Vous êtes sur la page 1sur 19

EXERCICE 1.

1. Représenter les extrémités des fragments de restriction obtenus après digestion par les enzymes de
restrictions suivantes en les classant selon la nature de ces extrémités (franches, 5'- ou 3'-sortantes).

BamH1 G/GATCC
HincII GTPy/PuAC
HpaII C/CGG
MspI C/CGG ou Cm/CGG (m :méthylée).
MboI /GATC
Sau3A GATC/
SmaI CCC/GGG
AccI GT/CGAC
KpnI GGTAC/C
EcoRI G/AATTC
PstI CTGCA/G
BglII A/GATCT

EXERCICE 2.

1. Si on utilise une enzyme de restriction possédant un site de restriction de 4 bases, quelles seront la fréquence
de coupure d'un ADN génomique et la taille moyenne des fragments de restriction obtenus ?

2. Même question pour une enzyme ayant un site de reconnaissance de 6 paires de bases.

QUESTION 3.

On veut digérer par l'enzyme EcoRI, 10 µg d'un fragment d'ADN linéaire aux extrémités SmaI-KpnI. L'ADN est
disponible en solution à la concentration de 0,5µg/ml. L'enzyme est à votre disposition à la concentration de 5U/µl
dans une solution de glycérol 50%.

Sachant que :

- une unité (U) d'enzyme digère 1µg d'ADN en 1h à 37°C. Pour être certain que la coupure sera totale on utilise
l'enzyme EcoRI 5 fois en excès.

- Pour que l'enzyme ait son maximum d'efficacité, il est nécessaire d'ajouter un tampon de digestion contenant du
NaCl à 50mM, du MgCl2 à 10mM dans un tampon Tris 0,1M, pH 7,5. Vous disposer d'une solution de tampon de
digestion concentrée (NaCl 0,5M; 0.1M; Tris 1M, pH 7,5).

- Pour que l'enzyme fonctionne correctement, la concentration en glycérol ne doit pas excéder 5%.

1. Décrire le protocole de digestion en respectant les conditions.

Après une incubation de 2 heures à 37°C, les produits de digestion sont analysés par électrophorèse sur gel
d'agarose (figure 1).

2. Expliquer le principe de cette expérience.

3. Comment visualise t-on les fragments d'ADN sur le gel ?

1
4. Calculer la taille des différents fragments d'ADN produits de la digestion (puits 1) en utilisant les fragments
d'ADN marqueurs de taille (puits 2). Ces fragments proviennent de la digestion par HindIII de l'ADN du
phage Lambda [sept bandes sont visibles de tailles 23 - 9,5 - 6,6 - 4,3 - 2,3 - 2 et 0,56 kb (1 kb = 1000 paires de
bases)].

La même expérience est réalisée avec d'autres enzymes et à donner les résultats suivants

Enzyme(s) utilisée(s) Taille des fragments obtenus (en kb)


MspI 8 et 0,5
EcoRI + MspI 3,5 - 3 - 1,5 - 0,5
BglII 7,5 et 1
EcoRI + BglII 4 - 3 - 1 et 0,5

5. Donner la taille et la carte de restriction de ce fragment d'ADN sachant que le site MspI et situé près du
site SmaI.

On veut insérer dans le vecteur plasmidique pUC les fragments EcoRI-EcoRI (fragment A), SmaI-MspI (fragment
B) et BglII-KpnI (Fragment C) produits de la digestion de l'ADN initial..

L'ADN du vecteur pUC possède un SMC (site multiple de clonage). Les sites de restriction du SMC sont dans
l'ordre suivant : EcoRI - KpnI - SmaI - BamHI - AccI - PstI - HindIII. Ces sites sont uniques dans le vecteur. On sait
par ailleurs que le vecteur pUC possède 13 sites de reconnaissance par l'enzyme MspI et aucun pour l'enzyme BglII.

6. Quelles enzymes peut-on utiliser pour insérer les différents fragments A, B et C dans le SMC du
vecteur pUC ?

Après insertion des fragments dans le plasmide, la construction plasmidique est introduite dans des bactéries
(transformation) et un clone de bactéries transformées et mis en culture. L'ADN est ensuite purifié et on cherche à
isoler les fragments clonés.

