Vous êtes sur la page 1sur 134

Guide Methodologique

ANALYSE ET RÉDUCTION DES CONSOMMATIONS D’EAU


DANS LES ÉTABLISSEMENTS TERTIAIRES
Table des matières

Résumé 9

Guide méthodologique 27
INTRODUCTION 28

I. CONTEXTE GIRONDIN D’ÉLABORATION DU GUIDE 29


I.1 Ressources en eau en Gironde 29
I.2 SAGE Nappes Profondes de Gironde 31

II. CONTENU DU GUIDE ET UTILISATION 33

III. COLLECTE DES DONNÉES 35


III.1 ,GHQWLÀHUHWGpOLPLWHUOHSpULPqWUHpWXGLp 35
III.2 ,GHQWLÀHUOHVUHVVRXUFHVHQHDX HQWUpHV 35
III.3 ,GHQWLÀHUOHVXVDJHV VRUWLHV 36
,,, /LVWHUOHVGLIIpUHQWVSRVWHVGHFRQVRPPDWLRQ 37
,,, 'pWHUPLQHUOHYROXPHG·HDXXWLOLVpSRXUFKDTXHXVDJHHW
  FDUDFWpULVHUOHVGLIIpUHQWVpTXLSHPHQWVHWOHXUDGpTXDWLRQDX[
  FRQWUDLQWHVG·XWLOLVDWLRQ 37
III.3.2.1 Rechercher des informations communes à tous les usages 37
III.3.2.2 Sanitaires du personnel ou du public 38
III.3.2.3 Nettoyage 38
III.3.2.3.1Nettoyage des surfaces à l’eau 38
III.3.2.3.2Nettoyage de véhicules ou de matériels 39
III.3.2.3.3Lavage du linge 39
III.3.2.4 Restauration 39
III.3.2.4.1Préparation des repas et vaisselle 39
III.3.2.4.2Chambres froides 39
III.3.2.4.3Chauffage 40
III.3.2.5 Piscines ouvertes au public 40
III.3.2.6 Bassins décoratifs 41
III.3.2.7 Climatisation 41
III.3.2.7.1Refroidissement par l’eau du réseau 42
III.3.2.7.2Refroidissement par l’eau issu d’un forage ou d’une ressource de
surface 42
III.3.2.7.3 Refroidissement par un circuit fermé 42
III.3.2.8 Arrosage 43
III.3.2.9 Sécurité incendie 44
III.3.2.10 Logements de fonction 44

IV. ANALYSE DES DONNÉES 45


IV.1 %LODQGHVGRQQpHVGLVSRQLEOHVHWGHVGRQQpHVPDQTXDQWHV 45
IV.2 1DWXUHGHVLQIRUPDWLRQVFRPSOpPHQWDLUHVjUHFKHUFKHU 46
IV.3 ,QYHVWLJDWLRQVRXPHVXUHVUpDOLVpHVVDQVLQYHVWLVVHPHQW 46
,9 (QWUHWLHQDYHFOHVJHVWLRQQDLUHVRXXWLOLVDWHXUVDXTXRWLGLHQ 46
,9 5HOHYpVGHFRPSWHXUVVXUGHVSpULRGHVSDUWLFXOLqUHV 46
,9 $QDO\VHGHODSURJUDPPDWLRQGHVV\VWqPHVG·DUURVDJH 47
,9 0HVXUHVSRQFWXHOOHVjO·DLGHG·DSSDUHLOVFRXUDQWV 47
IV.3.4.1 Seau et chronomètre 47
IV.3.4.2 Manomètre 47
IV.3.4.3 Débitmètre à lecture directe pour lavabo ou douche 47
,9 ,QYHVWLJDWLRQVRXPHVXUHVSOXVSRXVVpHVDYHFGHVLQYHVWLVVHPHQWV
  SOXVLPSRUWDQWV 47
IV.3.5.1 Pose de compteurs d’eau divisionnaires 47
IV.3.5.2 Mesure de débit ponctuelle 48
3
IV.3.5.2.1 Enregistrement sur une période donnée du débit sur un compteur
d’eau existant 48
IV.3.5.2.2 Débitmètre à ultrasons 48
IV.3.5.2.3 Comptage de la fréquentation 49
,9 'pÀQLWLRQGHODFDPSDJQHGHPHVXUHVDGDSWpH 49

