGX6PDUW$UW- Ajouter une forme
- 6pOHFWLRQQHUO¶RSWLRQGpVLUpH
Modifier une forme
- Cliquer-droit le SmartArt - Modifier la forme
- Sélectionner la forme désirée
Supprimer une forme
- &OLTXHUO¶pOpPHQWSULQFLSDOGHODIRUPHjVXSSULPHU
- Cliquer [Suppr]
Déplacer une forme
- Cliquer-JOLVVHUODIRUPHjO¶HQGURLWGpVLUp

¾ Gestion du texte
0RGLILHUOHWH[WHG¶XQpOpPHQW
- Cliquer le texte à modifier et réaliser la modification
Paramétrer la mise en forme du texte
- &OLTXHUO¶RQJOHW : Accueil
- 3DUDPpWUHUODPLVHHQIRUPHjO¶DLGHGHVRXWLOVKDELWXHOV

¾ Mettre en forme les cartouches


Modifier le style des cartouches
- &OLTXHUO¶RQJOHW : Création
- Cliquer le SmartArt puis cliquer dans la zone : Styles SmartArt O¶RSWLRQGpVLUpH
Mettre en forme les cartouches
- &OLTXHUO¶RQJOHW : Format des Outils SmartArt
- Cliquer le cartouche à paramétrer ou sélectionner plusieurs cartouches en appuyant sur [Ctrl]
- Utiliser les outils qui correspondent à la mise en forme à réaliser
Modifier les couleurs des éléments
- &OLTXHUO¶RXWLO : Modifier les couleurs
- Sélectionner le jeu de couleur désiré

¾ Mettre en fRUPHO¶DUULqUHSODQGX6PDUW$UW
0LVHHQIRUPHGHO¶DUULqUHSODQ
- Cliquer le SmartArt pour le sélectionner
- &OLTXHUO¶RQJOHW : Format de la zone Outils SmartArt
- Cliquer les options de paramétrage désirées
Modifier la taille du SmartArt
- Cliquer-JOLVVHUXQHSRLJQpHG¶DQJOH
Position et habillage
- Cliquer le SmartArt
- &OLTXHUO¶RQJOHW : Mise en page
- &OLTXHUO¶RXWLO SXLVVpOHFWLRQQHUO¶KDELOODJHGpVLUp

Corrigé  :  Maîtriser  Office  2010     Page  127  


- Positionner par cliqué-JOLVVpOH6PDUW$UWjO¶HQGURLWVRXKDLWp
Ou
- &OLTXHUO¶RXWLO : Position et cliquer la position désirée

'LIIXVHUjO¶pFUDQOHGLDSRUDPD

- Cliquer le mode : Diaporama HQEDVGHO¶pFUDQjGURLWH


Ou
- &OLTXHUO¶RQJOHW : Affichage SXLVO¶RXWLO : Diaporama

- 8WLOLVHUOHFODYLHUSRXUPHWWUHHQ°XYUHOHGLDSRUDPD

4. Sauvegarder le diaporama

- Cliquer l'outil

Corrigé  :  Maîtriser  Office  2010     Page  128  


PowerPoint 2010 ± Entraînement
Dossier 35 ± Animations et transitions
Objectifs x Animations et transitions
Duréex 45¶
Supportx Clé USB ou espace personnel sur le disque dur ou le serveur

Travail à faire :

1. Ouvrir PowerPoint et le fichier : Diaporama associés

2. Paramétrer des animations pour chaque objet affiché sur les diapositives

¾ $QLPHUO¶DIILFKDJHGHVpOpPHQWVG¶XQHdiapositive
- &OLTXHUO¶RQJOHW : Animations

Paramétrer des animations


- Activer la diapositive à traiter
- &OLTXHUO¶REMHWjWUDLWHU EORFGHWH[WHLPDJHREMHWHWF 
- Sélectionner une animation prédéfinie dans la zone : Animer :
Ou
- &OLTXHUO¶RXWLO : Animation personnalisée
- Cliquer le bouton : Ajouter un effet HWVpOHFWLRQQHUGDQVOHVGLIIpUHQWVPHQXVHWVRXVPHQXVO¶DQLPDWLRQj
réaliser
- 3HUVRQQDOLVHUO¶DQLPDWLRQGDQVOD]RQHDX-dessous (début, sens, vitesse)
- Recommencer avec chaque élément à paramétrer

¾ 0RGLILHUO¶RUGUHGHVDQLPDWLRQV
- &OLTXHUGDQVOHYROHWO¶DQLPDWLRQjGpSODFHU
- Cliquer les boutons de réorganisation au bas du volet office

¾ Supprimer des animations


- &OLTXHUOHQXPpURGHO¶DQLPDWLRQVXUODGLDSRVLWLYHjVXSprimer ± [Suppr] ou
cliquer le bouton : Supprimer du volet

¾ 7HVWHUO¶DQLPDWLRQ

- Cliquer le bouton au bas du volet

3. Paramétrer des transitions entre toutes les diapositives

Corrigé  :  Maîtriser  Office  2010     Page  129  


¾ Paramétrer la transition
- &OLTXHUO¶RQJOHW : Transitions
- Cliquer la WUDQVLWLRQGpVLUpHGDQVOHUXEDQG¶RXWLOV

- Ajouter éventuellement un son


- Paramétrer la vitesse de l'effet
- Sélectionner le type de passage :
Manuellement : le passage se fera par un clic ou une action sur le clavier
Automatiquement après : le passage est automatique après la durée spécifiée