7. Quelles enzymes peut-on utiliser pour ressortir les fragments insérés dans le vecteur pUC ?

EXERCICE 4

Un fragment d'ADN est inséré au niveau d'un site HindIII du plasmide pBR322. La carte de restriction de ce
plasmide non recombinant est présentée sur la figure 2.

Les produits de digestion enzymatique du plasmide recombinant sont analysés après électrophorèse sur gel
d'agarose (figure 3). L'ADN du plasmide recombinant à été coupé par les enzymes EcoRI (puits 1), ClaI (puits 2)
et PstI (puits 3). Le puits T montre les produits de digestion du plasmide pBR322 non recombinant digéré par
l'enzyme EcoRI.

1. De combien de paires de bases est constitué le fragment d'ADN inséré dans le vecteur pBR322 ?

2. Positionner les sites de restriction ClaI et PstI de ce fragment sur un schéma.

Le plasmide recombinant est digéré par les enzymes de restriction ClaI et PstI.

3. Quelle sera la taille (en pb) des fragments produits de cette digestion ? Combien de bandes distinctes seront
visualisées sur un gel d'agarose après une électrophorèse ?

2
4. Pourquoi n'a t-on pas inséré le fragment d'ADN au niveau du site AvaI de pBR322 ?

Figure 2. Le plasmide pBR322 est linéaire et constitué de


4363 paires de bases.

Figure 1.
Figure 3.

EX 1

Interprétation de l'extraction de l'ADN plasmidique par lyse alcaline:


Les techniques les plus courantes de l'extraction et la purification de l'ADN des
plasmides par lyse alcaline ont des noms abrégés selon 'miniprep', 'midiprep' et
'maxiprep' (selon le volume de laculture bactérienne). Le but consiste à faire une
extraction rapide de l'ADN du plasmide (ADN plasmidique) afin de faire une analyse par
digestion via les enzymes de restriction et la séparation par électrophorèse. Les
digestions servent à vérifier un clone et/ou établir une carte de restriction.

3
Expliquer les différentes étapes de l'extraction de l'ADN plasmidique par lyse
alcaline comme résumée dans la figure ci contre.

Exercice 2 (d'après http://step.ipgp.jussieu.fr) (Réponse 2). Clonage et analyse de l'ADN


recombinant. On souhaite étudier la fonctionnalité d’un gène M d’une bactérie.
Pour cela, on essaie de cloner au site EcoRI du vecteur plasmidique pBR330 (voir
schéma) un fragment Eco RI-Eco RI d'ADN génomique de la bactérie d’intérêt.

4
a- Proposez un protocole de clonage et indiquez comment vous sélectionnez les clones
recombinants.

b- Un des plasmides recombinants contenant le gène M (appelé pBM1) est digéré par
les enzymes de restriction Bam HI et Eco RI. Après migration et séparation des
fragments d'ADN par électrophorèses sur gel d'agarose puis coloration au bromure
d'éthidium, on obtient les profils de restriction ci contre.

Donnez la carte de restriction du plasmide recombinant pBM1.

Exercice 3 (Réponse 3). Carte de restriction d'un plasmide circulaire double brin.

On se propose d'établir la carte de restriction d'un plasmide par deux enzymes de


restriction, EcoR I et Pst I. La digestion par les deux enzymes a donné les fragments
indiqués dans le tableau ci dessous. Dessiner la carte de restriction du plasmide.

Exercice 4 (Réponse 4). Séquençage de l'ADN d'un gène

5
Pour établir la carte de restriction de l'ADN d'un gène, une solution d'ADN a été réparti
en 3 fractions soumises à une hydrolyse avec EcoR I, Hind III et EcoR I + Hind III,
respectivement. Les hydrolysats ont été séparés par électrophorèse. La détection des
fraguements d'ADN a été réalisée par hybrIdation avec une sonde marquée du gène
étudié. Les résultats de l'électrophorèse sont montrés dans la figure ci dessous.
Dessiner la carte de restriction de l'ADN du gène.