V. EXPLOITATION DES DONNÉES 51


V.1 (ODERUDWLRQGXWDEOHDXHQWUpHVVRUWLHVGHVFRQVRPPDWLRQVG·HDX 51
V.2 9pULÀFDWLRQGHODFRKpUHQFHGXWDEOHDX 52
9 9pULÀFDWLRQGHO·DEVHQFHGHIXLWH 52
9 9pULÀFDWLRQGHODFRKpUHQFHGHVSpULRGHVGHUHOqYHV 52
9 5HFKHUFKHGHFRQVRPPDWLRQVDQQXHOOHVDQWpULHXUHV 
  FRPSOpPHQWDLUHV 52
9 &RPSDUDLVRQGHVVLWHVRXpWDEOLVVHPHQWVHQWUHHX[ 52
9 &RPSDUDLVRQjGHVUDWLRV 53
V.2.5.1 Déterminer les ratios pertinents par usage 53
V.2.5.2 Tableau de valeurs de ratios disponibles (voir annexe) 53
V.2.5.3 Cas particulier des consommations des bureaux 54
V.3 +LpUDUFKLVDWLRQGHVXVDJHV 55

VI. PROPOSITIONS DE SCÉNARIOS 56

VII. SOLUTIONS D’ÉCONOMIE 58


VII.1 (FRQRPLHVSDVVLYHV 58
9,, 5pGXFWLRQGHSUHVVLRQ 58
9,, $SSDUHLOVVDQLWDLUHV :&ODYDERVGRXFKHV 58
VII.1.2.1 Eviers/ Lavabos 61
VII.1.2.2 Chasses d’eau et urinoirs 63
VII.1.2.3 Douches 64
VII.1.2.4 Production et transport de l’eau chaude sanitaire 65
VII.1.2.4.1 Chaudière à (micro-)accumulation 65
VII.1.2.4.2 Calorifugeage des canalisations d’eau chaude 65
VII.1.2.4.3 Robinet thermostatiques et mitigeurs 65
VII.1.2.4.4 Economie d’énergie générées par les économies d’eau chaude
sanitaire 65
9,, 3LVFLQHVUHFHYDQWGXSXEOLF 67
VII.1.3.1 Réglementation 67
VII.1.3.1.1 Taux de renouvellement et qualité de l’eau des bassins 67
VII.1.3.1.2 Récupération de l’eau 68
VII.1.3.2 Moyens potentiels de réduire la consommation d’eau des piscines 68
VII.1.3.2.1 Piscines de grandes dimensions (piscine municipale ou parc de
loisirs privé) 68
VII.1.3.2.2 Piscines < 200 m2 (hôtel, camping, résidence, gîte, centre
sportif…) 70
9,, 5HVWDXUDWLRQ 70
9,, /DYDJHGXOLQJH 71
9,, 1HWWR\DJH 71
VII.1.6.1 Nettoyage des sols 72
VII.1.6.2 Nettoyage des chaussées ou parkings 72
VII.1.6.3 Nettoyage des véhicules ou matériels 72
9,, &OLPDWLVDWLRQ 73
VII.1.7.1 Climatisation à eau perdue 73
VII.1.7.2 Climatisation à refroidissement par tour de refroidissement 73
9,, $UURVDJH 73
VII.1.8.1 Espèces végétales peu consommatrices d’eau 73
VII.1.8.2 Conception nécessitant moins d’arrosage 74
VII.1.8.3 Limitation des pertes en eau 74
VII.1.8.4 Fréquence des arrosages adaptées aux plantes, au sol et à la
saison 74
VII.1.8.4.1 Programmation 74
VII.1.8.4.2 Gestion technique centralisée (GTC) 74
VII.1.8.4.3 Emetteurs d’eau adaptés 76
VII.1.8.5 Gestion différenciée des espaces verts 76

