Vous êtes sur la page 1sur 26

Rec. UIT-R BT.

1614 1

RECOMMANDATION UIT-R BT.1614

Identification de la charge utile vidéo pour interfaces


de télévision numérique
(Question UIT-R 20/6)
(2003)

L'Assemblée des radiocommunications de l'UIT,


considérant
a) que de nombreux pays se dotent actuellement d'installations de production de télévision
numérique à composantes vidéo numériques conformes aux prescriptions figurant dans les
Recommandations UIT-R BT.601, UIT-R BT.656, UIT-R BT.709 et UIT-R BT.799;
b) que l'on installe actuellement des systèmes de production de télévision à haute définition
(TVHD) utilisant des interfaces TVHD numériques conformes aux prescriptions figurant dans la
Recommandation UIT-R BT.1120;
c) qu'un signal conforme aux prescriptions de la Recommandation UIT-R BT.1120 a la
capacité nécessaire pour acheminer d'autres formats source sur ces connexions numériques série;
d) que l'on peut tirer des avantages en termes d'exploitation et de coûts de l'utilisation d'une
infrastructure unique pour l'acheminement de divers formats source;
e) qu'il est nécessaire d'identifier les charges utiles acheminées sur une interface qui peut être
utilisée pour de multiples formats source,
recommande
d'utiliser l'identification de charge utile vidéo définie dans la norme SMPTE 352M-2002 «Video
Payload Identification for Digital Interfaces» pour spécifier le format source particulier en cours de
transmission sur l'interface numérique série à haute définition conforme à la Recommandation
UIT-R BT.1120.
NOTE 1 – La norme SMPTE 352M comporte une référence normative à la norme SMPTE 296M
«1280 × 720 Progressive Image Sample Structure – Analog and Digital Representation and Analog
Interface». Les formats suivants énumérés dans le Tableau 1 de cette norme ne sont pas considérés
comme faisant partie de la présente Recommandation:

Elément du Tableau 1 Désignation du système Fréquence d'image


3 1280 × 720/50 50
6 1280 × 720/25 25
7 1280 × 720/24 24
8 1280 × 720/23,98 24/1,001

Note du Secrétariat: La norme SMPTE 352M-2002, dont la version électronique était disponible sur un site
web, a été annexée au texte de la présente Recommandation.
2 Rec. UIT-R BT.1614

La norme SMPTE 352M contient une référence normative à la norme SMPTE 292M «Bit-Serial
Digital Interface for High-Definition Televisions Systems». Le format 1250 lignes/50 Hz indiqué
dans la colonne C du Tableau 1 de cette norme SMPTE 292M n'est pas considéré comme faisant
partie de la présente Recommandation.
La norme SMPTE 352M contient une référence normative aux normes SMPTE 344M «540 Mb/s
Serial Digital Interface», SMPTE 347M «540 Mb/s Serial Digital Interface – Source Image Format
Mapping», SMPTE 359M «Dynamic Documents» et SMPTE 372M «Dual Link 292M Interface for
1920 × 1080 Picture Raster». Ces quatre normes SMPTE et toute spécification se rapportant
exclusivement à celles-ci ne sont pas considérées comme faisant partie de la présente
Recommandation.
Résumé de la norme SMPTE 352M-2002
Cette norme définit un identificateur de charge utile à quatre octets qui peut être ajouté aux
interfaces de télévision numérique pour les besoins d'identification de la charge utile vidéo. Cet
identificateur doit s'appliquer à toutes les interfaces de télévision numérique actuelles et futures. La
norme définit la manière dont cet identificateur est placé dans le paquet de données auxiliaires
conformément à la norme SMPTE 291M. Elle spécifie la position de l'échantillon, le ou les
numéros de ligne ainsi que le taux de répétition du paquet de données auxiliaires pour différentes
interfaces de télévision numérique. La norme comporte en outre des définitions pour l'interprétation
de chaque octet de l'identificateur, bien que des valeurs pour de nombreuses interfaces de télévision
numérique puissent avoir des attributions particulières. Les valeurs d'identificateur de charge utile
pour les interfaces de télévision numérique existantes sont définies; elles établissent des lignes
directrices pour l'attribution des valeurs d'identificateur de charge utile appropriées aux futures
interfaces de télévision numérique.
NOTE 1 – La norme SMPTE 352M-2002 figure à l'Annexe 1.
La norme SMPTE 352M-2002 et son résumé renvoient uniquement à la version 2002, qui est celle qui a été
approuvée, le 4.01.03 en application de la Résolution UIT-R 45, par les Administrations des Etats Membres
de l'UIT et par les Membres du Secteur des radiocommunications participant aux travaux de la Commission
d'études 6 des radiocommunications. Comme convenu entre l'UIT et la SMPTE, ladite version a été fournie
par la SMPTE qui en a autorisé l'utilisation et l'UIT-R a accepté de l'inclure dans la présente
Recommandation. Toute version ultérieure de la norme SMPTE 352M-2002, qui n'aurait pas été agréée et
approuvée par la Commission d'études 6, n'entre pas dans le cadre de la présente Recommandation. Pour des
versions ultérieures de documents SMPTE, le lecteur est prié de consulter le site web de la SMPTE à
l'adresse URL suivante: http://www.smpte.org/.
Rec. UIT-R BT.1614 3
Annexe 1

 6037(0
5HYLVLRQRI6037(0

6037(67$1'$5'


IRU7HOHYLVLRQ '\QDPLF 


9LGHR3D\ORDG,GHQWLILFDWLRQ
IRU'LJLWDO,QWHUIDFHV

3DJHRISDJHV


6FRSH

7KLVVWDQGDUGGHILQHVWKHVSHFLILFDWLRQRIDE\WHSD\ORDGLGHQWLILHUZKLFKPD\EHDGGHGWRGLJLWDOLQWHUIDFHV
IRUWKHSXUSRVHRILGHQWLI\LQJWKHYLGHRSD\ORDG7KHSD\ORDGLGHQWLILHU LVLQWHQGHGIRUDSSOLFDWLRQWRH[LVWLQJ
DQGIXWXUHGLJLWDOLQWHUIDFHV

7KHVWDQGDUGGHILQHVKRZWKHSD\ORDGLGHQWLILHULVSODFHGLQWRDQDQFLOODU\GDWDSDFNHWDFFRUGLQJWR6037(
0 ,W VSHFLILHV WKH VDPSOH SRVLWLRQ OLQH QXPEHU V  DQG UHSHWLWLRQ UDWH RI WKH DQFLOODU\ GDWD SDFNHW IRU
GLIIHUHQWGLJLWDOLQWHUIDFHV

7KH VWDQGDUG DOVR LQFOXGHV GHILQLWLRQV IRU WKH LQWHUSUHWDWLRQ RI HDFK E\WH RI WKH E\WH SD\ORDG LGHQWLILHU
DOWKRXJK WKH YDOXHV IRU PDQ\ YLGHR SD\ORDGV PD\ KDYH FXVWRP GHILQLWLRQV 3D\ORDG LGHQWLILHU YDOXHV IRU
H[LVWLQJYLGHRSD\ORDGVDUHGHILQHGDQGWKHVHHVWDEOLVKJXLGHOLQHVIRUWKHDVVLJQPHQWRIDSSURSULDWHSD\ORDG
LGHQWLILHUYDOXHVWRIXWXUHYLGHRSD\ORDGV

7KLVVWDQGDUGLVDG\QDPLFGRFXPHQWZKLFKDOORZVLQGLYLGXDOO\GHILQHGSDUWVRIWKLVGRFXPHQWWREHH[WHQGHG
DFFRUGLQJ WR WKH SURFHGXUHV ODLG GRZQ E\ 6037( 0 7KLV VWDQGDUG GRHV QRW DOORZ UHYLVLRQV WR WKLV
VWDQGDUGZKLFKDUHQRWEDFNZDUGVFRPSDWLEOHZLWKWKHRULJLQDOGRFXPHQWRUDQ\SULRUH[WHQVLRQ

127(±6037(0ZDVILUVWWULDOSXEOLVKHGLQWKH-XO\LVVXHRI6037(-RXUQDODOWKRXJKLWGLGQRWUHDFKILQDO
DSSURYDO LW KDV EHHQ LPSOHPHQWHG DQG HTXLSPHQW LV QRZ LQ XVH ,Q RUGHU WR GLVWLQJXLVK WKLV YHUVLRQ IURP WKLV QHZO\
GHILQHGG\QDPLFGRFXPHQWYHUVLRQELWRIE\WHKDVEHHQVHWWR VHHFODXVHVDQGDQGDQQH[$DQG% 7KH
ILUVWWULDOSXEOLFDWLRQYHUVLRQVKRXOGQRWEHXVHGIRUQHZLPSOHPHQWDWLRQV

1RUPDWLYHUHIHUHQFHV G\QDPLF 

7KHIROORZLQJVWDQGDUGVFRQWDLQSURYLVLRQVZKLFKWKURXJKUHIHUHQFHLQWKLVWH[WFRQVWLWXWHSURYLVLRQVRIWKLV
VWDQGDUG $W WKH WLPH RI SXEOLFDWLRQV WKH HGLWLRQV LQGLFDWHG ZHUH YDOLG $OO VWDQGDUGV DUH VXEMHFW WR UHYLVLRQ
DQGSDUWLHVWRDJUHHPHQWVEDVHGRQWKLVVWDQGDUGDUHHQFRXUDJHGWRLQYHVWLJDWHWKHSRVVLELOLW\RIDSSO\LQJWKH
PRVWUHFHQWHGLWLRQRIWKHVWDQGDUGVLQGLFDWHGEHORZ

7KLV FODXVH LV G\QDPLF WR DOORZ QHZ VWDQGDUGV WR EH DGGHG RQO\ DV D UHVXOW RI WKH DGGLWLRQ RI QHZ YLGHR
SD\ORDG VWDQGDUGV RU D QHZ GLJLWDO LQWHUIDFH VWDQGDUGV WR WKLV GRFXPHQW LQ DFFRUGDQFH ZLWK WKH W\SH 
SURFHGXUHV GHILQHGLQ6037(07KHDGGLWLRQRIVXFKQHZUHIHUHQFHVWDQGDUGVPXVWUHWDLQ EDFNZDUGV
FRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQVRIWKLVGRFXPHQW

&RS\ULJKW‹E\7+(62&,(7<2) $SSURYHG
027,213,&785($1'7(/(9,6,21(1*,1((56 -XQH
:+DUWVGDOH$YH:KLWH3ODLQV1<
 
4 Rec. UIT-R BT.1614

6037(0

6037( 0 7HOHYLVLRQ ² %LW  &RPSRQHQW DQG fVF &RPSRVLWH 'LJLWDO 6LJQDOV ² 6HULDO
'LJLWDO,QWHUIDFH

6037( 0 7HOHYLVLRQ ²  [  6FDQQLQJ DQG $QDORJ DQG 3DUDOOHO 'LJLWDO ,QWHUIDFHV IRU
0XOWLSOH3LFWXUH5DWHV

6037(07HOHYLVLRQ²$QFLOODU\'DWD3DFNHWDQG6SDFH)RUPDWWLQJ

6037(07HOHYLVLRQ²%LW6HULDO'LJLWDO,QWHUIDFHIRU+LJK'HILQLWLRQ7HOHYLVLRQ6\VWHPV

6037( 0 7HOHYLVLRQ ²  [  3URJUHVVLYH ,PDJH 6DPSOH 6WUXFWXUH ² $QDORJ DQG 'LJLWDO
5HSUHVHQWDWLRQDQG$QDORJ,QWHUIDFH

6037(07HOHYLVLRQ²0EV6HULDO'LJLWDO,QWHUIDFH

6037(07HOHYLVLRQ²0EV6HULDO'LJLWDO,QWHUIDFH²6RXUFH,PDJH)RUPDW0DSSLQJ

6037(07HOHYLVLRQ²7UDQVSRUWRI$OWHUQDWH6RXUFH,PDJH)RUPDWVWKURXJK6037(0

6037(07HOHYLVLRQDQG0RWLRQ3LFWXUHV²'\QDPLF'RFXPHQWV

6037(07HOHYLVLRQ²'XDO/LQN0,QWHUIDFHIRU[3LFWXUH5DVWHU

6037(53,PSOHPHQWDWLRQRI33DQG36HJPHQWHG)UDPHVIRU[3URGXFWLRQ
)RUPDW

,785%7  6WXGLR3DUDPHWHUVRIDQG/LQH3URJUHVVLYH6FDQ7HOHYLVLRQ6\VWHPV

,785%7  ,QWHUIDFHVIRU'LJLWDO&RPSRQHQW9LGHR6LJQDOLQDQG/LQH3URJUHVVLYH6FDQ
7HOHYLVLRQ6\VWHPV

*ORVVDU\RIWHUPV

FKDQQHO,QVRPHFDVHVDGLJLWDOLQWHUIDFHRIIHUVVXIILFLHQWFDSDFLW\WREHDEOHWRFDUU\PRUHWKDQRQH
YLGHRSD\ORDG,QWKLVFDVHHDFKYLGHRSD\ORDGEHFRPHVDFKDQQHORIWKHGLJLWDOLQWHUIDFH