- Cliquer éventuellement : Appliquer partout pour appliquer les paramètres de cette diapositive à toutes les
diapositives

¾ Tester la transition

- Cliquer le bouton au bas du volet office

4. Tester le diaporama

¾ 3DUDPpWUHUO¶DIILFKDJHGXGLDSRUDPD
- &OLTXHUO¶RQJOHW : Diaporama
- &OLTXHUO¶RXWLO : Configurer le diaporama
- 6pOHFWLRQQHUOHVRSWLRQVGpVLUpHVHQIRQFWLRQGHO¶XWLOLVDWHXURXGXW\SHG¶XWLOLVDWLRQGXGLDSRUDPD
- Cliquer la case : Exécuter HQFRQWLQXMXVTX¶j(&+$3 pour un affichage en boucle
- Cliquer : OK

5. Imprimer le diaporama complet

Cliquer outil dans la barre : Accès rapide

6. Sauvegarder le diaporama

- Cliquer l'outil

Corrigé  :  Maîtriser  Office  2010     Page  130  


Office 2010 ± Entraînement
Dossier 35 ± Objets et images
Objectifs x Gestion des objets et des images
Durée ¶
Support Clé USB ou espaces personnel sur le disque dur ou le serveur

1. Ouvrir Word

2. Saisir et mettre en forme le document suivant sur deux colonnes :

¾ Saisir le texte
Source du texte : http://webcamus.free.fr/biographie.html

- La saisie et la mise en forme de texte ne pose pas de problèmes particuliers

- &OLTXHUO¶RQJOHW : Mise en forme


- Sélectionner le texte à PHWWUHHQFRORQQH 6LYRXVQHVpOHFWLRQQHUSDVXQWH[WHHWVLYRXVQ¶DYH]SDVGpILQLW
XQHVHFWLRQOHPXOWLFRORQQDJHVHUDDSSOLTXpjO¶LQWpJUDOLWpGXWH[WH 
- &OLTXHUO¶RXWLO : Colonnes et sélectionner le nombre de colonnes à créer

Photo : La photo à éWp SULVH VXU O¶,QWHUQHW SDU FRSLp FROOp (OOH HVW KDELOOpH SDU OH WH[WH DYHF DMRXW
G¶XQHERUGXUHHWG¶XQHIIHWRPEUp

¾ ,QVpUHUO¶LPDJH
6RXUFHGHO¶LPDJH : http://increvablesanarchistes.org/album_photo/photbiographie/camus.jpg
- ,PSRUWHUO¶LPDJHSDUFRSLpFROOpjSDUWLUG¶,QWHUQHW
- &OLTXHUO¶LPDJHjhabiller avec du texte
- &OLTXHUO¶RXWLO
- Cliquer l'option : Carré ou Rapproché
- Cliquer-JOLVVHUO¶LPDJH au milieu du texte
- 0RGLILHUpYHQWXHOOHPHQWOHSDUDPpWUDJHGHVFRXSXUHVGHPRWVDILQTX¶LOQ¶\DLWSDVG¶HVSDFHVWURS
importants entre les mots.

Paramétrage
Titre  'DQV XQ REMHW j DQJOHV DUURQGLV DYHF GX WH[WH j O¶LQWpULHXU /H IRQG HVW GpJUDGp 8Q effet
G¶RPEUHDUULqUHDpWpDMRXWp

¾ Tracer un objet
- &OLTXHUO¶RQJOHW : Insertion
- &OLTXHUO¶RXWLO : Formes puis cliquer au dessous la forme à tracer
- Cliquer-glisser sur la feuille (Pour tracer un cercle ou un carré, appuyer sur la touche [Maj] en traçant
l'objet.)
- Cliquer glisser le cadre au dessus du texte
- Cliquer-droit le cadre ± Ajouter du texte
- Saisir et mettre en forme le texte

¾ Remplissage
- Cliquer le bouton
- &OLTXHUHWSDUDPpWUHUO¶RSWLRQGpVLUpH

¾ Contour
- Cliquer le bouton :
- &OLTXHUHWSDUDPpWUHUO¶RSWLRQGpVLUpH

Corrigé  :  Maîtriser  Office  2010     Page  131  


¾ (IIHWG¶RPEUHHW'
- &OLTXHUO¶REMHWjWUDLWHU
- Cliquer et paramétrer les effets désirés dans la
zone : (IIHWVG¶RPEUH et Effets 3D

3. Imprimer le document

4. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous le nom Albert Camus.

Corrigé  :  Maîtriser  Office  2010     Page  132  


Office 2010 ± Entraînement
Dossier 36 - WordArt et SmartArt
x Paramétrer des WordArts
Objectifs
x Paramétrer des SmartArts
Durée ¶
Support Clé USB ou espace personnel sur le disque dur ou le serveur

1. Ouvrir Word

2. Saisir et mettre en forme le document suivant (Source du texte : http://www.cterrier.com)

- Saisir et mettre en forme le texte de base

Corrigé  :  Maîtriser  Office  2010     Page  133  


WordArt
¾ Créer un WordArt
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer l'outil : WordArt
- Saisir le texte du WordArt : La communication interpersonnelle
- Cliquer : OK
=> Le ruban : Format est activé :

¾ Modifier le texte
- Cliquer dans le WordArt
- Réaliser les modifications désirées dans la fenêtre de saisie