4
VII.2 (FRQRPLHVDFWLYHV 77
9,, &RPSWDJHVHWVXLYLGHVYROXPHVFRQVRPPpV 77
9,, 5HFKHUFKHGHIXLWHV 78
9,, ,QIRUPDWLRQHWVHQVLELOLVDWLRQGHVXWLOLVDWHXUVHWSHUVRQQHOV
  G·HQWUHWLHQ 80
9,, (QWUHWLHQGHVpTXLSHPHQWVPDLQWHQDQFH 81

VIII. SOLUTIONS DE SUBSTITUTION 83


VIII.1 4XDOLWpG·HDXUHTXLVHSDUXVDJH 83
9,,, 3ULQFLSHVJpQpUDX[²8VDJHVGRPHVWLTXHV 83
9,,, 5HPDUTXHFUpGLWG·LPS{WSRXUOHVORJHPHQWVSULYpV 83
9,,, 8VDJHVQRQGRPHVWLTXHV 84
VIII.2 ,GHQWLÀFDWLRQGHVVRXUFHVG·HDXGHVXEVWLWXWLRQGLVSRQLEOHV 85
9,,, (DX[GHIRUDJHVVXSHUÀFLHOV KRUVQDSSHVGX6$*( 85
VIII.2.1.1 Eléments règlementaires 85
VIII.2.1.2 Eléments techniques et économiques 85
9,,, (DX[GHVXUIDFH 86
VIII.2.2.1 Eléments règlementaires 86
VIII.2.2.2 Eléments techniques et économiques 87
9,,, (DXGHSOXLH 87
VIII.2.3.1 Eléments règlementaires 87
VIII.2.3.2 Eléments techniques et économiques généraux 87
VIII.2.3.3 Types de stockage 89

IX. ELABORATION DU PLAN D’ACTIONS 91


IX.1 +LpUDUFKLVDWLRQHWFRPSDUDWLIGHVVROXWLRQVG·pFRQRPLHV et de
VXEVWLWXWLRQ 91
,; %LODQV\QWKpWLTXHGHVGLIIpUHQWVVFpQDULRV 91
,; +LpUDUFKLVDWLRQGHVWUDYDX[ 93
,; 5DSSHOGHVDXWUHVDFWLRQVjSUpYRLU 94
IX.1.3.1 Suivi des consommations, évaluation des résultats 94
IX.1.3.2 Maintenance des équipements mis en place 94
IX.1.3.3 Sensibilisation, formation 94
IX.2 &KRL[GXSODQG·DFWLRQV 94
,; 3URJUDPPHG·DFWLRQVjEXGJHWUpGXLWSRXUFRQYDLQFUHG·DOOHU
  SOXVORLQ 95
,; 3URJUDPPHG·DFWLRQVUDSLGHPHQWUpDOLVDEOHVUHQWDELOLVpHVHQ
  PRLQVGHDQV DXSOXVDQV 95
,; 3URJUDPPHG·DFWLRQVDPELWLHX[ 96
,; &RQVXOWDWLRQGHVHQWUHSULVHV 96

X. CONCLUSION 97

Annexes du guide 99
XI. ANNEXES 100
;, )LFKHpWDSHLGHQWLÀFDWLRQGX RXGHV VLWH V pWXGLp V 100
;, )LFKHpWDSHLGHQWLÀFDWLRQGHVUHVVRXUFHVHQHDX 101
;, )LFKHpWDSHLGHQWLÀFDWLRQGHVXVDJHVRXSRVWHVGH 
consommation et caractérisation des équipements 102
XI.4 Outil d’aide : descriptif sommaire des principaux équipements
hydro économes 106
XI.5 Outil d’aide : principaux ratios de consommation d’eau 113
XI.6 Outil d’aide : tarif indicatif des principaux matériels
hydroéconomes 116
XI.7 Exemples 120
Exemple I : hôtel 120
Exemple II : camping 123
Exemple III : immeuble de bureaux 126
Exemple IV : clinique 128
XI.8 Bibliographie et sites Internet de référence 132
5
Sommaire des synoptiques méthodologiques