  LQWHUIDFH WUDQVSRUW  7KH GDWD VWUXFWXUH GHILQHG E\ DQ LQWHUIDFH IRU WKH SXUSRVH RI V\QFKURQL]LQJ WKH
WUDQVSRUW ZRUGV DW WKH UHFHLYHU 7KLV FRPSULVHV SULPDULO\ RI WKH ($9 DQG 6$9 ZRUGV 7KH WUDQVSRUW GDWD LV
XVXDOO\H[SUHVVHGDVDZRUGRIELWVDOWKRXJKWKHSK\VLFDOLQWHUIDFHLVXVXDOO\VHULDOL]HG

OLQN,QVRPHFDVHVWKHSLFWXUHUDVWHUH[FHHGV WKHFDSDFLW\DYDLODEOHDWWKHGLJLWDO LQWHUIDFH,QWKHVH
FDVHV WZR RU PRUH GLJLWDO LQWHUIDFHV FDQ EH XVHG WR SURYLGH WKH WRWDO FDSDFLW\ UHTXLUHG ZKHUH HDFK GLJLWDO
LQWHUIDFHLVDVLQJOHOLQNRIWKHFRPELQHGLQWHUIDFHVHW

SLFWXUHUDVWHU7KHPDWUL[RIVDPSOHVWKDWUHSUHVHQWVDGLJLWDOYLGHRSLFWXUH

SLFWXUHUDWH7KHUDWHDWZKLFKWKHSLFWXUHVZHUHLQWHQGHGWREHSUHVHQWHG7KHSLFWXUHUDWHYDOXHLVWKH
display UDWH DQG PD\ GLIIHU ZLWK WKH source SLFWXUH UDWH DQG WKH interface UDWH $ K\SRWKHWLFDO H[DPSOH LV D
PRWLRQSLFWXUHKDYLQJDVRXUFHUDWHRI+]ZKRVHLQWHQGHGGLVSOD\UDWHLV+] IRUOLQHWUDQVPLVVLRQ 
WKDW LV WUDQVSRUWHG RYHU D 0EV 6', WUDQVSRUW DW WZLFH VSHHG E\ PDSSLQJ HDFK SLFWXUH IUDPH RQWR D
WUDQVSRUWILHOGRSHUDWLQJDW+],QWKLVFDVHWKHLQWHQGHGSLFWXUHUDWHYDOXHLV+],WZRXOGQRWEHVHWWR
WKHYDOXHRIWKHVRXUFHSLFWXUHUDWHRUWKHYDOXHRIWKHWUDQVSRUWUDWH

  VDPSOLQJ  5HIHUV WR WKH KRUL]RQWDO DUUDQJHPHQW RI SLFWXUH VDPSOHV QRWDEO\ WKH DUUDQJHPHQW RI
PXOWLSOH[LQJWKHYDULRXVOXPLQDQFHFKURPLQDQFHDQGRWKHUVLJQDODQGGDWDVDPSOHV

3DJHRISDJHV
Rec. UIT-R BT.1614 5

6037(0

VFDQQLQJ7KLVLVWKHDFWLRQRIUHDGLQJWKHGDWDVWUXFWXUHRIWKHLQWHUIDFHLQDSUHGHWHUPLQHGRUGHUIRU
WUDQVPLVVLRQ,WDOVRUHIHUVWRWKHPDSSLQJRIWKHSLFWXUHUDVWHUWRWKHLQWHUIDFHIRUWUDQVPLVVLRQ7KHVFDQQLQJ
RIWKHSLFWXUHUDVWHUDQGWKHLQWHUIDFHWUDQVSRUWDUHRIWHQFORVHO\UHODWHGWKHQRWDEOHH[FHSWLRQVEHLQJWKH3V)
VFDQQLQJ SURJUHVVLYH SLFWXUH RQ DQ LQWHUODFHG LQWHUIDFH  DQG  SXOOGRZQ VFDQQLQJ XVHG WR PDS D
+]SLFWXUHVFDQRQWRD+]LQWHUODFHGLQWHUIDFH 

  YLGHR SD\ORDG  7KH SLFWXUH FDUULHG E\ D GLJLWDO LQWHUIDFH DQG FRPSULVLQJ D PDWUL[ RI KRUL]RQWDO DQG
YHUWLFDOSL[HOV7KHPDWUL[XVXDOO\FRPSULVHVDPXOWLSOH[RIOXPLQDQFHDQGFRORUFRPSRQHQWV

,QWURGXFWLRQ

7KH YLGHR SD\ORDG LGHQWLILHUPD\ EH DSSOLHG HTXDOO\ WR ERWK WKH SDUDOOHO DQG VHULDO IRUPV RI GLJLWDO LQWHUIDFH
WUDQVSRUWV)RUFRQYHQLHQFHWKLVVWDQGDUGJHQHUDOO\UHIHUVWRWKHVHULDO 6', IRUP:KHUHWKLVVWDQGDUGUHIHUV
RQO\ WR D 6', WUDQVSRUW LW VKDOO EH DVVXPHG WR DSSO\ HTXDOO\ WR ERWK WKH VHULDO DQG WKH DVVRFLDWHG SDUDOOHO
WUDQVSRUWV

7KLVVWDQGDUGZLOOILUVWH[SODLQWKHVWUXFWXUHRIWKHSURSRVHGE\WHYLGHRSD\ORDGLGHQWLILHU,WZLOOWKHQGHILQH
KRZ WKH YLGHR SD\ORDG LGHQWLILHU LV SODFHG LQ DQ DQFLOODU\ GDWD SDFNHW DFFRUGLQJ WR 6037( 0 7KH ODVW
FODXVHZLOOGHILQHWKHSRVLWLRQDQGWLPLQJRIWKHDQFLOODU\GDWDSDFNHWIRUYDULRXVLQWHUIDFHV

$QQH[ $ ZLOO GHILQH WKH YLGHR SD\ORDG LGHQWLILHU YDOXHV IRU WKH IROORZLQJ YLGHR SD\ORDG DQG GLJLWDO LQWHUIDFH
FRPELQDWLRQV

– OLQHLQWHUODFHGYLGHRSD\ORDGVRQD0EVRU0EVGLJLWDOLQWHUIDFH

– OLQH H[WHQGHG YLGHR SD\ORDGV RQ D 0EV VLQJOHOLQNGLJLWDO LQWHUIDFH RU D 0EV GXDO
OLQNGLJLWDOLQWHUIDFHGLJLWDOLQWHUIDFH

– OLQHYLGHRSD\ORDGVRQD0EVGLJLWDOLQWHUIDFH

– OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO GLJLWDOLQWHUIDFH

– OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO GLJLWDOLQWHUIDFH

– OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO GLJLWDOLQWHUIDFH

– OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO GXDOOLQNGLJLWDOLQWHUIDFH

$QQH[$LVDG\QDPLFDQQH[ZKLFKPHDQVWKDWQHZYLGHRSD\ORDGVDQGLQWHUIDFHFRPELQDWLRQVQRWPHQWLRQHG
DERYHFDQEHDGGHGDFFRUGLQJWRWKHW\SHSURFHGXUHVGHILQHGLQ6037(0

$QQH[%LVDKLVWRULFDOUHFRUGRIWKHYLGHRSD\ORDGVDQGLQWHUIDFHFRPELQDWLRQVDVGHILQHGE\WKHILUVWYHUVLRQ
WKDWZDVWULDOSXEOLVKHGLQWKH-XO\HGLWLRQRIWKH6037(-RXUQDO7KLVDQQH[LVSURYLGHGWRDOORZQHZ
GHFRGHUV WR UHFRJQL]H SD\ORDG LGHQWLILHUV HQFRGHG DFFRUGLQJ WR WKH ILUVW WULDO SXEOLFDWLRQ YHUVLRQ DQG VKRXOG
QRWEHXVHGE\QHZHQFRGLQJHTXLSPHQW

$QQH[&VKRZVWKHPDSSLQJRIWKHYLGHRSD\ORDGLGHQWLILHUIURPWKHDQFLOODU\SDFNHWGDWDVWUXFWXUHRI6037(
0WRWKH./9GDWDVWUXFWXUHRI6037(0DVDIL[HGOHQJWKGDWDSDFN

$QQH['LGHQWLILHVZK\DYLGHRSD\ORDGLGHQWLILHULVQRZQHHGHGIRUWKHLGHQWLILFDWLRQRIDYLGHRSD\ORDGRQD
GLJLWDOLQWHUIDFHWUDQVSRUWDQGH[SODLQVZK\WKHYLGHRSD\ORDGLGHQWLILHULVE\WHVLQOHQJWK

9LGHRSD\ORDGLGHQWLILHU

7KHYLGHRSD\ORDGLGHQWLILHUVKDOOEHXVHGWRLGHQWLI\WKHYLGHRSD\ORDGFDUULHGRQDGLJLWDOLQWHUIDFHWUDQVSRUW

3DJHRISDJHV
6 Rec. UIT-R BT.1614

6037(0


7KHYLGHRSD\ORDGLGHQWLILHUVKDOOEHE\WHVORQJZKHUHHDFKE\WHKDVDVHSDUDWHVLJQLILFDQFH7KHILUVWE\WH
RI WKH YLGHR SD\ORDG LGHQWLILHU VKDOO KDYH WKH KLJKHVW VLJQLILFDQFH DQG VXEVHTXHQW E\WHV VKDOO EH XVHG WR
GHILQH ORZHU RUGHU YLGHR SD\ORDG LQIRUPDWLRQ $ SUHFLVH GHILQLWLRQ RI HDFK YLGHR SD\ORDG LGHQWLILHU VKDOO EH
SURYLGHGIRUHDFKLQWHUIDFHEDVHGRQWKHIROORZLQJJXLGHOLQHV

&RPPRQYLGHRSD\ORDGLGHQWLILHUIRUPDW

7KHGHVFULSWLRQVRIHDFKE\WHPD\EHVXPPDUL]HGDVIROORZVLQWDEOH

7DEOHD±*HQHUDOL]HGYLGHRSD\ORDGLGHQWLILHUE\WHGHILQLWLRQVIRUGLJLWDOWUDQVSRUWV

%LWV %\WH %\WH %\WH %\WH
%LW 9HUVLRQLGHQWLILHU
%LW  $SSOLFDWLRQVSHFLILF $SSOLFDWLRQVSHFLILF
OLQHRUSLFWXUH VDPSOLQJRUDVSHFW
%LW 9LGHRSD\ORDGDQG $SSOLFDWLRQVSHFLILF
UHODWHGLQIRUPDWLRQ  UDWLRUHODWHGLQIRUPDWLRQ 
GLJLWDOLQWHUIDFH FKDQQHODVVLJQPHQW
%LW VWDQGDUGV G\QDPLFUDQJHELW
%LW PDQGDWRU\  GHSWKUHODWHGRURWKHU
%LW 6DPSOLQJVWUXFWXUH LQIRUPDWLRQ 
3LFWXUHUDWH
%LW LGHQWLILFDWLRQ