Réponses

Réponse 1 (Exercice 1)
- Lyse des cellules par le détergent (SDS) en présence de soude (pH 13) dénaturant
l'ADN total (plasmide + Chromosome).

- Neutralisation rapide par addition de l'acétate de potassium (pH 5,5): L'ADN


plasmidique se renature tandis que l'ADN chromosomique précipite.

- Concentration de l'ADN plasmidique par précipitation à l'alcool et récupération de


l’ADN par centrifugation.

- Suspension de l’ADN plasmidique dans le tampon TE ou l'eau pure.

- Elimination des ARN par les RNases (hydrolyse sélective des ARN/ ADN reste intact).

Réponse 2 (Exercice 2)
a. Protocole de clonage
- Préparation de l'insert: Extraction d'ADN génomique de la bactérie. Digestion partielle
de cet ADN par l'enzyme de restriction Eco RI, de manière à générer des fragments de
5 à 10 kb. Electrophorèse préparative pour purifier sur gel les fragments de 5 à 10 kb.

6
- Préparation du vecteur: Digestion complète de pBR330 par Eco RI. Déphosphorylation
des extrémités.
- Clonage: ligature des inserts et des vecteurs. Transformation de cellules d'E. coli.
Recommencer les étapes précédentes jusqu'à avoir 10 e+6 colonies transformées
indépendantes.
- Sélection: sélection des colonies transformées sur milieu contenant de la
streptomycine. Pour estimer le taux de colonies qui ont reçu un plasmide contenant de
l'ADN génomique de la bactérie étudiée, repiquage d'environ 500 colonies sur milieu
contenant de l'ampicilline: seule les colonies qui ont reçu un plasmide ne contenant pas
d'ADN génomique de la bactérie étudiée poussent.
- Sélection des clones contenant le gène d’intérêt: transfert des 10 e+6 colonies sur filtre
et hybridation moléculaire avec une sonde appropriée (technique dite de 'hybridation sur
colonies')
b. Carte de restriction.
Une carte de restriction (= physique, à ne pas confondre avec une carte génétique) est
une représentatio ngraphique de la localisation des sites reconnus par les principales
enzymes de restriction sur une molécule d’ADN. A l'aide de la carte, il devient facile de
connaitre la taille des fragments d'ADN libérés par digestion par une ou plusieurs
enzymes.
Rappel:
Un polylinker est une courte séquence portant un grand nombre de site de restriction
uniques sur l'ensemble du plasmide et qui permettent d'insérer plus facilement un ADN
d'intérêt qu'on appelle insert. Le polylinker sert pour les manipulations de génie
génétique. Présentant un polylinker, Un plasmide ou un ADN de bactériophage devient
un vecteur de clonage dans lequel on peut insérer un ADN étranger.

Exemple de Plasmide artificiel de clonage pBluescript

7
On note trois grands domaines fonctionnels: l'origine qui permet la réplication du
plasmide, le gène 'ampicillin' qui code pour la résistance à l'antibiotique ampicilline et le
gène lacZ qui code pour la ß-galactosidase et permet la détection des cellules
transformées. Le site MCS (Multiple Cloning Site) ou polylinker, de courte séquence
mais portant un grand nombre de sites de restriction uniques sur l'ensemble du
plasmide, permet d'insérer facilement un ADN d'intérêt qu'on appelle insert.

Réponse 3 (Exercice 3). Carte de restriction d'un plasmide circulaire double brin.
EcoR I (2 coupures): 4,2 + 3,4 = 7,6

Pst I (3 coupures): 3,6 + 2,7 + 1,3 = 7,6

EcoR I + Pst I (5 coupures): 2,2 + 2,0 + 1,4 + 1,3 + 0,7 = 7,6

8
Réponse 4 (Exercice 4). Séquençage de l'ADN d'un gène.

Réponse 5 (Exercice 5). Séquençage d'un ADN monocaténaire

- Dans le séquençage par la méthode de Sanger, l'amorce (primer) fourni une extrémité
3' OH libre nécessaire pour l'action de la DNA polymérase.

- Le didésoxynucléotide provoque l'arrêt de l'élongation de l'ADN.

- Le but du traitement thermique est la dénaturation de l'ADN bicaténaire (Matrice +


ADN néoformé). Après chauffage, tous les fragments sont monocaténaires.