SYNOPTIQUE N°1 : Synthèse schématique de la méthode d’analyse et de réduction des


consommations d’eau 34
SYNOPTIQUE N°2 : Quels équipements hydro économes retenir pour l’optimisation des
consommations d’eau dans des sanitaires existants ?
60
SYNOPTIQUE N°3 : Comment procéder pour optimiser les consommations d’eau
d’arrosage ? 75
SYNOPTIQUE N°4 : Quelle ressource de substitution pour l’arrosage ? 21
SYNOPTIQUE N°5 : Quelle ressource de substitution pour les autres usages nécessitant
de l’eau toute l’année ? 21

Sommaire des tableaux

TABLEAU N°1 : Principaux postes de consommation sanitaire 38


TABLEAU N°2 : Principaux postes de consommation de restauration 39
TABLEAU N°3 : Principaux postes de consommation des piscines 40
TABLEAU N°4 : Appareils de mesures adaptés à la recherche de différentes
informations et à différents contextes 50
TABLEAU N°5 : Guide de choix pour l’amélioration ou le remplacement de la
robinetterie existante 62
TABLEAU N°6 : Guide de choix pour l’amélioration ou le remplacement des WC ou
urinoirs existants 64
TABLEAU N°7 : Guide de choix pour l’amélioration ou le remplacement des
douches existante 64
TABLEAU N°8 : Consommations d’eau et d’énergie moyenne d’un ménage 66
TABLEAU N°9 : Consommations d’eau et d’énergie moyenne d’un ménage après
équipement en matériel hydroéconome 66
TABLEAU N°10 : Bilan des économies d’énergie induites par les économies d’eau, et
en particulier d’eau chaude sanitaire 67
TABLEAU N°11 : Ratios de consommation d’eau 113

Sommaire des exemples

EXEMPLE N°1 : Sites tertiaires 35


EXEMPLE N°2 : Exemple de mauvaise évaluation des postes de consommation
d’eau 45
EXEMPLE N°3 : Tableau entrée / sorties pour un immeuble de bureaux employant
100 personnes 51
EXEMPLE N°4 : Consommations d’eau de plusieurs entreprises ou établissements
publics « de bureau » girondins 54
EXEMPLE N°5 : Coûts du chauffage de l’eau 65
EXEMPLE N°6 : Plantes à faibles besoins en eau 74
EXEMPLE N°7 : Villes ayant adopté une gestion différenciée de leur espaces verts 77
EXEMPLE N°8 : Implantations de compteurs divisionnaires 77
EXEMPLE N°9 : 5HOqYHPHQVXHOOHGHVFRPSWHXUVGHÁXLGH 78
EXEMPLE N°10 : Volumes de fuite 79
EXEMPLE N°11 : Fuite 79
6
EXEMPLE N°12 : Baisse rapide des performances hydroéconomes faute de
maintenance 81
EXEMPLE N°13 : Risque de focalisation sur un type d’action pour l’établissement
d’un programme d’économie d’eau 91
EXEMPLE N°14 : Calculs de temps de retour sur investissement pour quelques
équipements, en fonction de leur fréquence d’utilisation 92
EXEMPLE N°15 : Comparatif des différents scénarios de l’étude de cas de
l’aéroport de Bordeaux-Mérignac 93