%LW


7DEOHE G\QDPLF ±'HIDXOWYLGHRSD\ORDGLGHQWLILHUILHOGGHILQLWLRQV

%LWV %\WH %\WH %\WH
,QWHUODFHG  RUSURJUHVVLYH   ,PDJHDVSHFWUDWLR &KDQQHODVVLJQPHQW
%LW
WUDQVSRUW   RU   6LQJOHOLQNRUFKRI
PXOWLOLQN K 
,QWHUODFHG  RUSURJUHVVLYH   FKRIPXOWLOLQN K 
%LW 5HVHUYHG
SLFWXUH FKRIPXOWLOLQN K 
FKRIPXOWLOLQN K 
%LW 5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW 5HVHUYHG 5HVHUYHG '\QDPLFUDQJH
 K  K 
%LW RU K 
5HVHUYHG K 
%LW 6DPSOLQJVWUXFWXUH 5HVHUYHG
3LFWXUHUDWH
%LW LGHQWLILFDWLRQ %LWGHSWK
ELW K ELW K 
%LW RUELW K 
5HVHUYHG K 

3DJHRISDJHV
Rec. UIT-R BT.1614 7

6037(0

%\WHSURYLGHVDPDQGDWRU\ GHILQLWLRQRIWKHYLGHRSD\ORDGDQGGLJLWDOLQWHUIDFHVWDQGDUG7KHUHPDLQLQJ 
E\WHVDVGHILQHGLQWDEOHVDDQGESURYLGHGHIDXOWGHILQLWLRQVIRULQGLYLGXDOILHOGVDOWKRXJKWKHVHPD\YDU\
RQDFDVHE\FDVHEDVLVGHSHQGLQJRQWKHYDOXHJLYHQLQE\WH

7KHGHIDXOWPHDQLQJRIWKHUHVHUYHGELWVRIWDEOHEPD\EHDVVLJQHGLQDIXWXUHUHYLVLRQRIWKLVVWDQGDUGLQ
DFFRUGDQFH ZLWK W\SH  SURFHGXUHV GHILQHG LQ 6037( 0 6XFK DVVLJQPHQW PXVW UHWDLQ EDFNZDUGV
FRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQVRIWKLVGRFXPHQW

%\WH9LGHRSD\ORDGDQGGLJLWDOLQWHUIDFHLGHQWLILFDWLRQ

7KLV ILUVW E\WH KDV WKH KLJKHVW VLJQLILFDQFH DQG VKDOO EH XVHG WR LGHQWLI\ WKH FRPELQDWLRQ RI YLGHR SD\ORDG
IRUPDWDQGGLJLWDOLQWHUIDFHWUDQVSRUW

1RWHWKDWVRPHGLJLWDOLQWHUIDFHVFDQFDUU\DQXPEHURIGLIIHUHQWYLGHRSD\ORDGIRUPDWVDWWKHVDPHWUDQVSRUW
ELW UDWH E\ FKDQJLQJ WKH WLPLQJ DQG UHSHWLWLRQ UDWHV RI WKH WLPLQJ UHIHUHQFH VLJQDOV HPEHGGHG LQ WKH GLJLWDO
LQWHUIDFHV\QFKURQL]DWLRQZRUGV)XUWKHUPRUHYLGHRSD\ORDGIRUPDWVFDQQRZEHPDSSHGRQWRVHYHUDOGLJLWDO
LQWHUIDFH WUDQVSRUWV 7KXV WKH ILUVW E\WH LGHQWLILHV WKH FRPELQDWLRQ RI ERWK WKH YLGHR SD\ORDG IRUPDW DQG LWV
DVVRFLDWHGGLJLWDOLQWHUIDFH

7KHILUVWE\WHRIWKHYLGHRSD\ORDGLGHQWLILHUVKDOOKDYHDQRQ]HURYDOXHIRUDOOYDOLGYLGHRSD\ORDGV7KXVWKH
ILUVWE\WHFDQEHXVHGWRDGGUHVVXSWRYLGHRSD\ORDGDQGGLJLWDOLQWHUIDFHVWDQGDUGV

%LWRIE\WHVKDOOEHXVHGWRGHILQHWKHSD\ORDGLGHQWLILFDWLRQYHUVLRQ

− LGHQWLILHVYHUVLRQEDVHGRQWKLVVWDQGDUG VHHDQQH[$ 

− LGHQWLILHV YHUVLRQ EDVHGRQ6037(0DVWULDOSXEOLVKHG LQWKH-XO\ LVVXHRIWKH 6037(
-RXUQDO VHHDQQH[% 

%\WH3LFWXUHUDWHDQGVFDQQLQJPHWKRG

7KHVHFRQGE\WHFDQEHXVHGWRLGHQWLI\WKHSLFWXUHUDWHDQGWKHSLFWXUHDQGWUDQVSRUWVFDQQLQJPHWKRGVDV
VKRZQLQWDEOHE

%\ GHIDXOW ELW E LV XVHG WR LGHQWLI\ ZKHWKHU WKH GLJLWDO LQWHUIDFH XVHV D SURJUHVVLYH RU LQWHUODFHG WUDQVSRUW
VWUXFWXUH7KHGHIDXOWYDOXHRIELVZKLFKLGHQWLILHVDQLQWHUODFHGWUDQVSRUW

127( ± %LW E LV SURYLGHG IRU UDSLG DQG UHOLDEOH GHWHFWLRQ RI WKH WUDQVSRUW VFDQQLQJ VWUXFWXUH 7KH GLJLWDO LQWHUIDFH
VFDQQLQJVWUXFWXUHFDQEHIRXQGWKURXJKWKHGHWHFWLRQRIWKH)ELWZKLFKKDVDVWDWLFYDOXHIRUSURJUHVVLYHWUDQVSRUWV
DQGWRJJOHVEHWZHHQ ILUVWILHOG DQG VHFRQGILHOG IRULQWHUODFHGWUDQVSRUWV7KLVGHWHFWLRQPD\WDNHVHYHUDOWUDQVSRUW
IUDPHVWRHQVXUHDFFXUDF\ZKHUHDVWKLVVLQJOHELWEFDQSURYLGHWKHLQIRUPDWLRQRQDSHUIUDPHEDVLV

%\GHIDXOWELWELVXVHGWRLGHQWLI\ZKHWKHUWKHSLFWXUHKDVEHHQVFDQQHGDVSURJUHVVLYHRULQWHUODFHG7KH
GHIDXOWYDOXHRIELVZKLFKLGHQWLILHVDQLQWHUODFHGVFDQQHGSLFWXUH

127(±3V)YLGHRSD\ORDGVDUHLGHQWLILHGE\DSURJUHVVLYHVFDQQLQJRIWKHYLGHRSD\ORDGWUDQVSRUWHGRYHUDQLQWHUODFHG
GLJLWDOLQWHUIDFHWUDQVSRUWFDUU\LQJWKHSURJUHVVLYHYLGHRSD\ORDGDVDILUVWDQGVHFRQGSLFWXUHVHJPHQWZLWKLQWKHWUDQVSRUW
IUDPHGXUDWLRQ7KHVHILUVWDQGVHFRQGSLFWXUHVHJPHQWVDUHLQGLFDWHGE\WKHILUVWDQGVHFRQGILHOGLQGLFDWRUVLQWKHGLJLWDO
LQWHUIDFHWUDQVSRUW

%\GHIDXOWELWVEWRERIE\WHDUHXVHGWRGHILQHWKHSLFWXUHUDWHLQ+]7KHELWVDOORZYDOXHVRIKWR)K
ZKLFKVKDOOEHDVGHILQHGLQWDEOH

3DJHRISDJHV
8 Rec. UIT-R BT.1614

6037(0

7DEOH G\QDPLF ±'HIDXOWDVVLJQPHQWRISLFWXUHUDWHYDOXHV



9DOXH 3LFWXUHUDWH 9DOXH 3LFWXUHUDWH 9DOXH 3LFWXUHUDWH 9DOXH 3LFWXUHUDWH
K 1RGHILQHGYDOXH K 5HVHUYHG K  K 
K 5HVHUYHG K  K  K 
K 5HVHUYHG K  $K  %K 
&K 5HVHUYHG 'K 5HVHUYHG (K 5HVHUYHG )K 5HVHUYHG

7KHXQDVVLJQHGYDOXHVRIWDEOHPD\EHDVVLJQHGLQDIXWXUHUHYLVLRQRIWKLVGRFXPHQWLQDFFRUGDQFHZLWK
W\SHSURFHGXUHVGHILQHGLQ6037(06XFKDVVLJQPHQWPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHU
YHUVLRQVRIWKLVGRFXPHQW

%\WH6DPSOLQJVWUXFWXUHLGHQWLILFDWLRQ

7KHWKLUGE\WHFDQEHXVHGWRLGHQWLI\DVSHFWVRIWKHVDPSOLQJVWUXFWXUHRIWKHYLGHRSD\ORDGDVVKRZQLQWDEOH
D %\ GHIDXOW ELW E RI E\WH  FDQ EH XVHG WR LGHQWLI\ WKH LPDJH DVSHFW UDWLR ZKHUH WKH GHIDXOW YDOXH RI 
LQGLFDWHVDDVSHFWUDWLRDQGLQGLFDWHVDDVSHFWUDWLR

%\ GHIDXOW ELWV E WR E RI E\WH  DUH XVHG WR LGHQWLI\ WKH KRUL]RQWDO VDPSOLQJ VWUXFWXUH 7KH  ELWV DOORZ
YDOXHVRIKWR)KZKLFKDUHGHILQHGDVVKRZQLQWDEOH

7DEOH G\QDPLF ±'HIDXOWDVVLJQPHQWRIVDPSOLQJVWUXFWXUHYDOXHV

9DOXH 6DPSOLQJ 9DOXH 6DPSOLQJ 9DOXH 6DPSOLQJ 9DOXH 6DPSOLQJ


K >GHIDXOW@ K  K  K 
<&E&U  <&E&U  *%5 
K  K  K  K 5HVHUYHG
<&E&U$  <&E&U$  *%5$ 
K  K  $K  %K 5HVHUYHG
<&E&U'  <&E&U'  *%5' 
&K 5HVHUYHG 'K 5HVHUYHG (K 5HVHUYHG )K 5HVHUYHG

7KHXQDVVLJQHGYDOXHVRIWDEOHPD\EHDVVLJQHGLQDIXWXUHUHYLVLRQRIWKLVGRFXPHQWLQDFFRUGDQFHZLWK
W\SHSURFHGXUHVGHILQHGLQ6037(06XFKDVVLJQPHQWPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHU
YHUVLRQVRIWKLVGRFXPHQW

127(6

  7KH WHUP  LGHQWLILHV WKH UDWLR RI FRPSRQHQW VDPSOLQJ LQGHSHQGHQWO\ RI WKH UHVROXWLRQ 7KHVH YDOXHV DSSO\ WR DOO
SLFWXUHVDPSOLQJGHILQLWLRQVLQFOXGLQJKLJKGHILQLWLRQSLFWXUHV

,QWKHDQGILHOGVWKH$QRPHQFODWXUHUHIHUVWRDSLFWXUHFKDQQHOZKHUHDVWKH'QRPHQFODWXUHUHIHUVWR
DQRQSLFWXUH LHGDWD FKDQQHO

%\WH6SHFLDORSWLRQV

%\ GHIDXOW WKH IRXUWK E\WH LV XVHG WR LGHQWLI\ H[WHQGHG DVSHFWV RI WKH YLGHR SD\ORDG SURYLGLQJ LQIRUPDWLRQ
DERXWWKHFKDQQHODVVLJQPHQWG\QDPLFUDQJHDQGELWGHSWKRIWKHYLGHRSD\ORDGDVGHILQHGLQWDEOHE


3DJHRISDJHV
Rec. UIT-R BT.1614 9

6037(0

%\GHIDXOWELWVEDQGEDUHXVHGWRLGHQWLI\FKDQQHOLGHQWLILFDWLRQLQIRUPDWLRQZKHUHWKHIROORZLQJYDOXHVDUH
GHILQHG

− KLGHQWLILHVDVLQJOHFKDQQHOYLGHRSD\ORDGRUFKDQQHORIDPXOWLFKDQQHOYLGHRSD\ORDG
− KLGHQWLILHVFKDQQHORIDPXOWLFKDQQHOYLGHRSD\ORDG
− KLGHQWLILHVFKDQQHORIDPXOWLFKDQQHOYLGHRSD\ORDG
− KLGHQWLILHVFKDQQHORIDPXOWLFKDQQHOYLGHRSD\ORDG