- Toutes les chaînes nucléotidiques liées à l'amorce sont radioactives (32P) et


visualisées par autoradiographie.

- La séquence de l'ADN à séquencer: 5'TCGAAGATGCACCTG3'

Automatisation du séquençage
Les fragments d'ADN résultant de la polymérisation sont marqués grâce à des
marqueurs fluorescents. La taille des fragments obtenus est déterminée par
une chromatographie au lieu de l'électrophorèse. Le séquenceur détecte la
florescence sortant des colonnes de chromatographie (4 colonnes), repérant les
fragments d'ADN et leurs tailles précises. Les systèmes les plus modernes permettent
même de lire les quatres nucléotides à partir d'une seule colonne de chromatographie.
Le résultat est présenté par la machine sous forme de courbes présentant la
fluorescence détectée (et l'équivalent en terme de nucléotides).

9
Le séquençage des gènes par la méthode de Sanger permet d'étudier la phylogénie
moléculaire des espèces.

Liens utiles -Nucléosides, Nucléotides. QCM


- Acides nucléiques. QCM (Fr, Ar)
- DNA electrophoresis on agarose gel
- Purification, analyse DNA du plasmide. Contôle TP 2015
- Clonage d'un gène

10
TD 3

Exercice 1
1) Identifier les bases présentes dans les structures
suivantes :

2) Parmi ces bases, lesquelles : a) contiennent du ribose.


b) contiennent du désoxyribose.
c) contiennent une purine.
d) contiennent une pyrimidine
e) contiennent de la guanine.
f) sont des nucléosides.
g) sont des nucléotides.
h) se trouvent dans l’ARN.
i) se trouvent dans l’ADN.

3) indiquer les extrémités 5’ et 3’ de la molécule A

11
Exercice 2
La séquence d’un ADN bicaténaire, correspondant à un gène, est partiellement reportée ci-dessous.
5’ ATACGGGATCCGAGCTCTCGATCGTCTGCAGAAATTCC 3’

1) Ecrire la séquence et l’orientation du second brin de ce fragment.

2) Donner le brin complémentaire d’ARN

3) Soient les enzymes de restriction BamH I, Pst I, Xho I et Mbo I dont les sites reconnus sont :
BamH I : 5' G/GATCC 3' ; Pst I : 5' CTGCA/G 3' ; Xho I : 5' C/TCGAG 3' ; Mbo I : 5'
/GATC 3'. Recopier la séquence de l’ADN et encadrer les sites de restriction en indiquant la
position des coupures.
5) Pour chaque enzyme, écrire les séquences des extrémités des molécules d’ADN
digérées et préciser le type d’extrémités obtenu.

6) On mélange ce brin d’ADN apparié avec son brin complémentaire à un autre


fragment d’ADN double brin. La solution est portée à une température supérieure à
leurs Tm respectives, puis refroidie. Que peut-on attendre?

8) Voici la séquence d’une amorce (ou primer) : 5’ - TTTCTGCA- 3’


Où cette amorce se fixera-t-elle sur la séquence d’ADN ? Quelle séquence obtiendra-t-on
après élongation par la DNA-polymérase ?

Exercice 3
L'ADN d’un plasmide de 48,6 kpb a été hydrolysé par l'enzyme de restriction Sal I.
Cet ADN est analysé par électrophorèse sur gel d’agarose (pistes 2 et 4). Un marqueur de
taille (l'ADN du phage lambda hydrolysé par l'enzyme de restriction Hind III ) est déposé
dans les puits
1 et 3. Ce marqueur de taille est un mélange équimolaire de fragments d’ADN de tailles
connues. La quantité d’ADN total déposé dans les puits 1 et 2 est le double de celle des
puits 3 et 4. Après coloration par le bromure d’ethidium**, l’image suivante est obtenue.

12
1) Tracer la courbe étalon : Log taille(pb) = f(distance de migration).

2) À partir de cette courbe, déduire la taille des fragments issus de la digestion par l'enzyme de
restriction Sal I de l'ADN du cosmide recombinant (pistes 2 et 4).