¾ Modifier le style du texte du WordArt


Couleur du texte
- Cliquer le WordArt puis cliquer dans la zone Styles WordArt la
couleur prédéfini
Ou
- &OLTXHUO¶RXWLO : Remplissage de texte et sélectionner une couleur
Bordure du texte
- &OLTXHUO¶RXWLO : Contour du texte et paramétrer la bordure désirée

¾ Modifier la couleur GHO¶DUULqUHSODQdu WordArt


Remplissage
- Cliquer le WordArt puis cliquer dans la zone Styles de formes
O¶DUULqUH-plan prédéfini
Ou
- &OLTXHUO¶RXWLO : Remplissage de forme et paramétrer le remplissage désiré

¾ Paramétrer la forme du texte

- &OLTXHUOHERXWRQGpURXODQWGHO¶RXWLO - Transformer
- Cliquer la forme désirée

¾ Taille, rotation et forme


- Le WordArt affiche un certain nombre de boutons qui permettent des paramétrer la taille, la rotation et la
forme. Pour les modifier il suffit de les cliquer-glisser

¾ 3DUDPpWUHUXQHIIHWG¶RPEUHRX'
- Le paramétrage est identique à celui des autres objets (Voir 4.3 page 327)

¾ Position et habillage
- Le paramétrage est identique à celui des autres objets (Voir 6.2 et 6.3 page 330)

Corrigé  :  Maîtriser  Office  2010     Page  134  


SmartArt
¾ Créer un SmartArt
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer l'outil : SmartArt
- Cliquer la catégorie de SmartArt à créer dans la zone de gauche
- Cliquer le SmartArt à créer dans la liste de droite
- Cliquer : OK
- Saisir les textes dans le volet de
texte
Ou
- Cliquer dans les zones de texte et saisir le texte désiré dans le cartouche
- $FWLYHUGpVDFWLYHUOHYROHWGHWH[WHjO¶DLGHGHO¶RXWLO :

¾ Modifier la disposition du SmartArt


- Cliquer le SmartArt puis cliquer dans la zone : Dispositions O¶RSWLRQGpVLUpH

¾ Modifier la structure du SmartArt


Ajouter une forme
- Cliquer-GURLWO¶pOpPHQWSULQFLSDOGX6PDUW$UW- Ajouter une forme
- 6pOHFWLRQQHUO¶RSWLRQGpVLUpH
Modifier une forme
- Cliquer-droit le SmartArt - Modifier la forme
- Sélectionner la forme désirée
Supprimer une forme
- &OLTXHUO¶pOpPHQWSULQFLpal de la forme à supprimer
- Cliquer [Suppr]
Déplacer une forme
- Cliquer-JOLVVHUODIRUPHjO¶HQGURLWGpVLUp

¾ Gestion du texte
0RGLILHUOHWH[WHG¶XQpOpPHQW
- Cliquer le texte à modifier et réaliser la modification
Paramétrer la mise en forme du texte
- &OLTXHUO¶RQJOHW : Accueil
- 3DUDPpWUHU OD PLVH HQ IRUPH j O¶DLGH GHV RXWLOV
habituels

¾ Mettre en forme les cartouches


Modifier le style des cartouches
- &OLTXHUO¶RQJOHW : Création
- Cliquer le SmartArt puis cliquer dans la zone : Styles SmartArt O¶RSWLRQGpVLUpH
Mettre en forme les cartouches
- &OLTXHUO¶RQJOHW : Format des Outils SmartArt
- Cliquer le cartouche à paramétrer ou sélectionner plusieurs cartouches en appuyant sur [Ctrl]
- Utiliser les outils qui correspondent à la mise en forme à réaliser
Modifier les couleurs des éléments
- &OLTXHUO¶RXWLO : Modifier les couleurs
- Sélectionner le jeu de couleur désiré

¾ 0HWWUHHQIRUPHO¶DUULqUHSODQGX6PDUW$UW
0LVHHQIRUPHGHO¶DUULqUHSODQ
- Cliquer le SmartArt pour le sélectionner
- &OLTXHUO¶RQJOHW : Format de la zone Outils SmartArt
- Cliquer les options de paramétrage désirées

Corrigé  :  Maîtriser  Office  2010     Page  135  


Modifier la taille du SmartArt
- Cliquer-JOLVVHUXQHSRLJQpHG¶DQJOH
Position et habillage
- Cliquer le SmartArt
- &OLTXHUO¶RQJOHW : Mise en page
- CliquHUO¶RXWLO SXLVVpOHFWLRQQHUO¶KDELOODJHGpVLUp

- Positionner par cliqué-JOLVVpOH6PDUW$UWjO¶HQGURLWVRXKDLWp


Ou
- &OLTXHUO¶RXWLO : Position et cliquer la position désirée

3. Imprimer le document

4. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous le nom : Communication interpersonnelle.

Corrigé  :  Maîtriser  Office  2010     Page  136  


Word 2010 ± Entraînement
Dossier 37 : Import-Export / Copier-coller
Objectifs x Créer des documents composites avec tableau et graphique Excel
Durée ¶
Support Clé USB ou espaces personnel sur le disque dur ou le serveur

1. Ouvrir Excel puis saisir et mettre en forme le tableau et le graphique qui seront à importer dans le
rapport Word

2. Imprimer le tableau et le graphique

3. Sauvegarder le document Excel dans le dossier Maîtriser Office 2010 du serveur, du dossier
Document ou de la clé USB sous le nom Rapport trimestriel données

4. Ouvrir Word

4.1 Saisir et mettre en forme le texte

4.2 Importer le tableau et le graphique conçus sous Excel par copié-collé avec lien OLE. Le
document terminé doit se présenter comme sur la page précédente.