%\ GHIDXOW ELWV E DQG E DUH XVHG WR LGHQWLI\ WKH G\QDPLF UDQJH RI WKH VDPSOH TXDQWL]DWLRQ ZKHUH WKH
IROORZLQJYDOXHVDUHGHILQHG

− KLGHQWLILHVTXDQWL]DWLRQZKHUHWKHYDOXHUDQJHLVQRUPDO
− KLGHQWLILHVTXDQWL]DWLRQZKHUHWKHYDOXHUDQJHLVH[WHQGHGWRRIQRUPDO LHKDVRYHUKHDGELW
LQWKH06%ORFDWLRQ 
− K LGHQWLILHV TXDQWL]DWLRQ ZKHUH WKH YDOXH UDQJH LV H[WHQGHG WR  RI QRUPDO LH KDV  RYHUKHDG
ELWVLQWKH06%ORFDWLRQV 

%\ GHIDXOW ELWV E DQG E DUH XVHG WR LGHQWLI\ WKH ELW GHSWK RI WKH VDPSOH TXDQWL]DWLRQ ZKHUH WKH IROORZLQJ
YDOXHVDUHGHILQHG

− KLGHQWLILHVTXDQWL]DWLRQXVLQJELWVSHUVDPSOH
− KLGHQWLILHVTXDQWL]DWLRQXVLQJELWVSHUVDPSOH
− KLGHQWLILHVTXDQWL]DWLRQXVLQJELWVSHUVDPSOH

9LGHRSD\ORDGLGHQWLILHUVSHFLILFDWLRQDQGFDUULDJH

7KHE\WHYLGHRSD\ORDGLGHQWLILHUVKDOOEHFDUULHGLQD6037(0+$QFLOODU\GDWDSDFNHW7KLVHQVXUHVD
FRQVLVWHQWDSSURDFKWRGDWDKDQGOLQJIRUDOOGLJLWDOLQWHUIDFHWUDQVSRUWV

$QFLOODU\GDWDVSHFLILFDWLRQ

7KHDQFLOODU\GDWDSDFNHWXVHGE\WKHYLGHRSD\ORDGLGHQWLILHUVKDOOXVHWKHW\SHGDWDLGHQWLILFDWLRQKDYLQJD
ILUVWGDWDLGHQWLILFDWLRQ ',' ZRUGIROORZHGE\DVHFRQGDU\GDWDLGHQWLILFDWLRQ 6',' ZRUG

7KH','ZRUGVKDOOEHVHWWRWKHYDOXHK7KH6','ZRUGVKDOOEHVHWWRWKHYDOXHRIK

7DEOHRXWOLQHVWKHDQFLOODU\GDWDSDFNHWZRUGVZLWKYDOXHVZKHUHDSSURSULDWH7KHWRWDOVL]HRIWKHDQFLOODU\
GDWDSDFNHWLVZRUGV

3DJHRISDJHV
10 Rec. UIT-R BT.1614

6037(0

7DEOH±$QFLOODU\GDWDSDFNHWVWUXFWXUHIRUWKHYLGHRSD\ORDGLGHQWLILHU

1DPH $FURQ\P 9DOXH
$QFLOODU\GDWDIODJ ELWZRUGV  $') K))K))K
'DWDLGHQWLILFDWLRQ ',' K
6HFRQGDU\GDWDLGHQWLILFDWLRQ 6',' K
'DWDFRXQW '& K
6',YLGHRSD\ORDGLGHQWLILHU ZRUGV ²
&KHFNVXP &6 ²


3ODFHPHQWRIWKHDQFLOODU\GDWDSDFNHW G\QDPLF 

$V WKLV SDFNHW GHILQHV D EDVLF YLGHR SD\ORDG W\SH WKH SUHIHUUHG KRUL]RQWDO SODFHPHQW RI WKH DQFLOODU\ GDWD
SDFNHWLVLPPHGLDWHO\IROORZLQJDQ($9ZRUGVHTXHQFH

7KHOLQHQXPEHURIWKHSDFNHWZLOOYDU\DFFRUGLQJWRWKHGLJLWDOYLGHRLQWHUIDFHWRPHHWZLWKH[LVWLQJHTXLSPHQW
SUDFWLFH7KHGHWDLOVEHORZVXPPDUL]HWKHOLQHQXPEHUVIRUGLIIHUHQWLQWHUIDFHV

7KLVFODXVHLVG\QDPLFDQGDOORZVQHZVXEFODXVHV [ WREHDGGHGWRWKLVFODXVH  WRVXSSRUWGLJLWDO
LQWHUIDFHV QRW DOUHDG\ GHILQHG LQ WKLV FODXVH 6XFK QHZ VXEFODXVHV VKDOO EH DGGHG DFFRUGLQJ WR WKH W\SH 
SURFHGXUHVGHILQHGLQ6037(0,WLVQRWSHUPLVVLEOHWRDOWHUDQ\H[LVWLQJVXEFODXVH [ LQWKLVFODXVH
LQRUGHUWRSUHVHUYHEDFNZDUGVFRPSDWLELOLW\1HLWKHULVLWSHUPLVVLEOHWRDGGDQ\QHZVXEFODXVH [ LQWKLV
FODXVHWKDWRYHUULGHVDQ\H[LVWLQJVXEFODXVHDOUHDG\GHILQHG

127(6

  7KH OLQH QXPEHUV JLYHQ LQ WKH UHPDLQGHU RI WKLV FODXVH DUH LQWHUIDFH OLQH QXPEHUV ZKLFK PD\ GLIIHU IURP WKH YLGHR
SD\ORDGOLQHQXPEHUV7KHVHOLQHQXPEHUGLIIHUHQFHVPD\RFFXUZKHQXVLQJVSHFLDOUDVWHUPDSSLQJVVXFKDV3V)PXOWL
OLQNDQGPXOWLFKDQQHO

$OOWKHOLQHQXPEHUVEHORZDUHWKUHHOLQHVODWHUWKDQWKHVZLWFKLQJSRLQWOLQH

DQGOLQHGLJLWDOLQWHUIDFHVLQWHUODFHVFDQQHG

)RU GLJLWDO LQWHUIDFHV KDYLQJ  RU  OLQHV ZLWK DQ LQWHUODFHG ,  VFDQQLQJ VWUXFWXUH WKH DQFLOODU\ GDWD
SDFNHWVKDOOEHDGGHGRQFHSHUILHOGRQWKHIROORZLQJOLQHV

 , ILHOG  /LQH
 , ILHOG  /LQH
 , ILHOG  /LQH
 , ILHOG  /LQH

127(±7KHVHOLQHQXPEHUVDOVRDSSO\ZKHQXVLQJDSURJUHVVLYHSD\ORDGRQD0EVVHULDOGLJLWDOLQWHUIDFHD
0EVGXDOOLQNVHULDOGLJLWDOLQWHUIDFHRUD*EVVHULDOGLJLWDOLQWHUIDFH 6037(0 :KHQXVLQJWKH6037(
0VHULDOGLJLWDOLQWHUIDFHWKHDQFLOODU\GDWDSDFNHWVKDOOEHDGGHGRQFHSHUIUDPHRQRQO\WKH<FKDQQHORIWKHGHILQHG
OLQHEHFDXVHWKHYLGHRSD\ORDG,'VDUHDOZD\VPDSSHGRQWKH<FKDQQHORIWKH*EVVHULDOGLJLWDOLQWHUIDFH 

DQGOLQHGLJLWDOLQWHUIDFHVSURJUHVVLYHO\VFDQQHG
 
)RU GLJLWDO LQWHUIDFHV KDYLQJ  RU  OLQHV ZLWK D SURJUHVVLYH 3  VFDQQLQJ VWUXFWXUH WKH DQFLOODU\ GDWD
SDFNHWVKDOOEHDGGHGRQFHSHUIUDPHRQWKHIROORZLQJOLQH


3DJHRISDJHV
Rec. UIT-R BT.1614 11

6037(0

 3 /LQH
 3 /LQH

OLQHGLJLWDOLQWHUIDFHVSURJUHVVLYHO\VFDQQHG
 
)RUGLJLWDOLQWHUIDFHVKDYLQJOLQHVZLWKDSURJUHVVLYH 3 VFDQQLQJVWUXFWXUHWKHDQFLOODU\GDWDSDFNHWVKDOO
EHDGGHGRQFHSHUIUDPHRQRQO\WKH<FKDQQHORIWKHIROORZLQJOLQH

 3 /LQH

OLQHGLJLWDOLQWHUIDFHVLQWHUODFHDQGVHJPHQWHGIUDPHVFDQQHG

)RUGLJLWDOLQWHUIDFHVKDYLQJOLQHVZLWKLQWHUODFHG , DQGSURJUHVVLYHVHJPHQWHGIUDPH 3V) VFDQQLQJ
VWUXFWXUHVWKHDQFLOODU\GDWDSDFNHWVKDOOEHDGGHGRQFHSHUILHOGRQRQO\WKH<FKDQQHORIWKHIROORZLQJOLQHV

 , ILHOG  /LQH
 , ILHOG  /LQH

127( ± 7KHVH OLQH QXPEHUV DOVR DSSO\ WR GXDOOLQN +'6', ZKHQ XVLQJ LQWHUODFHG DQG SURJUHVVLYH VHJPHQWHGIUDPH
VFDQQLQJ

OLQHGLJLWDOLQWHUIDFHVSURJUHVVLYHO\VFDQQHG

)RU GLJLWDO LQWHUIDFHV KDYLQJ  OLQHV ZLWK D SURJUHVVLYH 3  VFDQQLQJ VWUXFWXUH WKH DQFLOODU\ GDWD SDFNHW
VKDOOEHDGGHGRQFHSHUIUDPHRQWKH<FKDQQHORQO\RIWKHIROORZLQJOLQH

 3 /LQH

127(6

7KHVHOLQHQXPEHUVDOVRDSSO\WRGXDOOLQN+'6',ZKHQXVLQJSURJUHVVLYHVFDQQLQJ

  7KH OLQH QXPEHUV GHILQHG DERYH IRU WKH OLQH DQG OLQH LQWHUIDFHV LQ WKH 6037( 0 EDVHG VHULDO GLJLWDO
LQWHUIDFHDYRLGVWKHOLQHVXVHGE\6037(0IRUWKHFDUULDJHRIWKHGLJLWDODXGLRFRQWUROGDWDSDFNHW



$QQH[$ G\QDPLF  QRUPDWLYH 
9LGHRSD\ORDGLGHQWLILHUGHILQLWLRQVIRUH[LVWLQJLQWHUIDFHV

7KHGHILQLWLRQRIWKHYLGHRSD\ORDGLGHQWLILHUXVHVWKHILUVWZRUGWRLGHQWLI\WKHUHOHYDQWVWDQGDUGVDQGWKHUHDUHDOUHDG\VHYHUDOFXUUHQW
DQGHPHUJLQJVWDQGDUGVZKHUHWKHYLGHRSD\ORDGLGHQWLILHUFRXOGEHEHQHILFLDO7KHWDEOHVEHORZLGHQWLI\WKHFXUUHQWYLGHRSD\ORDGDQG
LQWHUIDFHFRPELQDWLRQVDQGGHILQHWKHYDOXHVLQWKHE\WHVRIWKHYLGHRSD\ORDGLGHQWLILHU

7KLVDQQH[LVG\QDPLFDQGDOORZVQHZWDEOHVDQGVXSSRUWLQJGHVFULSWLYHWH[WWREHDGGHGWRVXSSRUWQHZFRPELQDWLRQVRIYLGHRSD\ORDGV
DQGGLJLWDOLQWHUIDFHVQRWDOUHDG\GHILQHGLQWKLVDQQH[6XFKQHZWDEOHVVKDOOEHDGGHGDFFRUGLQJWRWKHW\SHSURFHGXUHVGHILQHGLQ
6037(0

)XUWKHUPRUHH[LVWLQJWDEOHVDQGWKHLUVXSSRUWLQJGHVFULSWLYHWH[WPD\EHH[WHQGHGWRVXSSRUWSDUDPHWHUYDOXHVQRWDOUHDG\GHILQHGLQ
WKLVDQQH[6XFKH[WHQVLRQVVKDOOEHDGGHGDFFRUGLQJWRWKHW\SHSURFHGXUHVGHILQHGLQ6037(0