3) La somme des tailles des fragments obtenus vous semble-t-elle en accord avec la taille attendue de
48,6 kpb ?

4) Le bromure d’ethidium s'intercale entre les bases de l'ADN de manière uniforme sur une molécule
d'ADN linéaire. Étudiez attentivement la photo du profil de restriction, que remarquez vous? Qu’en
déduisez-vous ?

Exercice n° 4 : La séquence d’ADN ci-dessous vient de vous être fournie.

5’ATCGGTGATCTGCAGTCCCGATCGGGCACCCGGGTTAGCGATCGTTTAATGGGTCGGCCCGGGGATCCCGGGCC
TGGACTGA TCTGACATGGTGTCAGTCAGTTTCTC 3’

Q1 : Pouvez-vous fragmenter cette molécule avec les endonucléases de restrictions suivantes :

BamH1 (G/GATCC), HpaII (C/CGG), PvuI (CGAT/CG), Sau3A (/GATC), SmaI (CCC/GGG), XbaI (T/CTAGA) ?

13
Q2 : Placez les sites existants et schématisez les extrémités 5’ et 3’ après coupure pour chaque enzyme.

Q3 : Que deviennent ces extrémités lorsque les fragments obtenues après coupure sont incubés en présence de
l’ADN polymérase Klenow en présence de dNTPs ?

Q4 : Après cette modification, vous faites agir une ligase. Avez-vous régénéré l’ensemble des sites ?

Exercice n° 5 : Un plasmide circulaire possède un site de coupure par l’enzyme XhoI et deux sites de coupures pour
l’enzyme SmaI. Ces deux sites pour l’enzyme SmaI sont situés de part et d’autre du site XhoI, à égale distance de ce
site. Lorsque vous effectuez une électrophorèse sur gel d’agarose de l’ADN de ce plasmide digéré par l’enzyme XhoI
ou par SmaI en présence de bromure d’éthidium, on estime la taille des fragments obtenus à 3 kb ou à 1.5 kb
respectivement. Lorsque vous effectuez la double digestion XhoI et SmaI, la somme des fragments obtenus fait 2.25
kb. Tracer la carte de restriction de ce plasmide en positionnant les sites XhoI et SmaI.

Exercice n° 6 : Un fragment d’ADN HindIII-HindIII de 1kb est digéré par l’enzyme EcoRI en un fragment de 300 pb et
un fragment de 700 pb. Si le fragment de 300 pb est purifié et digéré par l’enzyme PstI, il donne deux fragments :
l’un de 100 pb et l’autre de 200 pb. Si le fragment de 700 pb est traité de la même façon, il produit deux fragments
: l’un de 500 pb et l’autre de 200 pb.
Lorsque le fragment HindIII-HindIII est digéré directement par l’enzyme Pst1 on obtient trois fragments : 100, 200
et 700 pb. Expliquez ces résultats à l’aide de schémas. Qu’obtiendrait-on en effectuant la double digestion EcoRI et
PstI sur le fragment de 1kb ?

Exercice n° 8 : Un chromosome linéaire de phage est marqué au 32P à ses deux extrémités et digéré par EcoRI. Une
électrophorèse sur gel d’agarose en présence de Bet permet de mettre en évidence des fragments de 2.9 – 4.5 – 6.2
–7.4 et 8 kb. Après Southern blot et autoradiographie, seuls les fragments de 6.2 et de 8 kb sont détectés. Avec
l’enzyme BamHI la taille des fragments obtenus est de 6.0 – 10.1 – 12.9 kb. Et, dans ce cas, le marquage est associé
aux fragments de 6,0 et 10.1 kb. La double digestion EcoRI et BamHI permet d’obtenir les fragments de 1.0 – 2.0 –
2.9 – 3.5 – 6.0 – 6.2 et 7.4 kb. Déterminer la carte de restriction de ce chromosome.

Exercice n° 9:

Parmi les séquences oligonucléotidiques suivantes lesquelles vous paraissent susceptibles d’hybrider avec le
fragment d’ADN ci apres.