- Mettre en forme les données à copier sur Excel (tableau ou graphique)


- Sélectionner le tableau ou cliquer le graphique à copier
- Cliquer l'outil ou clique-droit - Copier ou [Ctrl] + [C]
- Charger le fichier Word destination
- Cliquer l'endroit où coller les données
- Cliquer le bouton déroulaQWGHO¶RXWLO : Coller - Collage spécial...
- Cliquer le type d'objet à coller : Feuille Microsoft office Excel Objet
- Activer le bouton : Coller avec liaison :

- Cliquer : OK ou [Entrée]

Corrigé  :  Maîtriser  Office  2010     Page  137  


5. Imprimer le document terminé

6. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous le nom : Rapport trimestriel.

Corrigé  :  Maîtriser  Office  2010     Page  138  


Word 2010 ± Entraînement
Dossier 38 : Internet
Objectifs x Créer des pages Web et les relier par des liens hypertextes
Durée ¶
Support Clé USB ou espaces personnel sur le disque dur ou le serveur

1. Ouvrir Word puis saisir et mettre en forme les quatre pages Web suivantes

2. Sauvegarder chaque page dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous les noms suivants : Site_accueil, site_historique, site_activite, site_magasins

Remarque :
- Placer le texte dans un tableau des deux colonnes par deux lignes
- Ne pas saisir le texte des liens hypertextes, ils seront affichés lorsque les liens seront créés.

x Site_accueil

x Site_historique

x Site_activite

Corrigé  :  Maîtriser  Office  2010     Page  139  


x Site_magasin

3. Imprimer chaque page

4. Relier chaque page avec les trois autres par des liens hypertextes placés dans la colonne de
gauche

- Concevoir les documents à relier par des liens hypertextes et les enregistrer dans un
même dossier
- &OLTXHUO¶RQJOHW : Insertion
- Cliquer l'outil : Lien hypertexte

- Ouvrir le dossier et sélectionner le fichier


à activer à partir du fichier ouvert
- Cliquer : OK

5. Imprimer les documents terminés

6. Sauvegarder les documents

Corrigé  :  Maîtriser  Office  2010     Page  140  


Word 2010 ± Entraînement (1)
Dossier 39 : Travail collaboratif
Objectifs Partager un classeur
Durée ¶
Support Clé USB ou espaces personnel sur le disque dur ou le serveur

1. Saisir, mettre en forme et imprimer le document suivant sur Word

2. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous les noms suivants : Congés payé original

3. Fermer le document

4. Saisir, mettre en forme et imprimer le document suivant :

5. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous les noms suivants : Congés payés 2

6. Fermer le document

Corrigé  :  Maîtriser  Office  2010     Page  141  


7. Ouvrir le document : Congés payés original

8. Comparer les documents Congés payés original et Congés payés 2

- &OLTXHUO¶RQJOHW : Révision
- &OLTXHUO¶RXWLO : Comparer SXLVO¶RSWLRQ : Combiner
- Sélectionner le GRFXPHQWRULJLQDOHWVDLVLUpYHQWXHOOHPHQWOHQRPGHO¶DXWHXU

- Sélectionner le GRFXPHQWjFRPSDUHUDXSUpFpGHQWHWVDLVLUpYHQWXHOOHPHQWOHQRPGHO¶DXWHXU
- Cliquer : OK
=> Word affiche un document de synthèse qui met en évidence les différences par un trait vertical dans la
marge et la mise en couleur les différences entre les documents

9. Accepter les corrections

- Cliquer-GURLWFKDTXHPRGLILFDWLRQHWFOLTXHUO¶RSWLRQGpVLUpH : Accepter la modification ou Refuser la


modification
Ou
- &OLTXHUO¶RXWLOTXLFRUUHVSRQGjO¶DFWLRQGpVLUpe
=> Lorsque toutes les modifications sont traitées il ne reste plus de marque de
modification

- Sauvegardé le document terminé

10. Sauvegarder le document définitif dans le dossier Maitriser Office 2010 du serveur, du dossier
Document ou de la clé USB sous les noms suivants : Congés payés définitif

11. Imprimer le document définitif

Corrigé  :  Maîtriser  Office  2010     Page  142  


Excel 2010 ± Entraînement (2)
Dossier 39 : Travail collaboratif
Objectifs Combiner deux documents
Durée ¶
Support Clé USB ou espaces personnel sur le disque dur ou le serveur

1. Saisir, mettre en forme et imprimer le document suivant sur Excel

2. Partager le classeur
- Ouvrir le classeur à partager
- &OLTXHUO¶RQJOHW : Révision
- &OLTXHUO¶RXWLO : Partager le classeur
- Activer la case : 3HUPHWWUHOHVPRGLILFDWLRQVPXOWLXWLOLVDWHXU«
- Cliquer : OK
- Sauvegarder le document en un lieu accessible à tous (serveur de réseau par exemple)

3. Sauvegarder le document dans le dossier Maitriser Office 2010 du serveur, du dossier Document
ou de la clé USB sous les noms suivants : Objectifs représentants