Sommaire des illustrations

ILLUSTRATION N°1 : Schéma de circulation des eaux souterraines en Gironde 29


ILLUSTRATION N°2 : Les différents types de nappe 29
ILLUSTRATION N°3 : Les vitesses d’écoulement de l’eau dans la nature 29
ILLUSTRATION N°4 : Coupe schématique d’une nappe captive et d’un forage 30
ILLUSTRATION N°5 : Principaux usages de l’eau des nappes profondes de Gironde 31
ILLUSTRATION N°6 : Principaux usages de l’eau potable en Gironde
(Millions de m3, données 2004) 31
ILLUSTRATION N°7 : Principe de réduction des prélèvement d’eau dans les nappes
profondes adopté par le SAGE nappes profondes de Gironde 32
ILLUSTRATION N°8 : Schéma de principe de fonctionnement de la CLE 32
ILLUSTRATION N°9 : Manomètre à lecture directe (Source Sider) 47
ILLUSTRATION N°10 : Débitmètre à lecture directe (Source : Sider) 47
ILLUSTRATION N°11 : Compteurs eau (Source Sider) 48
ILLUSTRATION N°12 : Têtes émettrices (Source Sappel) 48
ILLUSTRATION N°13 : Sonde positionnée sur une canalisation (Source CREAQ) 49
ILLUSTRATION N°14 : Débitmètre à ultrason DigiSonic (Source CREAQ) 49
ILLUSTRATION N°15 : Sonde à insertion (source Hydreka) 49
ILLUSTRATION N°16 : Cellule photoélectrique (Source : CREAQ) 49
ILLUSTRATION N°17 : 3KRWR5pÁHFWHXU 6RXUFH&5($4 49
ILLUSTRATION N°18 : Répartition moyenne des consommations d’eau par poste dans un
ménage (étude sur le Pays Cœur Entre Deux Mers) 66
ILLUSTRATION N°19 : Lave verres (Source : http://www.alicomenda.fr/) 71
ILLUSTRATION N°20 : Laveuse à avancement (Source : http://www.alicomenda.fr/) 71
ILLUSTRATION N°21 : Lave plateaux (Source : http://www.alicomenda.fr/) 71
ILLUSTRATION N°22 : Autolaveuse (Source : www.agroprocess.net) 72
ILLUSTRATION N°23 : Autolaveuse (Source :www.fastandclean.biz) 72
ILLUSTRATION N°24 : Enrouleur (Source : Les bonnes pratiques de l’arrosage des
espaces verts et des terrains de sport) 76
ILLUSTRATION N°25 : Tuyère (Source : Les bonnes pratiques de l’arrosage des espaces
verts et des terrains de sport) 76
ILLUSTRATION N°26 : Microjet (Source : Les bonnes pratiques de l’arrosage des espaces
verts et des terrains de sport) 76
ILLUSTRATION N°27 : Goutte à goutte (Source : Les bonnes pratiques de l’arrosage
des espaces verts et des terrains de sport) 76
ILLUSTRATION N°28 : Baisse des consommation d’eau dans les immeubles collectifs
liées à la mise ne place de compteurs individuels 77
ILLUSTRATION N°29 : Etat des unités de gestion du SAGE nappes profondes de Gironde 86
ILLUSTRATION N°30 : Cuve PEHD enterrée (Source GRAF) 89
ILLUSTRATION N°31 : Cuves béton (source www.idéesmaison.com et Kipopluie) 90
ILLUSTRATION N°32 : Cuves acier (source Kipopluie) 90
ILLUSTRATION N°33 : Bâche souple de stockage d’eau (source Kipopluie) 90
ILLUSTRATION N°34 : 0XUYpJpWDOLVpDYHFVWRFNDJHG·HDX VRXUFH3KRQLÁHXU 90
7
Résumé du guide méthodologique
ANALYSE ET RÉDUCTION DES CONSOMMATIONS D’EAU
DANS LES ÉTABLISSEMENTS TERTIAIRES
Introduction