$OLQHLQWHUODFHGYLGHRSD\ORDGVRQ0EVDQG0EVVHULDOGLJLWDOLQWHUIDFHV

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV GRFXPHQW LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

3DJHRISDJHV
12 Rec. UIT-R BT.1614

6037(0


7DEOH$ G\QDPLF ±9LGHRSD\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHLQWHUODFHGYLGHRSD\ORDGV
RQ0EVDQG0EVVHULDOGLJLWDOLQWHUIDFHV

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG ,PDJHDVSHFWUDWLR 5HVHUYHG
  
%LW  ,QWHUODFHG  SLFWXUH +RUL]RQWDO<VDPSOLQJ 5HVHUYHG
  
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  3LFWXUHUDWH 6DPSOLQJVWUXFWXUHLGHQWLILFDWLRQ 5HVHUYHG
VHHWDEOH  VHHWDEOH 
%LW  5HVHUYHG
%LW  %LWGHSWKELWV  RUELWV  

:KHQLGHQWLI\LQJOLQHLQWHUODFHGYLGHRSD\ORDGVRQ0EVDQG0EVVHULDOGLJLWDOLQWHUIDFHVWKHIROORZLQJOLPLWDWLRQVVKDOO
DSSO\

− 7KHSLFWXUHUDWHVKDOORQO\XVHWKHYDOXHVK +] DQGK +] LQDFFRUGDQFHZLWKWDEOH

− %LWRIE\WHVKDOOEHVHWWRDYDOXHRIWRLGHQWLI\DQLQWHUODFHGYLGHRSD\ORDG

− 7KH6DPSOLQJVWUXFWXUHLGHQWLILFDWLRQVKDOORQO\XVHWKHYDOXHRIµK¶WRLGHQWLI\D <&E&U YLGHRSD\ORDG

− %LWRIE\WHVKDOOEHXVHGWRLGHQWLI\DFWLYHOXPLQDQFHVDPSOHV  RUDFWLYHOXPLQDQFHVDPSOHV  DVGHILQHGE\WKH
KRUL]RQWDOOXPLQDQFHVDPSOHFRXQW

− :KHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEHDQGZKHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEH

− ,GHQWLILFDWLRQ RI WKH TXDQWL]DWLRQ UHVROXWLRQ LQ ELW E RI E\WH  LV RSWLRQDO 7KH GHIDXOW YDOXH LV  LGHQWLI\LQJ D YLGHR SD\ORDG
TXDQWL]DWLRQUHVROXWLRQRIELWV

$OLQHH[WHQGHGYLGHRSD\ORDGVRQ0EVVLQJOHOLQNDQG0EVGXDOOLQNVHULDOGLJLWDOLQWHUIDFHV

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV GRFXPHQW LQ
DFFRUGDQFHZLWK7\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

3DJHRISDJHV
Rec. UIT-R BT.1614 13

6037(0

7DEOH$ G\QDPLF ±9LGHRSD\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHH[WHQGHGYLGHRSD\ORDGV


on 360-Mb/s single-link and 270-Mb/s dual-link serial digital interfaces

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG ,PDJHDVSHFWUDWLR 5HVHUYHG
  
%LW  ,QWHUODFHG  RUSURJUHVVLYH    &KDQQHODVVLJQPHQW
SLFWXUH VHHILJXUHE 
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  3LFWXUHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
VHHWDEOH  VHHWDEOH 
%LW  5HVHUYHG
%LW  %LWGHSWKELWV  RUELWV  

:KHQ LGHQWLI\LQJ OLQH SURJUHVVLYH YLGHR SD\ORDGV RQ 0EV VLQJOHOLQN DQG 0EV GXDOOLQN VHULDO GLJLWDO LQWHUIDFH
WUDQVSRUWVWKHIROORZLQJFRQVWUDLQWVVKDOODSSO\

− 7KHSLFWXUHUDWHVKDOORQO\XVHWKHYDOXHVK +] DQG$K +] LQDFFRUGDQFHZLWKWDEOH

− %LWRIE\WHVKDOOEHVHWWRDYDOXHRIWRLGHQWLI\DSURJUHVVLYHYLGHRSD\ORDG

− 7KHVDPSOLQJVWUXFWXUHLGHQWLILFDWLRQVKDOORQO\XVHWKHYDOXHVK  IRUVLQJOHOLQN0EVWUDQVSRUWVDQGK  IRU
0EVGXDOOLQNWUDQVSRUWV

− :KHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEHDQGZKHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEH

− ,QWKHFDVHRIGXDOOLQN0EVWUDQVSRUWVWKHFKDQQHODVVLJQPHQWYDOXHLQELWERIE\WHVKDOOEHVHWWRDYDOXHRIµ¶IRUWKH
ILUVWOLQNDQGWRIRUWKHVHFRQGOLQN,QWKHFDVHRIVLQJOHOLQN0EV6',WKHFKDQQHOYDOXHVKDOOEHVHWWRDYDOXHRIK

− ,GHQWLILFDWLRQRIWKHTXDQWL]DWLRQYDOXHLQELWERIE\WHLVRSWLRQDO7KHGHIDXOWYDOXHLVLGHQWLI\LQJDYLGHRSD\ORDGTXDQWL]DWLRQ
UHVROXWLRQRIELWV

:KHQ LGHQWLI\LQJ  OLQH  LQWHUODFHG YLGHR SD\ORDGV RQ 0ESV GXDOOLQN VHULDO GLJLWDO LQWHUIDFH WUDQVSRUWV WKH IROORZLQJ
FRQVWUDLQWVVKDOODSSO\

− 7KHSLFWXUHUDWHVKDOORQO\XVHWKHYDOXHVK +] DQGK +] LQDFFRUGDQFHZLWKWDEOH

− %LWRIE\WHVKDOOEHVHWWRDYDOXHRIWRLGHQWLI\DQLQWHUODFHGYLGHRSD\ORDG

− 7KH VDPSOLQJ VWUXFWXUH LGHQWLILFDWLRQ VKDOO RQO\ XVH WKH YDOXHV K  <&E&U$  K  *%5$  K 
<&E&U' RU$K *%5' 

− :KHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEHDQGZKHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEH

− 7KHFKDQQHODVVLJQPHQWYDOXHLQELWERIE\WHVKDOOEHVHWWRDYDOXHRIIRUWKHILUVWOLQNDQGWRIRUWKHVHFRQGOLQN

− ,GHQWLILFDWLRQRIWKHTXDQWL]DWLRQYDOXHLQELWERIE\WHLVRSWLRQDO7KHGHIDXOWYDOXHLVLGHQWLI\LQJDYLGHRSD\ORDGTXDQWL]DWLRQ
UHVROXWLRQRIELWV

3DJHRISDJHV
14 Rec. UIT-R BT.1614

6037(0

$OLQHYLGHRSD\ORDGVRQD0EVVHULDOGLJLWDOLQWHUIDFH

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV VWDQGDUG LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVGRFXPHQW

7DEOH$ G\QDPLF ±9LGHRSD\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHYLGHRSD\ORDGV
RQD0EVVHULDOGLJLWDOLQWHUIDFH

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG ,PDJHDVSHFWUDWLR 5HVHUYHG
  
%LW  ,QWHUODFHG  RUSURJUHVVLYH    5HVHUYHG
SLFWXUH
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  3LFWXUHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
VHHWDEOH  VHHWDEOH 
%LW  5HVHUYHG
%LW  %LWGHSWKELWV  RUELWV  


:KHQ LGHQWLI\LQJ OLQH LQWHUODFHG DQG SURJUHVVLYH YLGHR SD\ORDGV RQ D 0EV GLJLWDO LQWHUIDFH DW OHDVW WKH IROORZLQJ OLVW RI
SLFWXUHUDWHVDQGVDPSOLQJVWUXFWXUHVDUHVXSSRUWHG

− 7KHSLFWXUHUDWHVKDOOEHVHWWRWKHYDOXHRIWKHOLQHYLGHRSD\ORDGDVGHILQHGLQ6037(0

− 7KHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRWKHYDOXHRIWKHOLQHYLGHRSD\ORDGDVGHILQHGLQ6037(07KLVVKDOOLQFOXGH
WKHXVHRIWKHDOSKDFKDQQHODVDFDUULHURIGDWDDVZHOODVYLGHR

7KHIROORZLQJELWILHOGVDUHXVHG

− %LWRIE\WHVKDOOEHVHWWRDYDOXHRIWRLGHQWLI\DQLQWHUODFHGYLGHRSD\ORDGDQGWRDYDOXHRIWRLGHQWLI\DSURJUHVVLYHYLGHR
SD\ORDG

− :KHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEHDQGZKHQELWRIE\WHLVWKHLPDJHDVSHFWUDWLRVKDOOEH

− ,GHQWLILFDWLRQRIWKHTXDQWL]DWLRQYDOXHLQELWERIE\WHLVRSWLRQDO7KHGHIDXOWYDOXHLVLGHQWLI\LQJDYLGHRSD\ORDGTXDQWL]DWLRQ
UHVROXWLRQRIELWV


$OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO VHULDOGLJLWDOLQWHUIDFH

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV VWDQGDUG LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

3DJHRISDJHV
Rec. UIT-R BT.1614 15

6037(0



7DEOH$ G\QDPLF ±3D\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHSURJUHVVLYHYLGHRSD\ORDGV
RQD*EV QRPLQDO VHULDOGLJLWDOLQWHUIDFH

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  3URJUHVVLYH  SLFWXUH 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  3LFWXUHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
VHHWDEOH  VHHWDEOH 
%LW  5HVHUYHG
%LW  %LWGHSWKELWV  RUELWV  

:KHQLGHQWLI\LQJOLQH3URJUHVVLYHYLGHRSD\ORDGVRQD*ESV QRPLQDO LQWHUIDFHWKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− 7KHSLFWXUHUDWHVKDOORQO\XVHWKHYDOXHVDVGHILQHGLQ6037(0

− 7KHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRK  

− 7KHSURJUHVVLYHSLFWXUHIODJELWVKDOOEHVHWWR

− ,GHQWLILFDWLRQRIWKHTXDQWL]DWLRQYDOXHLQELWERIE\WHLVRSWLRQDO7KHGHIDXOWYDOXHLVLGHQWLI\LQJDYLGHRSD\ORDG
TXDQWL]DWLRQUHVROXWLRQRIELWV

$OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO VHULDOGLJLWDOLQWHUIDFH

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV VWDQGDUG LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

7DEOH$ G\QDPLF ±3D\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHLQWHUODFHGDQGSURJUHVVLYH
YLGHRSD\ORDGVRQD*ESV QRPLQDO VHULDOGLJLWDOLQWHUIDFH

%LWV %\WH %\WH %\WH %\WH
%LW  ,QWHUODFHG  RUSURJUHVVLYH   5HVHUYHG 5HVHUYHG
WUDQVSRUW
%LW  ,QWHUODFHG  RUSURJUHVVLYH   5HVHUYHG 5HVHUYHG
SLFWXUH
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  3LFWXUHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
VHHWDEOH  VHHWDEOH 
%LW  5HVHUYHG
%LW  %LWGHSWKELWV  RUELWV  


:KHQLGHQWLI\LQJOLQH,QWHUODFHGDQG3URJUHVVLYHYLGHRSD\ORDGVRQD*ESV QRPLQDO LQWHUIDFHWKHIROORZLQJOLPLWDWLRQVVKDOO
DSSO\

3DJHRISDJHV
16 Rec. UIT-R BT.1614

6037(0

− 7KHSLFWXUHUDWHVKDOORQO\XVHWKHYDOXHVDVGHILQHGLQ6037(0

− 7KHLQWHUODFHSURJUHVVLYHSLFWXUHIODJELWVKDOOEHVHWWRRUDVGHILQHGE\WKHYLGHRSD\ORDGIRUPDW

− 7KH LQWHUODFHGSURJUHVVLYH WUDQVSRUW IODJ VKDOO EH VHW WR  RU  DV GHILQHG E\ WKH GLJLWDO LQWHUIDFH WUDQVSRUW 1RWH
WKDW3V)YLGHRSD\ORDGVDVGHILQHGLQ6037(53VHWWKHYLGHRSD\ORDGELWWRDYDOXHRI SURJUHVVLYH DQGWKHWUDQVSRUWELWWRD
YDOXHRI LQWHUODFHG 