4. Fermer le document

1RXV DOORQV SDUDPpWUHU GHX[ VpULHV G¶REMHFWLIV VRXV GHX[ QRPV G¶XWLOLVDWHXUV GLIIpUHQWV SXLV
nous fusionnerons les résultats

Collaborateur 1

5. Ouvrir le document Objectifs représentants et saisir les objectifs suivant :

5. Sauvegarder le document

7. Fermer le document

Collaborateur 2

&KDQJHUYRWUHQRPG¶XWLOLVDWHXUVRXV([FHOHWVDLVLUXQQRPILFWLI 9RLU

- Ouvrir le classeur

- Cliquer le bouton Office ± Options Excel


- &OLTXHUO¶RSWLRQ : Standard
- 6DLVLUYRWUHQRPG¶XWLOLVDWHXU(Ce nom sera accolé aux modifications affichées

9. Ouvrir le document Objectifs représentants et saisir les objectifs suivant :

10. Sauvegarder le document

11. Fermer le document

Corrigé  :  Maîtriser  Office  2010     Page  143  


Mise en commun des modifications

12. Afficher les modifications

- 2XYULUOHFODVVHXUD\DQWIDLWO¶REMHWGHPRGLILFDWLRQVPXOWLSOHV
- &OLTXHUO¶RQJOHW : Révision
- &OLTXHUO¶RXWLO SXLVO¶RSWLRQ : Afficher les
PRGLILFDWLRQV«
- Paramétrer les modifications à afficher
- Cliquer : OK

13. Activer la fonction accepter ou refuser les modifications

- &OLTXHUO¶RXWLO SXLVO¶RSWLRQ : $FFHSWHURXUHIXVHUOHVPRGLILFDWLRQV«


- Paramétrer les modifications à afficher
- Cliquer : OK
=> /DSUHPLqUHFHOOXOHIDLVDQWO¶REMHWG¶XQHPRGLILFDWLRQHVWDFWLYpHHWXQHIHQrWUHDIILFKHOHVPRGLILFDWLRQV
réalisées :

14. Valider toutes les modifications avec les objectifs les plus hauts

- Sélectionner la modification à conserver puis cliquer le bouton : Accepter


- Recommencer pour chaque cellule modifiée
=> Lorsque toutes les modifications sont traitées le document est affiché.

Tableau terminé

'pVDFWLYHUO¶DIILFKDJHGHVPRGLILFDWLRQV

- Ouvrir le classeur à partager


- &OLTXHUO¶RQJOHW : Révision
- &OLTXHUO¶RXWLO : Partager le classeur
- Désactiver la case : 3HUPHWWUHOHVPRGLILFDWLRQVPXOWLXWLOLVDWHXU«
- Cliquer : OK
- Cliquer : Oui dans la fenêtre de confirmation

16. Imprimer puis sauvegarder le document

Corrigé  :  Maîtriser  Office  2010     Page  144  


Dossier 40 : Windows live skydrive
Entraînement (1)
Objectifs x Créer un document sur office Apps
Durée ¶
Support Aucun

1. Créer un compte personnel Windows Live Skydrive

- Activer internet
- Se connecter au site Windows Live Skydrive : http://explore.live.com/windows-live-skydrive
- Cliquer le bouton : ,QVFULYH]YRXV«

- Saisir les caractéristiques de votre compte :


0HOLGHQWLWpHWF LOHVWSRVVLEOHG¶XWLOLVHU
une adresse mel personnelle)
- Saisir le code de sécurité
- Cliquer le bouton : -¶DFFHSWH
=> Un mel est envoyé à votre adresse
personnelle

- Ouvrir votre boite mel et cliquer le lien de


confirmation
!/¶pFUDQGH6N\GULYHGHYLHQWDFWLI
- Cliquer : OK
=> Un dossier : Mes documents est
affiché

- Double-FOLTXHUOHGRVVLHUSRXUO¶RXYULU

2. Activer le module de gestion des documents

$FWLYHUO·(VSDFH6N\GULYH
- Activer internet
- Se connecter au site Windows Live Skydrive : http://explore.live.com/windows-live-skydrive
- Cliquer le bouton : Se connecter HQKDXWjGURLWHGHO¶pFUDQ

- Cliquer votre compte personnel


- Saisir votre mot de passe
- Cliquer le bouton : se connecter
!8QHIHQrWUHG¶DVVLVWDQFHHVWpYHQWXHOOHPHQWDIILFKpHHOOHSUpVHQWHWRXWHVOHVRSWLRQVGLVSRQLEOHV :

Corrigé  :  Maîtriser  Office  2010     Page  145  


- Cliquer le bouton : Se connecter
=> Les fonctions disponibles sont accessibles par les boutons situés en haut de la page :

6N\GULYHHVWXQHVSDFHHQOLJQHFHTXLH[SOLTXHFHUWDLQVWHPSVG¶DWWHQWHORUVGHVRSpUDWLRQVG¶RXYHUWXUHVGHGRVVLHUVRX
de fichiers par exemple.

3. Créer un dossier : Fichier personnel

- Cliquer le bouton : Nouveau - Dossier


- Saisir le nom du dossier
- Cliquer : Créer un dossier

4. Créer le document : Définition Coud computing sous Word Apps

x Créer un nouveau document avec Office Web App


- Cliquer le bouton : Nouveau et sélectionner O¶DSSOLFDWLRQjXWLOLVHU
- Saisir le nom du document ± cliquer : Enregistrer

!/¶DSSOLFDWLRQHVWRXYHUWHHQOLJQH Son fonctionnement HVWFRPSDUDEOHjFHOOHTXLHVWVXUO¶RUGLQDWHXU


avec cette différence, cependant que les fonctionnalités sont réduites.