6DYLH]YRXVTX·HQ*LURQGHO·HDXGXURELQHW réduction des consommations d’eau dans les


SURYLHQW j  GHV QDSSHV VRXWHUUDLQHV établissements tertiaires ».
SURIRQGHV HW TX·HOOH D  DQV" 3RXU Ce guide est destiné aux maîtres d’ouvrages,
SUpVHUYHU FHWWH SUpFLHXVH UHVVRXUFH gestionnaires de patrimoines privés ou publics,
DFWXHOOHPHQWWURSVROOLFLWpHOH6$*( 6FKpPD et à leurs conseillers techniques. Il concerne les
G·DPpQDJHPHQWHWGHJHVWLRQGHVHDX[ QDSSHV établissements tertiaires (par opposition aux
SURIRQGHVGH*LURQGH D pWp DGRSWpÀQ  activités agricoles et industrielles, qui ne sont
6XUODEDVHG·pWXGHVK\GURJpRORJLTXHVLOÀ[H pas concernées si ce n’est pour leurs services
XQREMHFWLIQpFHVVDLUHSRXUODSUpVHUYDWLRQGHV administratifs). Il propose une méthode pour
QDSSHV SURIRQGHV  UpGXLUH OHV SUpOqYHPHQWV analyser les consommations d’eau puis mettre
GH  PLOOLRQV GH P3 G·LFL  VXU OHV  en œuvre les travaux d’optimisation ou de
PLOOLRQV GH P3 DFWXHOOHPHQW SUpOHYpV (W LO substitution de ressource les mieux adaptés à
SURSRVH XQH QRXYHOOH VWUDWpJLH SOXV GXUDEOH chaque contexte. Les recommandations pour
HQIDLVDQWGHVpFRQRPLHVG·HDXXQHSULRULWp réaliser des économies d’eau sont valables quel
SXLVTX·HOOHV GRLYHQW UHSUpVHQWHU XQ YROXPH que soit le contexte d’analyse ; en revanche,
G·DX PRLQV  PLOOLRQV GH P3 SDU DQ VRLW OD les substitutions de l’eau potable par une autre
PRLWLpDXPRLQVGHO·REMHFWLI ressource sont envisagées dans un contexte plus
VSpFLÀTXHPHQWJLURQGLQ
(WYRXVYRXVVHQWH]YRXVFRQFHUQpSDUFHGpÀ"
On pense souvent que les grands établissements &H JXLGH WHFKQLTXH HVW GHQVH HW GpWDLOOH
industriels ou publics le sont au premier chef, YRORQWDLUHPHQW HQ KXLW pWDSHV OD PpWKRGH
car nous estimons, à tort, qu’ils consomment GH GLDJQRVWLF HW OHV SRVVLELOLWpV G·pFRQRPLH
la plus grande partie de l’eau potable. En G·HDXSRXUFKDTXHSRVWHGHFRQVRPPDWLRQ,O
réalité, ils représentent, chacun, à peine 10% VHYHXWDXVVLGLUHFWHPHQWRSpUDWLRQQHO&·HVW
des prélèvements pour la production d’eau SRXUTXRLLOFRPSRUWHXQUpVXPpFRQoXSRXU
potable (120 millions de m3 par an). Ce sont rWUHOXHQWRWDOLWpHWGHVSDUDJUDSKHVGpWDLOOpV
les consommations d’eau sanitaire, à travers XVDJH SDU XVDJH DX[TXHOV YRXV SRXYH] YRXV
les habitants et la multitude d’établissements UHSRUWHUVLQpFHVVDLUHSRXUSOXVGHSUpFLVLRQV
tertiaires, qui représentent globalement les plus 3RXUDOOHUSOXVORLQGDQVXQSUHPLHUWHPSVOH
importantes consommations (80 millions de m3 FKDSLWUH©pODERUDWLRQGXSODQG·DFWLRQVªDLQVL
par an). TXH OHV H[HPSOHV HQ DQQH[H VRQW YLYHPHQW
UHFRPPDQGpV
A titre d’illustration, le diagnostic des
consommations d’eau de l’aéroport de Bordeaux- Ce document a été réalisé par le CREAQ (Centre
Mérignac, qui a servi de base à l’élaboration du régional d’éco-énergétique d’Aquitaine), avec
présent guide : auriez-vous imaginé que plus l’appui et pour le compte du SMEGREG (Syndicat
de la moitié du volume d’eau consommé, soit mixte d’études pour la gestion de la ressource
plus de 20 000 m3/an, disparaissait dans les en eau de la Gironde), en collaboration avec un
lavabos et WC, en majorité ceux des employés ? groupe de travail associant :
De même, 30 à 50% des volumes consommés - l’Agence de l’Eau Adour-Garonne,
dans les supermarchés sont utilisés dans les - le Conseil Régional d’Aquitaine,
sanitaires. Ces constats sont surprenants. - le Conseil Général de la Gironde,
D’autant plus quand on sait qu’il existe des - la DDASS (Direction départementale des
dispositifs hydroéconomes adaptables, faciles actions sanitaires et sociales) de la Gironde,
à installer sur les sanitaires, qui permettent - la DDAF (Direction départementale de
de réduire d’au moins 30% les consommations l’Agriculture et de la forêt) de la Gironde.
d’eau sanitaire et qui sont rentabilisés en moins
d’un an. Pour les consommations d’eau dans les
pWDEOLVVHPHQWV SXEOLFV OHV pFRQRPHV GH ÁX[
En matière de consommation et d’économie pourront aussi utilement se référer au « guide
d’eau, un certain nombre d’idées reçues des mesures d’économie et de maîtrise des
existent. Elles peuvent laisser penser que la usages de l’eau dans les collectivités », réalisé
VLWXDWLRQ DFWXHOOH HVW QRUPDOH GLIÀFLOHPHQW par le CREAQ en parallèle pour le compte du
améliorable, ou pire, orienter les décisions vers Conseil Général de la Gironde.
GHVWUDYDX[SHXHIÀFDFHV&·HVWGDQVFHFDGUH
et pour vous aider à faire les bons choix, qu’a
été réalisé le présent « guide d’analyse et de