− ,GHQWLILFDWLRQRIWKHTXDQWL]DWLRQYDOXHLQELWERIE\WHLVRSWLRQDO7KHGHIDXOWYDOXHLVLGHQWLI\LQJDYLGHRSD\ORDGTXDQWL]DWLRQ
UHVROXWLRQRIELWV

$OLQHYLGHRSD\ORDGVRQD*EV QRPLQDO GLJLWDOLQWHUIDFH

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV VWDQGDUG LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

7DEOH$ G\QDPLF ±9LGHRSD\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHYLGHRSD\ORDGV
RQD*EV QRPLQDO VHULDOGLJLWDOLQWHUIDFH


%LWV %\WH %\WH %\WH %\WH
%LW  5HVHUYHG 5HVHUYHG 
5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG &KDQQHODVVLJQPHQW
&KDFWLYH  RU
&KDQG&KDFWLYH  
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  7RWDOOLQHQXPEHU 5HVHUYHG ,PDJHDVSHFWUDWLR
  RU     RU  
%LW    0DSSLQJPRGH
3LFWXUHUDWH 6DPSOLQJVWUXFWXUH 1RUPDOPDSSLQJ  RU
VHHWDEOH  VHHWDEOH$  ZKROHOLQHPDSSLQJ  
%LW  5HVHUYHG
%LW  5HVHUYHG
%LW  %LWGHSWKELWV  RUELWV  

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV VWDQGDUG LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

3DJHRISDJHV
Rec. UIT-R BT.1614 17

6037(0

7DEOH$ G\QDPLF ±$VVLJQPHQWRIFRPELQDWLRQRIVDPSOLQJVWUXFWXUH


DQGLQWHUODFHGRUSURJUHVVLYHSLFWXUH

9DOXH 3LFWXUHUDWH 9DOXH 3LFWXUHUDWH 9DOXH 3LFWXUHUDWH 9DOXH 3LFWXUHUDWH
S L
L <&E&U  L <&E&U 
K K K <&E&U  1R K <&E&U$ 
 1RRU  1RRU 
RU  1RRU 
L S LîFK
S <&E&U 
K *%5$  K K <&E&U  K <&E&U 
1RRU 
1RRU  1RRU  1RRU 
LîFK SîFK
K <&E&U  K <&E&U  $K 5HVHUYHG %K 5HVHUYHG
1RRU  1RRU 
&K 5HVHUYHG 'K 5HVHUYHG (K 5HVHUYHG )K 5HVHUYHG

:KHQLGHQWLI\LQJOLQHYLGHRSD\ORDGVPDSSHGRQWRD*ESVVHULDOGLJLWDOLQWHUIDFHWKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− %LWERIE\WHVKDOOEHXVHGWRGHILQHWKHYLGHRSD\ORDGOLQHFRXQWYDOXHDVWKHWRWDOQXPEHURIYLGHRSD\ORDGOLQHVLQWKHIUDPH
%LWEVKDOOEHVHWWRWRLGHQWLI\OLQHVDQGWRWRLGHQWLI\OLQHV

− 7KHSLFWXUHUDWHLQWDEOH$VKDOOEHVHWWRWKHYDOXHRIWKHOLQHYLGHRSD\ORDGDVGHILQHGLQWDEOHRI6037(0

− 7KHVDPSOLQJVWUXFWXUHLQWDEOH$VKDOOEHVHWWRWKHYDOXHDVGHILQHGLQWDEOHRI6037(0

− %LW E RI E\WH VKDOO EH XVHG WRLGHQWLI\ ZKHWKHU RQO\ FKDQQHO  LV DFWLYH RU ERWK FKDQQHO  DQG %LW EVKDOO EH VHWWR  WR
LGHQWLI\FKDQQHOLVDFWLYHDQGVKDOOEHVHWWRWRLGHQWLI\ERWKFKDQQHODQGFKDQQHODUHDFWLYH

− %LWRIE\WHVKDOOEHXVHGWRLGHQWLI\WKHLPDJHDVSHFWUDWLR%LWVKDOOEHVHWWRWRLGHQWLI\WKDWWKHLPDJHDVSHFWUDWLRLV
DQGWRWRLGHQWLI\WKDWWKHLPDJHDVSHFWUDWLRLV

− %LWRIE\WHVKDOOEHXVHGWRLGHQWLI\WKHPDSSLQJPRGH%LWVKDOOEHVHWWRWRLGHQWLI\QRUPDOPDSSLQJDQGWRWRLGHQWLI\
ZKROHOLQHPDSSLQJ6037(0GHILQHVWKHGHWDLOVRIWKHVHPDSSLQJPRGHV

− ,GHQWLILFDWLRQRIWKHTXDQWL]DWLRQYDOXHLQELWERIE\WHLVRSWLRQDO7KHGHIDXOWYDOXHLVLGHQWLI\LQJDYLGHRSD\ORDGTXDQWL]DWLRQ
UHVROXWLRQRIELWV

$OLQHYLGHRSD\ORDGVRQGXDOOLQN*EV QRPLQDO GLJLWDOLQWHUIDFHV

7KH XQDVVLJQHG YDOXHV RI WDEOH $ DQG WKH GHVFULSWLYH WH[W WKDW IROORZV PD\ EH H[WHQGHG LQ D IXWXUH UHYLVLRQ RI WKLV VWDQGDUG LQ
DFFRUGDQFHZLWKW\SHSURFHGXUHVGHILQHGLQ6037(06XFKH[WHQVLRQVPXVWUHWDLQEDFNZDUGVFRPSDWLELOLW\ZLWKHDUOLHUYHUVLRQV
RIWKLVVWDQGDUG

3DJHRISDJHV
18 Rec. UIT-R BT.1614

6037(0


7DEOH$ G\QDPLF ±9LGHRSD\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHYLGHRSD\ORDGV
RQGXDOOLQN*EV QRPLQDO GLJLWDOLQWHUIDFHV


%LWV %\WH %\WH %\WH %\WH
%LW  ,QWHUODFHG  RUSURJUHVVLYH  
5HVHUYHG 5HVHUYHG
WUDQVSRUW
%LW  ,QWHUODFHG  RUSURJUHVVLYH   &KDQQHODVVLJQPHQWRIGXDOOLQN
5HVHUYHG
SLFWXUH &K  RU&K  
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG '\QDPLFUDQJH K 
K  K 5HVHUYHG K 
%LW 
%LW  5HVHUYHG
3LFWXUHUDWH 6DPSOLQJVWUXFWXUH
%LW  VHHWDEOH  VHHWDEOH  %LWGHSWK
%LW  ELW K ELW K ELW K 
5HVHUYHG K 

:KHQLGHQWLI\LQJOLQHYLGHRSD\ORDGVPDSSHGRQWRGXDOOLQN*EVGLJLWDOLQWHUIDFHVWKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− 7KHSLFWXUHUDWHVKDOOEHVHWWRWKHYDOXHRIWKHOLQHLQWHUIDFHDVGHILQHGLQ6037(0

− 7KHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRWKHYDOXHDVGHILQHGLQ6037(07KLVVKDOOLQFOXGHWKHXVHRIWKHDOSKDFKDQQHODVD
FDUULHURIGDWDDVZHOODVYLGHR

− 7KHFKDQQHOQXPEHULQELWERIE\WHVKDOOEHVHWWRDYDOXHRIIRUWKHILUVWOLQNDQGWRIRUWKHVHFRQGOLQN

− ([WHQGHGG\QDPLFUDQJHRIWKHVDPSOLQJTXDQWL]DWLRQVKDOOEHLGHQWLILHGE\ELWVEDQGERIE\WHKDYLQJWKHIROORZLQJYDOXHV

 ±KLGHQWLILHVTXDQWL]DWLRQZKHUHWKHYDOXHUDQJHLVQRUPDO
 ±KLGHQWLILHVTXDQWL]DWLRQZKHUHWKHYDOXHUDQJHLVH[WHQGHGWRRIQRUPDO
 ±KLGHQWLILHVTXDQWL]DWLRQZKHUHWKHYDOXHUDQJHLVH[WHQGHGWRRIQRUPDO

− 7KHELWGHSWKRIWKHVDPSOHTXDQWL]DWLRQVKDOOEHLGHQWLILHGE\ELWVEDQGERIE\WHKDYLQJWKHIROORZLQJYDOXHV

 ±KLGHQWLILHVTXDQWL]DWLRQXVLQJELWVSHUVDPSOH
 ±KLGHQWLILHVTXDQWL]DWLRQXVLQJELWVSHUVDPSOH
 ±KLGHQWLILHVTXDQWL]DWLRQXVLQJELWVSHUVDPSOH


3DJHRISDJHV
Rec. UIT-R BT.1614 19

6037(0

$QQH[% QRUPDWLYH 
3D\ORDGLGHQWLILHUGHILQLWLRQVIRUH[LVWLQJLQWHUIDFHV

7KHSD\ORDGLGHQWLILHUYDOXHVGHILQHGLQWKLVDQQH[VKRXOGQRWEHLPSOHPHQWHGLQQHZHQFRGHUGHVLJQV7KHLQFOXVLRQRIWKLVDQQH[LV
VROHO\WRDOORZGHFRGHUVFRQIRUPLQJWRWKLVVWDQGDUGWREHDEOHWRLGHQWLI\DQGGHFRGHSD\ORDGLGHQWLILHUVWKDWKDYHEHHQLPSOHPHQWHG
DFFRUGLQJWRWKHWULDOSXEOLFDWLRQYHUVLRQDVSXEOLVKHGLQWKH-XO\LVVXHRIWKH6037(-RXUQDO

%,785%7SD\ORDGVRQ6037(06', OLQHSD\ORDGV 

7DEOH%±3D\ORDGLGHQWLILHUGHILQLWLRQVIRU,785%7SD\ORDGVRQ6037(06',

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG  5HVHUYHG
%LW    5HVHUYHG
%LW  )UDPHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
%LW  5HVHUYHG
%LW  5HVHUYHG

:KHQLGHQWLI\LQJ,785%7YLGHRSD\ORDGVRQ6037(06',WKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− 7KHIUDPHUDWHVKDOORQO\XVHWKHYDOXHVK +], DQGK +], LQDFFRUGDQFHZLWKWKHSD\ORDGIUDPHUDWH

− 7KHVDPSOLQJLGHQWLILFDWLRQVKDOORQO\XVHWKHIROORZLQJYDOXHV

 ±KWRLGHQWLI\,DFWLYHOXPLQDQFHSL[HOVSHUOLQH0EV6',
 ±KWRLGHQWLI\,DFWLYHOXPLQDQFHSL[HOVSHUOLQH0EV6',
 ±)KWRLGHQWLI\,DFWLYHOXPLQDQFHSL[HOVSHUOLQH0EV6',

− %LWRIE\WHVKDOORQO\EHXVHGIRUVDPSOLQJVWUXFWXUHVEDVHGRQSD\ORDGVZLWKDFWLYHOXPLQDQFHVDPSOHV,QWKHVHFDVHV
LIWKHELWLVWKHQWKHVRXUFHLPDJHDVSHFWUDWLRLVDQGLIWKHELWLVWKHQWKHVRXUFHLPDJHDVSHFWUDWLRLV LHDQDPRUSKLF 

%,785%7SD\ORDGVRQ,785%76', OLQHSD\ORDGVRQ0EVVLQJOHOLQN6',DQG0EVGXDOOLQN
6', 

7DEOH%±3D\ORDGLGHQWLILHUGHILQLWLRQVIRU,785%7SD\ORDGVRQ,785%76',

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG &KDQQHOQXPEHU 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG  5HVHUYHG
%LW    5HVHUYHG
%LW  )UDPHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
%LW  5HVHUYHG
%LW  5HVHUYHG