Corrigé  :  Maîtriser  Office  2010     Page  146  


5. Saisir et mettre en forme le texte suivant sur Word Apps

Cloud computing
Source : Wikipedia.org
Le Cloud computing consiste à déporter sur des serveurs distants des traitements informatiques traditionnellement
localisés sur le poste Client de l'utilisateur. Ce concept est vu comme une évolution majeure par certains analystes, ou
comme un piège marketing fumeux par d'autres.
Le journal officiel a précisé que le cloud computing est une forme particulière de gérance de l'informatique, puisque
l'emplacement des données dans le nuage n'est pas porté à la connaissance des clients.
Les utilisateurs ou les entreprises ne sont plus gérants de leurs serveurs informatiques mais peuvent ainsi accéder de
manière évolutive à de nombreux services en ligne sans avoir à gérer l'infrastructure sous-jacente, souvent complexe.
Les applications et les données ne se trouvent plus sur l'ordinateur local, mais ± métaphoriquement parlant ± dans un
nuage (« cloud ») composé d'un certain nombre de serveurs distants interconnectés au moyen d'une excellente bande
passante indispensable à la fluidité du système. L'accès au service se fait par une application standard facilement
disponible, la plupart du temps un navigateur Web.

6. Imprimer le document

x Imprimer un document
- &OLTXHUO¶RQJOHW : Fichier ± Imprimer

Corrigé  :  Maîtriser  Office  2010     Page  147  


Dossier 40 : Windows live skydrive
Entraînement (2)
Objectifs x Créer un groupe de travail sur Windows Live Skydrive
Durée ¶
Support Aucun

Travail  préparatoire  à  la  création  du  groupe  de  travail  


1.  Créer  un  groupe  de  trois  ou  quatre  personnes  
Ϯ͘ŚĂƋƵĞŵĞŵďƌĞĚƵŐƌŽƵƉĞĚŽŝƚĚŝƐƉŽƐĞƌĚ͛ƵŶĐŽŵƉƚĞŚŽƚŵĂŝů͘  
x Si  un  membre  ne  possède  pas  de  compte,  créer  un  compte  personnel  sur  hotmail͘>ĂĐƌĠĂƚŝŽŶĚ͛ƵŶĐŽŵƉƚĞ
Hotmail  Ŷ͛ĞŶƚƌĂŝŶĞĂƵĐƵŶĞĐŽŶƐĠƋƵĞŶĐĞƉĂƌƚŝĐƵůŝğƌĞ͘>͛ŽƉĠƌĂƚŝŽŶĞƐƚŐƌĂƚƵŝƚĞĞƚĂƵĐƵŶĞŝŶĨŽƌŵĂƚŝŽŶĐŽŶĨŝĚĞŶƚŝĞůůĞ
ne  vous  est  réclamée.    
3.  Nommer  un  administrateur  (responsable)  du  groupe  
ϰ͘>ĞŐƌŽƵƉĞĚŽŝƚƐĞĚŽŶŶĞƌƵŶŶŽŵƉŽƵƌƉŽƵǀŽŝƌů͛ƵƚŝůŝƐĞƌůŽƌƐĚĞůĂĐƌĠĂƚŝŽŶĚƵ'ƌŽƵƉĞ  
 
ƌĠĂƚŝŽŶĚƵŐƌŽƵƉĞƉĂƌů͛ĂĚŵŝŶŝƐƚƌĂƚĞƵƌ  (Les  autres  membres  regardent)  
ϱ͘>͛ĂĚŵŝŶŝƐƚƌĂƚĞƵƌĚƵŐƌŽƵƉĞĚŽŝƚĐƌĠĞƌƵŶŐƌŽƵƉĞƐŽƵƐWindows  Live  Skydrive  en  utilisant  le  nom  défini  
ĚĂŶƐ ů͛ĠƚĂƉĞ ƉƌĠĐĠĚĞŶƚĞ et   doit   inviter   les   autres   personnes   à   rejoindre   le   groupe   en   saisissant   les  
adresses  mèls  de  ces  personnes  

- Cliquer le lien : Office ± Vos groupes

- Cliquer le lien : Créer un groupe

- Saisir le nom du groupe


!/¶DGUHVVHPHOGXJURXSHVHUD : groupe@groups.live.com

- Saisir ou sélectionner les mels des


personnes invitées à rejoindre le groupe
puis cliquer : Créer

- Confirmer le nom du responsable du groupe ± Enregistrer


=!/HVLQYLWDWLRQVVRQWHQYR\pHVjFKDTXHSHUVRQQHGRQWO¶DGUHVVHPHODpWpLQGLTXpSUécédemment.
Chaque personne invitée, doit ouvrir sa boite mel et cliquer le bouton : Afficher le groupe.
 