Oligo 1 : 5’ CGGGCACCCGGGTTA 3’

Oligo 2 : 5’ CCCGGGGATCCCGGG 3’

Oligo 3 : 5’ GACTGATCTGACATG 3’

Oligo 4 : 5’ GAGAAACTGACTGAC 3’

14
5’ATCGGTGATCTGCAGTCCCGATCGGGCACCCGGGTTAGCGATCGTTTAATGGGTCGGCCCGGGGATCCCGGGCC
TGGACTGA TCTGACATGGTGTCAGTCAGTTTCTC 3’

Vous réalisez un séquençage de ce fragment d’ADN par la méthode de Sanger avec l’amorce oligonucléotidique
simple brin suivante : 5’ TCAGATCAGTCCAGG 3’.

Schématisez l’autogradiographie du gel de séquençage que vous devriez obtenir

Exercice 10 : Clonage et analyse de l'ADN recombinant


On souhaite étudier la fonctionnalité d’un gène M d’une bactérie. Pour cela, on essaie
de cloner au site Eco RI du vecteur plasmidique pBR330 (voir schéma) un fragment
Eco RI-Eco RI d'ADN génomique de la bactérie d’intérêt :

a- Proposez un protocole de clonage et indiquez comment vous sélectionnez les clones recombinants.

b- Un des plasmides recombinants contenant le gène M (appelé pBM1) est digéré par les enzymes de
restriction Bam HI et Eco RI. Après migration et séparation des fragments d'ADN sur gel d'agarose
puis coloration au bromure d'éthidium, on obtient les profils de restriction suivants:

15
Exercice 11 : Séquençage
Vous disposez d’un brin d’ADN à séquencer (matrice), d’une amorce, d’ADN polymérase, des quatre
2’désoxyribonucléotides (dXTP) et d’un jeu des différents 2’,3’-didésoxyribo-nucléotides (ddXTP).
L’amorce est radiomarquée par du phosphore radioactif 32P.
L’ADN matriciel à séquencer ACGTAATCGC---- comporte, à son extrémité 3’, une séquence
supplémentaire (représentée ici par un segment de droite en pointillé) sur laquelle l’amorce va
s’hybrider, créant ainsi le site d’initiation de l’ADN polymérase.

1 - Résumez brièvement le principe de la méthode en indiquant le rôle du didésoxyribonucléotide.

2- Compléter un tableau en indiquant la composition des différents milieux réactionnels et, pour
chaque milieu, le type et la taille des fragments néosynthétisés

3- Schématisez le résultat de la migration des produits obtenus pour chaque mélange


réactionnel.Utiliser une échelle un carreau pour une base.
4- Reporter, à droite, la séquence du brin synthétisé puis la séquence recherchée, en indiquant le
sens de lecture des séquences établies.

Exercice 12:

1- Retrouver l’ORF dans le fragment d’ADN suivant:

2- D’après le code génétique déterminez pour quelle protéine code cette ORF code :

16
A :mrlssfivvgaavvnlltsgsvvvaafprvsdvsamaiaphrmdqgatnggkrllrfksladiikhlddqdmkhvagilanmddihhkn
vlakalesgritqknyd daiaalqrtsk

B :myygggfivvgaavvnlltsgsvvvaafprvsdvsamaiaphrmdqgatnggkrllryhsnnnrggdediaeergifdfknlemltnl
arlnkandldsrlddffq alikakvnpsnihhtrldqddylelrqlfrtggaafyhras

C :mrlssfivvgaavvnlltsgsvvvaafprvsdvsamaiaphrmdqgatnggkrllryhsnnnrggdediaeergifdfknlemltnlarl
nkandldsrlddffqali kakvnpsnihhtrldqddylelrqlfrtwytfyhras

D :mrlssgyvgaavvnlltsgsvvvaafprvsdvsamaiaphrmdqgatnggkrllryhsnnnrggdediaeergifdfknlemltnlarl
nkandldsrlddffqali kakvnpsnihhtrldqddylelrpmggtwytfyhras

3- On rappelle que les introns sont bordés de séquences conservées correspondant à un


dinucléotide GU à l’extréminté 5’ et un dinucléotide AG a l’extrémité 3’. Retrouvez les introns
insérés dans la séquence codante de la protéine que vous venez d’identifier

17
18
19