3DJHRISDJHV
20 Rec. UIT-R BT.1614

6037(0

:KHQLGHQWLI\LQJWKH,785%73YLGHRSD\ORDGRQWKH,785%76',WKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− 7KH IUDPH UDWH VKDOO RQO\ XVH WKH YDOXHV K  +]  IRU 3V\VWHPV DQG$K  +]  IRU 3 LQ DFFRUGDQFH ZLWK ,78
%7

− 7KHVDPSOLQJVWUXFWXUHVKDOORQO\XVHWKHYDOXHVKIRUVLQJOHOLQN0EV6',DQGKIRU0EVGXDOOLQN6',

− ,QWKHFDVHRIGXDOOLQN0EV6',ELWVEDQGERIE\WHVKDOOGHILQHDFRXQWYDOXHLQWKHUDQJHWR ZKHUHGHILQHV
VLQJOHOLQN RSHUDWLRQ  GHILQHV FKDQQHO  RI GXDOOLQN RSHUDWLRQ DQG   GHILQHV FKDQQHO  RI GXDOOLQN RSHUDWLRQ 7KH YDOXH RI  LV
UHVHUYHGEXWQRWGHILQHG

− %LWRIE\WHVKDOOEHXVHGWRGHILQHWKHVRXUFHLPDJHDVSHFWUDWLRIRUSD\ORDGVZLWKDFWLYHOXPLQDQFHVDPSOHVSHUOLQH,I
WKHELWLVWKHQWKHVRXUFHLPDJHDVSHFWUDWLRLVDQGLIWKHELWLVWKHQWKHVRXUFHLPDJHDVSHFWUDWLRLV LHDQDPRUSKLF 

%1 OLQHSD\ORDGVRQ0EV6', 

7DEOH%±3D\ORDGLGHQWLILHUGHILQLWLRQVIRUSURJUHVVLYHDQGLQWHUODFHGSD\ORDGVRQ0EV6',

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG  5HVHUYHG
%LW    5HVHUYHG
%LW  )UDPHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
%LW  5HVHUYHG
%LW  5HVHUYHG


2QO\WKHIROORZLQJOLVWRIIUDPHUDWHVLQFRPELQDWLRQZLWKVDPSOLQJVWUXFWXUHVVKDOOEHVXSSRUWHG

− )UDPHUDWH K +], DQGVDPSOLQJVWUXFWXUH K ,<&E&U.H\ 
− )UDPHUDWH K +], DQGVDPSOLQJVWUXFWXUH K ,<&E&U.H\ 
− )UDPHUDWH K +], DQGVDPSOLQJVWUXFWXUH K ,5*%.H\ 
− )UDPHUDWH K +], DQGVDPSOLQJVWUXFWXUH K ,5*%.H\ 
− )UDPHUDWH K +], DQGVDPSOLQJVWUXFWXUH K 3 
− )UDPHUDWH $K +], DQGVDPSOLQJVWUXFWXUH K 3 
− %LWRIE\WHVKDOOEHXVHGWRGHILQHWKHVRXUFHLPDJHDVSHFWUDWLRIRUSD\ORDGVZLWKDFWLYHOXPLQDQFHVDPSOHVSHUOLQH,I
WKHELWLVµ¶WKHQWKHVRXUFHLPDJHDVSHFWUDWLRLVDQGLIWKHELWLVµ¶WKHQWKHVRXUFHLPDJHDVSHFWUDWLRLV LHDQDPRUSKLF 

3DJHRISDJHV
Rec. UIT-R BT.1614 21

6037(0

%6037(0 OLQHSD\ORDGV RQ6037(0+'6',




7DEOH%±3D\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHYLGHRLQWHUIDFHVRQ6037(0

%LWV %\WH %\WH %\WH %\WH
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  )UDPHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
%LW  5HVHUYHG
%LW  5HVHUYHG


− 7KHIUDPHUDWHVKDOORQO\XVHWKHYDOXHVDVGHILQHGLQ6037(0

− 7KHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRK 3 

%6037(0DQG6037(53 OLQHSD\ORDGV RQ6037(0+'6',

7DEOH%±3D\ORDGLGHQWLILHUGHILQLWLRQVIRUOLQHSD\ORDGVRQ6037(0

%LWV %\WH %\WH %\WH %\WH


%LW  3,DQG3V),GHQWLILFDWLRQ 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW    5HVHUYHG
%LW  )UDPH5DWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
%LW  5HVHUYHG
%LW  5HVHUYHG

:KHQLGHQWLI\LQJWKHYLGHRSD\ORDGRQ6037(0LQWHUIDFHVWKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− 7KHIUDPHUDWHVKDOORQO\XVHWKHYDOXHVDVGHILQHGLQ6037(0

− %LWVEDQGERIE\WHVKDOOGHILQHDQXPEHUWRLGHQWLI\WKHVFDQQLQJIRUPDW7KHIROORZLQJYDOXHVVKDOOEHXVHGWRGHILQHWKH
VFDQQLQJIRUPDW

 ±K ,QWHUODFH , ,QWKLVFDVHWKHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRK , 
 ±K 6HJPHQWHGIUDPH 3V) ,QWKLVFDVHWKHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRK 3 
 ±K 3URJUHVVLYH 3 ,QWKLVFDVHWKHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRK 3 

− 7KHYDOXHKLVUHVHUYHGEXWQRWGHILQHG


3DJHRISDJHV
22 Rec. UIT-R BT.1614

6037(0


%6037(0 6'YLGHRSD\ORDGPDSSLQJLQWR6037(0 

7DEOH%±3D\ORDGLGHQWLILHUGHILQLWLRQVIRUPDSSLQJ6'LQWHUIDFHVLQWR6037(0+'6',

%LWV %\WH %\WH %\WH %\WH


%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG 0DSSLQJPRGH 5HVHUYHG
%LW  5HVHUYHG 5HVHUYHG 5HVHUYHG
%LW  5HVHUYHG  5HVHUYHG
%LW    5HVHUYHG
%LW  )UDPHUDWH 6DPSOLQJVWUXFWXUH 5HVHUYHG
%LW  5HVHUYHG
%LW  5HVHUYHG

:KHQLGHQWLI\LQJ6'YLGHRSD\ORDGVPDSSHGRQWR6037(0WKHIROORZLQJOLPLWDWLRQVVKDOODSSO\

− 7KHIUDPHUDWHVKDOOEHVHWWRWKHYDOXHRIWKH6'LQWHUIDFHDVGHILQHGLQWDEOHRI6037(0

− 7KHVDPSOLQJVWUXFWXUHVKDOOEHVHWWRWKHYDOXHDVGHILQHGLQWDEOHRI6037(0

− %LWRIE\WHVKDOOEHXVHGWRLGHQWLI\WKHPDSSLQJPRGH6HWWLQJELWWRVKDOOGHILQHQRUPDOPDSSLQJDQGVHWWLQJELWWR
VKDOOGHILQHZKROHOLQHPDSSLQJ VHH6037(0IRUGHWDLOVRQWKHPDSSLQJPRGHV 

− %LWRIE\WHVKDOORQO\EHXVHGIRUVDPSOLQJVWUXFWXUHVEDVHGRQSD\ORDGVZLWKDFWLYHOXPLQDQFHVDPSOHV,QWKHVHFDVHVLI
WKHELWLVWKHQWKHVRXUFHLPDJHDVSHFWUDWLRLVDQGLIWKHELWLVWKHQWKHVRXUFHLPDJHDVSHFWUDWLRLV LHDQDPRUSKLF 

3DJHRISDJHV
Rec. UIT-R BT.1614 23

6037(0

$QQH[& LQIRUPDWLYH 
0DSSLQJ WKH YLGHR SD\ORDG LGHQWLILHU IURP DQ +$QF SDFNHW WR D ./9 SDFNHW DFFRUGLQJ WR WKH GDWD
HQFRGLQJSURWRFROGHILQHGLQ6037(0

,WVKRXOGEHQRWHGWKDWWKH+$QFGDWDSDFNHWKDVDNH\±OHQJWK±YDOXH ./9 FRQVWUXFWOLNHWKDWRI6037(07KHSDFNHWVWDUWVZLWK
VWDUWFRGHWKH$')ZRUGVHTXHQFHZKLFKLVDGHILQHGVWDUWFRGHLQGLJLWDOYLGHRLQWHUIDFHV7KLVLVIROORZHGE\','DQG6',' ZRUGV
ZKLFKGHILQHWKHGDWDW\SHDGDWDFRXQWDQGWKHGDWDLWVHOI WKHYLGHRSD\ORDGLGHQWLILHUYDOXH 7KHSDFNHWLVFRPSOHWHGZLWKDFKHFNVXP
WRGHWHFWSRVVLEOHHUURUV,IWKH$')DQG&6ZRUGVDUHUHPRYHGWKHQWKHGDWDVWUXFWXUHLVDNH\±OHQJWK±YDOXH7KXVWKHYDOXHRIWKH+
$QFSDFNHW LHWKHYLGHRSD\ORDGLGHQWLILHUZRUGV FDQEHPDSSHGLQWRWKH./9SURWRFRORI6037(0DVIROORZV

ADF-1
16-byte
Start ADF-2
Sequence Key

ADF-3
2-byte Anc ID
DID mapped to 16-
byte SMPTE UL
SDID

Data Count Length

SMPTE 291M SMPTE 336M


Anc Data KLV pack
Packet (type 2) 4-byte 4-byte coding
Payload Payload
Identifier Identifier

CRC


)LJXUH&±0DSSLQJWKHYLGHRSD\ORDGLGHQWLILHUIURPDQ+$QFSDFNHWLQWRD./9SDFNHW

7DEOH&±0DSSLQJWKHFRPSRQHQWVRIDQ+$QFSDFNHWWRD./9SDFNHW

'DWDVWUXFWXUH +$QFSDFNHW ./9SURWRFRO
.H\ ','6',' E\WH8QLYHUVDOODEHO
/HQJWK '& Variable length
9DOXH E\WH6',YLGHRSD\ORDGLGHQWLILHU E\WH6',YLGHRSD\ORDGLGHQWLILHU

,QPDSSLQJ+$QFSDFNHWGDWDLQWRD./9GDWDSDFNHWLWLVRIFRXUVHSRVVLEOHWRFRQVLGHUPDSSLQJWKHZKROH+$QFSDFNHWDVWKHYDOXH
EXWWKLVLVDWXQQHOLQJSURFHVVLQZKLFKWKHUHDUHWZROD\HUVRIRYHUKHDGRQHIURPWKH+$QFSDFNHWVWUXFWXUHDQGRQHIURPWKH./9GDWD
FRQVWUXFW 7KLV DGGV QR YDOXH VR WKH FRQFHSW RI KHWHURJHQHRXV RSHUDWLRQ ZKHUH WKH YLGHR SD\ORDG LV PDSSHG LQWR WKH ORFDO GDWD
FRQVWUXFWLVSUHIHUUHGWRWKDWRIWXQQHOLQJ

7KHE\WHYLGHRSD\ORDGLGHQWLILHULVDGDWDSDFNFRPSULVLQJPXOWLSOHPHWDGDWDSDUDPHWHUVLQDSUHDVVLJQHGIRUP7KLVGDWDSDFNVKRXOG
EHDGGHGWRDQ\6037(GDWDSDFNUHJLVWU\ZKLFKPD\EHFUHDWHGLQWKHIXWXUHZLWKWKHIROORZLQJJXLGDQFHIRUWKH6037(8QLYHUVDOODEHO
8/ DVWKHSDFNNH\

3DJHRISDJHV
24 Rec. UIT-R BT.1614

6037(0

7DEOH&±5HFRPPHQGHGYDOXHIRUWKH6037(8/


 %\WH1R 'HVFULSWLRQ 9DOXH KH[ 
  2EMHFWLGHQWLILHU K

  /DEHOVL]H (K
  'HVLJQDWLRQ,62 %K

  'HVLJQDWLRQ6037( K

 5HJLVWU\FDWHJRU\6HWVDQGSDFNV K

  5HJLVWU\GHVLJQDWRU)L[HGOHQJWKSDFNV K

 6WDQGDUG3DFNVWDQGDUG K

  9HUVLRQQXPEHU K

 6037(UHJLVWHUHGGDWD K

  'HILQLQJGRFXPHQW$QFSDFNHWV K

 $QFLOODU\GDWDSDFNHW',' K

  $QFLOODU\SDFNHW6',' K

 =HURILOO K

  =HURILOO K

 =HURILOO K

  =HURILOO K


127(±7KHDERYHE\WH8/YDOXHLVVKRZQIRUJXLGDQFHRQO\8VHUVVKRXOGFRQVXOWDQDSSURSULDWHUHJLVWU\IRUDGHILQLWLYHYDOXH

3DJHRISDJHV
Rec. UIT-R BT.1614 25

6037(0

$QQH[' LQIRUPDWLYH 
:K\GRZHQHHGDYLGHRSD\ORDGLGHQWLILHUDQGZK\LVLWE\WHVORQJ"