 
 

Corrigé  :  Maîtriser  Office  2010     Page  148  


 
Formation  du  groupe  (ů͛ĂĚŵŝŶŝƐƚƌĂƚĞƵƌ  regarde)  
 
ϲ͘ŚĂƋƵĞŵĞŵďƌĞĚƵŐƌŽƵƉĞĚŽŝƚŽƵǀƌŝƌƐŽŶDĞůĞƚĂĐĐĞƉƚĞƌů͛ŝŶǀŝƚĂƚŝŽŶăƌĞũŽŝŶĚƌĞůĞŐƌŽƵƉĞ(Attention  
ŽƵǀƌŝƌůĂƚĞŵğůƋƵŝĂĠƚĠƵƚŝůŝƐĠĞƉĂƌů͛ĂĚŵŝŶŝƐƚƌĂƚĞƵƌĚĂŶƐƐŽŶŝŶǀŝƚĂƚŝŽŶͿ  
 
- Chaque personne invitée, doit ouvrir sa boite mel et cliquer le bouton : Afficher le groupe.
 
Utilisation  du  groupe  (chaque  membre  est  sur  son  propre  ordinateur  connecté  au  groupe  Skydrive)  
8.  Chaque  membre  doit  accéder  au  groupe  Skydrive  

- Cliquer le lien : Office ± Vos groupes


- Cliquer le groupe auxquel se connecter

9.  Chaque  membre  doit  importer   dans  le  groupe  un  fichier  de  son  choix  (Sélectionner  un   fichier  Word,  
Excel  ou  image  de  taille  raisonnable)  
 
- Cliquer le lien : Télécharger ou créer des documents
- Cliquer : Ajouter des fichiers
- Cliquer le bouton : Parcourir HWVpOHFWLRQQHUO¶XQLWpOHGRVVLHUSXLVOHILFKLHUVRXUFH
- Cliquer : Télécharger
 
ϭϬ͘ŚĂƋƵĞŵĞŵďƌĞĚŽŝƚŽƵǀƌŝƌĚĞƐĨŝĐŚŝĞƌƐƚƌĂŶƐĨĠƌĠƐƉĂƌĚ͛ĂƵƚƌĞƐŵĞŵďƌĞƐĚƵŐƌŽƵƉĞ  

- Cliquer le fichier à ouvrir


 
11. Quitter le groupe de travail

Corrigé  :  Maîtriser  Office  2010     Page  149  


Dossier 40 : Windows live skydrive
Entraînement (3)
Objectifs x Créer et gérer un calendrier personnel sur Skydrive
Durée ¶
Support Aucun

1. Si vous ne possédez pas de mèl, créer un mèl personnel sur Hotmail ou sur un autre compte
2. Accéder à Skydrive et créé un compte personnel
/DFUpDWLRQG¶XQFRPSWHQ¶HQWUDLQHDXFXQHFRQVpTXHQFHSDUWLFXOLqUH/¶RSpUDWLRQHVWJUDWXLWHHWDXFXQH
information confidentielle ne vous est réclamée.

3. Agenda personnel
3.1 Activer votre calendrier

- Ouvrir votre compte Skydrive


- &OLTXHUO¶RSWLRQ : Hotmail - Calendrier

3.2 Paramétrer le calendrier selon votre convenance

- Cliquer le lien : Options (en haut à droite)


- Modifier les paramètres
- Cliquer : Enregistrer

x 0RGLILHUO¶DIILFKDJH
- &OLTXHUO¶RQJOHWTXLFRUUHVSRQGjO¶DIILFKDJHVRXKDLWp
- faire défiler les périodes

x Modifier la couleur
- Cliquer le nom du calendrier dans le volet de gauche
- Modifier les paramètres du calendrier
- Cliquer : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  150  


3.3 Saisir les événements suivants dans votre calendrier personnel

- Saisir le QRPGHO¶pYpQHPHQWSXLVOHOLHX
- 6pOHFWLRQQHUO¶DJHQGDFRQFHUQpSDUO¶pYpQHPHQW

- Paramétrer la date et la durée


- 3RXUSDUDPpWUHUXQHSpULRGLFLWpRXXQUDSSHODYDQWO¶KHXUH
cliquer le lien : Ajouter plus de détails

- Paramétrer la périodicité éventuelle


- Cliquer : Enregistrer
x Modifier un événement
- &OLTXHUO¶pYpQHPHQW- 0RGLILHUO¶pYpQHPHQW
- Cliquer : Enregistrer
x Supprimer un événement
- &OLTXHUO¶pYpQHPHQWjVXSSULPHUHQGHKRUVGXWLWUH
- &OLTXHUO¶RSWLRQ : Supprimer dans la barre des menus
- Cliquer : Supprimer

re
1 semaine de janvier
x Le mercredi de 8 h à 10 h réunion de coordination du salon
x Le mercredi 11 h rendez-vous avec M. Houdon
x 5HQFRQWUHGHO¶DUFKLWHFWHSRXUSDUOHUGXSURMHWG¶RXYHUWXUHG¶XQPDJDVLQj0DUVeille le jeudi après-
midi à partir de 14 h
x Vendredi à 16 h tirer les rois avec le personnel de la société. Programmer un rappel par Pop-Up 30
PLQXWHVDYDQWO¶KHXUH&RPPDQGHUODYHLOOHJDOHWWHVDXSUqVGHODSkWLVVHULH*HUEHG¶RU
e
2 semaine de janvier
e
x Tous les lundis matin à partir de la 2 semaine : réunion de coordination commerciale de 9 h à 10 h
MXVTX¶DXMXLQ
x Tous les mardis matin de 8 h à 10 h réunion de coordination avec le DAF (Directeur Administratif et
Financier) et avec le responsable de production
x Mardi à midi repas avec le représentant de la société Grivel. (Durée 3 heures)
o Réserver la veille 4 places dans le restaurant l¶(OLWHGHVERLV
o Envoyer un Mel de confirmation à la société Grivel la veille, en fin de journée, par Mel.
x Jeudi 6RXKDLWHUO¶DQQLYHUVDLUHGHODVHFUpWDLUHjK3URJUDPPHUXQUDSSHOSDU3RS-Up 30
PLQXWHVDYDQWO¶KHXUH