7KH ILUVW FRPSRQHQW GLJLWDO YLGHR LQWHUIDFH VSHFLILFDWLRQV ZHUH EDVHG RQ D XQLTXH PDSSLQJ RI WKH SLFWXUH UDVWHU RQWR D V\QFKURQRXV
WUDQVSRUWPHFKDQLVP7KXVWKHDQGYDULDQWVDUHYHUWLFDOVWDQGDUGVZKLFKHQFRPSDVVDOOOHYHOVRIWKH,6226,OD\HUUHIHUHQFH
PRGHO $W WKH WLPH RI GHYHORSLQJ WKHVH VWDQGDUGV WKH WHFKQRORJ\ ZDV LQ LWV LQIDQF\ DQG PDQXIDFWXUHUV KDG WR XVH WKH IDVWHVW FKLSV
DYDLODEOHDWWKHWLPHWRDFKLHYHWKH0ESVVHULDOGDWDUDWH

+RZHYHU HYHQ LQ WKRVH HDUO\ GD\V VRPH  \HDUV DJR WKHUH ZHUH DOUHDG\ XVHUV ZKR ZLVKHG WR XVH WKH LQWHUIDFHV LQ PRUH FUHDWLYH
ZD\V,QSDUWLFXODUWKHXVHRIWZRGLJLWDOYLGHRLQWHUIDFHFKDQQHOVZLWKRQHFKDQQHOFDUU\LQJWKHEDVHEDQGVDPSOHVWUXFWXUHDQGWKH
VHFRQGFDUU\LQJDOLQHDUNH\FKDQQHODQGWKHPLVVLQJFKURPLQDQFHVDPSOHVWRPDNHDVRFDOOHG[V\VWHP6XFKGHYHORSPHQWVZHUH
XVHG E\ RQO\ D VPDOO QXPEHU RIXVHUV DQGWKXV WKH SUREOHP RI ODEHOOLQJ WKH WZLQ FRQQHFWLRQV ZDV D PDWWHU RI SK\VLFDOO\ WDJJLQJWKH
FDEOHVWRHQVXUHWKHFKDQQHOVZHUHFRQQHFWHGFRUUHFWO\

$ IXUWKHU GHYHORSPHQW ZDV WKDW RI WKH 0EV 6', ZKLFK H[WHQGHG WKH KRUL]RQWDO EDQGZLGWK E\ D WKLUG IRU XVH ZLWK ZLGHVFUHHQ
WHOHYLVLRQ EDVHG RQ  DFWLYH OXPLQDQFH VDPSOHV SHU OLQH UDWKHU WKDQ WKH  SL[HOV LQ 0EV 6', 7KLV KRZHYHU ZDV VWLOO
PDQDJHDEOHDQGFRPSDWLELOLW\ZLWK0EV6',ZDVUHODWLYHO\HDVLO\PDLQWDLQHG

7KHQH[WPDMRUPLOHVWRQHLQ6',KLVWRU\ZDVWKHH[WHQVLRQWRFDUU\GDWDZKLFKLQLWVYDULRXVIRUPVLVQRZNQRZQDVWKHWUDQVSRUWIRUGDWD
FDUULDJH6'7, 6037(0 7KLVGLVWLQJXLVKHVLWVHOIIURP6',E\DGGLQJDYLGHRSD\ORDGLGHQWLILHULQWKH+EODQNLQJWRLGHQWLI\LWVHOI
DV6'7,DQGWRLGHQWLI\WKHYLGHRSD\ORDGSDFNHWVWUXFWXUHFDUULHGE\WKHWUDQVSRUW

7KH LQLWLDO GHYHORSPHQW RI +'6', 6037( 0  ZDV DJDLQ DQ H[RWLF WHFKQRORJ\ DW WKH WLPH KDYLQJ D GDWD UDWH  ZKLFK KDV ILQDOO\
VHWWOHGDW*EV QRPLQDO ,WWRRFDUULHGDVLQJOHYLGHRSD\ORDGLQLWLDOO\EDVHGRQDVLQJOHYLGHRVDPSOLQJVWUXFWXUH+RZHYHUQHZ
GHYHORSPHQWVSURGXFHGWZRVDPSOHVWUXFWXUHYDULDQWV

− $ILUVWV\VWHPEDVHVRQDFWLYHOLQHVLQDQLQWHUODFHGSLFWXUHZLWKKRUL]RQWDOOXPLQDQFHVDPSOHVDQG

− $VHFRQGV\VWHPEDVHGRQDFWLYHOLQHVLQDSURJUHVVLYHSLFWXUHZLWKKRUL]RQWDOOXPLQDQFHVDPSOHV

%RWKXVHGWKH+'6',LQWHUIDFHDVDFRPPRQFDUULHU1RZWKDW+'LVFRQVLGHUHGDVDZRUOGZLGHSURGXFWLRQIRUPDWWKHOLVWRIVDPSOLQJ
YDULDQWVLQWKHOLQHIDPLO\KDVUHDFKHGDQGWKDWRIWKHOLQHIDPLO\KDVUHDFKHGWRDFFRPPRGDWHWKHGLIIHUHQWSLFWXUHUDWHV
XVHGWKURXJKRXWWKHZRUOG

$ IXUWKHU GHYHORSPHQW LV WKDW RI 0EV 6', ZKLFK LV GHVLJQHG WR FDUU\ D QXPEHU RI YLGHR SD\ORDGV LQFOXGLQJ SURJUHVVLYH VFDQ
+] DQGSRWHQWLDOO\+] V\VWHPV

7KHODWHVWGHYHORSPHQWLVWKHPDSSLQJRIVWDQGDUGGHILQLWLRQYLGHRRQWR+'6',ZLWKWKHDLPRIXVLQJRQHLQWHUIDFHWRFDUU\PDQ\YLGHR
SD\ORDGV

7KHVHRQJRLQJGHYHORSPHQWVDUHSRVVLEOHEHFDXVHWKHWHFKQRORJ\QRZDOORZVVXFKFDSDELOLW\DQGWKH+'6',LQWHUIDFHLQSDUWLFXODUKDV
WKHFDSDFLW\WRFDUU\DOPRVWHYHU\YLGHRV\VWHPLQXVHWRGD\DQGWKHQHDUIXWXUH

7KHSUREOHPLVWKDWLWLVQRZEHFRPLQJGLIILFXOWIRUHTXLSPHQWWRUHFRJQL]HWKHYLGHRSD\ORDGW\SHDVLWLVQRORQJHULQWLPDWHO\UHODWHGWR
WKHLQWHUIDFH:HDUHPRYLQJLQH[RUDEO\WRWKHKRUL]RQWDOPRGHORIVWDQGDUGVZKHUHHDFKKRUL]RQWDOOD\HULVEHFRPLQJGHWDFKHGIURPWKH
OD\HUVLPPHGLDWHO\DERYHDQGEHORZ

:K\LVWKHYLGHRSD\ORDGLGHQWLILHUE\WHVORQJ"

7KHYLGHRSD\ORDGLGHQWLILHUKDVEHHQSURSRVHGDVDE\WHOHQJWKIRUDQXPEHURIUHDVRQV

− RUE\WHVGRHVQRWJLYHVXIILFLHQWIOH[LELOLW\IRUSRVVLEOHIXWXUH XQIRUHVHHQ DSSOLFDWLRQV

− $E\WH6037(8QLYHUVDOODEHOLVDJURVVH[FHVVRIFDSDELOLW\8QLYHUVDOODEHOVDUHFRQYHQWLRQDOO\LQPXOWLSOHVRIE\WHVXSWR
E\WHVPD[LPXP

− $E\WHYLGHRSD\ORDGLGHQWLILHUDOORZVERWKHDV\SDUVLQJDQGFDQDFFRPPRGDWHDOOIRUHVHHQUHTXLUHPHQWVZLWKDGHTXDWHURRP
IRUIXUWKHUH[SDQVLRQIRUXQIRUHVHHQUHTXLUHPHQWVLQWKHIXWXUH

− ,WLVUHODWLYHO\HDV\IRUWKLVLGHQWLILHUWREHHQFRGHGDQGGHFRGHGE\KDUGZDUHLQWHQVLYHHTXLSPHQW

$YLGHRSD\ORDGLGHQWLILHUFRXOGEHXVHGWRLGHQWLI\FRUHVDPSOLQJSDUDPHWHUVVXFKDV+DQG9UHVROXWLRQVOXPLQDQFHDQGFKURPLQDQFH
VDPSOLQJVWUXFWXUHV DQGPRUH ,W ZRXOG WKHQ HQFRPSDVV LQIRUPDWLRQ ZKLFK LV SURYLGHG E\ WKH 6037( YLGHR LQGH[ 6037( 53  
7DNLQJ WKLV DSSURDFK WR LWV ORJLFDO FRQFOXVLRQPHDQVWKDW WKH YLGHR SD\ORDG LGHQWLILHU EHFRPHV D OHQJWK\ PHWDGDWD VHW UDWKHU WKDQ DQ
LGHQWLILHU

7KHDERYHDSSURDFKZDVUHMHFWHGDVEHLQJWRRFRPSOH[IRUUHODWLYHO\VLPSOHGLJLWDOYLGHRLQWHUIDFHFRQQHFWLRQVDQGUHSOLFDWHVLQIRUPDWLRQ
ZKLFKZRXOGEHEHWWHUSODFHGHOVHZKHUHVXFKDVWKHYLGHRLQGH[


3DJHRISDJHV
26 Rec. UIT-R BT.1614

6037(0

7KHVLPSOHDSSURDFKXVHGLQWKLVVWDQGDUGXVHVWKHYLGHRSD\ORDGLGHQWLILHUWRLGHQWLI\WKHUHOHYDQW6037(VWDQGDUGDQGDQ\RSWLRQV
ZLWKLQWKDWVWDQGDUG$QH[DPSOHZRXOGEHWRXVHWKHILUVWE\WHRIWKHYLGHRSD\ORDGLGHQWLILHUWRSRLQWWR6037(0 OLQHYLGHR
SD\ORDGV  DQG WKHQ XVH WKH UHPDLQLQJ SDUWV WR LGHQWLI\ WKH WDEOH HQWU\ LQ WKH VWDQGDUG 6LQFH WKH QXPEHU RI GLJLWDO YLGHR LQWHUIDFH
VWDQGDUGVLVOLPLWHGDQGWKHQXPEHURIWDEOHVLQHDFKHQWU\LVW\SLFDOO\UHVWULFWHGWRDIHZHQWULHVWKLVSURFHVVFDQEHVLPSO\GHILQHGDQG
HDVLO\SDUVHGE\GHFRGHUV





$QQH[( LQIRUPDWLYH 
%LEOLRJUDSK\

6037(07HOHYLVLRQ²[$FWLYH/LQHDW+]3URJUHVVLYH6FDQ3URGXFWLRQ²'LJLWDO5HSUHVHQWDWLRQ

6037(07HOHYLVLRQ²[$FWLYH/LQHDW+]3URJUHVVLYH6FDQ3URGXFWLRQ²%LW6HULDO,QWHUIDFHV

6037(07HOHYLVLRQ²%LW'LJLWDO$XGLR)RUPDWIRU+'79%LW6HULDO,QWHUIDFH

6037(07HOHYLVLRQ²'DWD(QFRGLQJ3URWRFROXVLQJ.H\/HQJWK9DOXH

,785%76WXGLR(QFRGLQJ3DUDPHWHUVRI'LJLWDO7HOHYLVLRQIRU6WDQGDUGDQG:LGH6FUHHQ$VSHFW5DWLRV


3DJHRISDJHV