Fin janvier
er
x Du 1 au 7 février 6DORQGHO¶KDELWDWHWGHODGpFRUDWLRQj9DOHQFH 3ODQLILHUYRWUHSUpVHQFHVXUOH
stand en dehors des réunions habituelles)
x ,QVWDOODWLRQGXVWDQGOHVWURLVMRXUVRXYUpVTXLSUpFpGHQWO¶RXYHUWXUHGXVDORQ. Prévoir votre présence
les deux après-midi précédents.

4. Imprimer les pages de janvier et février

- $IILFKHUjO¶pFUDQODSpULRGHjLPSULPHU
- Cliquer O¶RXWLO Imprimer
- Cliquer le menu : Imprimer

Corrigé  :  Maîtriser  Office  2010     Page  151  


Dossier 40 : Windows live skydrive
Entraînement (4)
Objectifs x Créer et gérer un calendrier du groupe sur Skydrive
Durée ¶
Support Aucun

1. Chaque élève ou pWXGLDQWGRLWFRPPXQLTXHUDX[GHX[DXWUHVO¶DGUHVVH0HOTXLOXLjVHUYL


à créer son calendrier

2. Chaque élève ou étudiant ouvre son calendrier personnel sur son ordinateur

3. Chaque élève ou pWXGLDQW GRLW DXWRULVHU OH SDUWDJH GH VRQ FDOHQGULHU DYHF G¶DXWUHV
personnes et autoriser les modifications de son calendrier par les autres

- Cliquer le menu : Partager


- Cliquer le calendrier à partager
- Activer la case : Partager ce calendrier

- Cliquer le bouton : Ajouter


- Saisir les adresses mel des personnes avec qui partager votre calendrier
- Indiquer la nature du partage (lecture, lecture + modification, etc.)
- Recommencer pour chaque personne invitée
- Cliquer : Enregistrer
=> Chaque personne doit ouvrir sa boîte mel et axccepter le partage de calendrier.

4. Affecter à chaque calendrier une couleur différente

- Cliquer le nom du calendrier dans le volet


de gauche
- Modifier les paramètres du calendrier
- Cliquer : Enregistrer

Corrigé  :  Maîtriser  Office  2010     Page  152  


5. Les trois personnes doivent se répartir les rôles (Numéro de collègue) et enregistrer
dans son calendrier personnel les événements donnés ci-dessous

- 6DLVLUOHQRPGHO¶pYpQHPHQWSXLVOHOLHX
- 6pOHFWLRQQHUO¶DJHQGDFRQFHUQpSDUO¶pYpQHPHQW

- Paramétrer la date et la durée


- 3RXUSDUDPpWUHUXQHSpULRGLFLWpRXXQUDSSHODYDQWO¶KHXUH
cliquer le lien : Ajouter plus de détails

- Paramétrer la périodicité éventuelle


- Cliquer : Enregistrer
x Modifier un événement
- &OLTXHUO¶pYpQHPHQW- 0RGLILHUO¶pYpQHPHQW
- Cliquer : Enregistrer
x Supprimer un événement
- &OLTXHUO¶pYpQHPHQWjVXSSULPHUHQGHKRUVGXWLWUH
- &OLTXHUO¶RSWLRQ : Supprimer dans la barre des menus
- Cliquer : Supprimer

Collègue 1
re
1 semaine de mars
x Mardi à 8 h rencontre avec le client Santin (Prévoir 2 heures)
x Mercredi après-midi visite des clients de Privas
x Jeudi visite des clients de Valence

Collègue 2
re
1 semaine de mars
x Mardi de 8 h à 14 h rencontre avec le responsable du service recherche et développement pour
étudier les nouveaux produits
x Mercredi de 8 h à 10 h réunion avec le responsable de production
x Jeudi : rencontre avec le fournisseur Caron

Collègue 3
re
1 semaine de mars
x 0DUGLGHKjKUHQFRQWUHDYHFO¶H[SHUW-comptable + repas au restaurant à midi
x Mercredi rencontre avec le responsable des achats de 14 h à 16 h
x 9R\DJHG¶DIIDLUHj3DULVOHMHXGLHWOHYHQGUHGL
x

6. Fermer les trois calendriers

- Cliquer : Office ± Vos groupes

Corrigé  :  Maîtriser  Office  2010     Page  153  


7. Ouvrir les trois calendriers et fixer un rendez-vous de deux heures commun aux trois
personnes dans la VHPDLQHjO¶H[FHSWLRQGXOXQGL

- Activer ou désactiver les calendriers à afficher dans le volet de gauche

8. Chaque élève ou étudiant doit imprimer son calendrier personnel

- $IILFKHUjO¶pFUDQODSpULRGHjimprimer
- &OLTXHUO¶RXWLO Imprimer
- Cliquer le menu : Imprimer

9. Fermer les calendriers

- Cliquer : Office ± Vos groupes

Corrigé  :  Maîtriser  Office  2010     Page  154