10
SYNTHÈSE SCHÉMATIQUE DE LA MÉTHODE D’ANALYSE ET
DE RÉDUCTION DES CONSOMMATIONS D’EAU

Lien
c o m p t e u r s
ETAPE 1. Recueil des données disponibles sans investigation physiques / factures ou
Collecte des données

de terrain (plans, relevés des compteurs, factures,…), déclarations


Bilan de l’évolution des
ETAPE 2. Identification sur site des entrées (ressources en eau) consommations (ou volumes
et sorties en eau (usages ou postes de consommation), prélevés) sur au moins 3 ans.
Comparaison entre sites ou usages
identiques et ciblage des valeurs
ETAPE 3. Bilan sur site des équipements en place¬ élevées ou croissantes sans
- caractéristiques techniques et fréquence/mode
d’utilisation, pour évaluer leurs consommations d’eau, justification
- contraintes éventuelles d’utilisation,
- et bilan des qualités d’eau nécessaires.
Analyse des données

ETAPE 4. Evaluation du volume d’eau consommé pour 4bis. Si évaluation


chaque usage (sanitaires, arrosage, nettoyage, des volumes associés à
restauration,…), tableau entrées/sorties et ciblage des chaque usage impossible,
postes gros consommateurs
détermination des compléments
de données nécessaires, et
enquête complémentaire OU
ETAPE 5. Validation des informations recueillies et
DFTXLVHVSDUGHVGRQQpHV©¬pSURXYpHV¬ª FRPSDUDLVRQHQWUH campagne de mesures (relevés du
différents sites, à des ratios ou valeurs de référence, compteur soir/matin ou lors
volumes estimés par deux méthodes différentes,….) d’activités spécifiques,...)

ETAPE 6. Détermination du potentiel et des techniques


Propositions de scénarios

- d’économie d’eau, pour tous les usages,


- de substitution de l’eau potable par une autre
ressource, pour les usages d’arrosage et de nettoyage.
Appréciation de l’adéquation des équipements aux besoins
des utilisateurs (fréquence et contraintes d’utilisation,….).

ETAPE 7. Comparatif technico–économique des


DPpOLRUDWLRQVHQYLVDJHDEOHV¬HWhiérarchisation des actions
VHORQOHXU
- efficacité (volume économisé/volume total, coût du m3
économisé ou temps de retour sur investissement),
- exemplarité vis-à-vis des usagers ou visibilité,
facilité de mise en œuvre ou délai de réalisation.

ETAPE 8. Choix du plan d’actions, qui associe


- un suivi (minimum mensuel) des compteurs, avec
détection de fuites, pour un gain de 10 à 20% la 1ère
année, et 5% en routine;
Plans d'actions

- des équipements adaptables, rapidement (< 1 an)


rentabilisés (matériels hydroéconomes sur les sanitaires,
programmation d’arrosage, …), pour un gain minimum Penser à se donner les moyens
GH¬ de mesurer les résultats
- des travaux plus onéreux mais efficaces (volume (compteur, dédié si nécessaire, et
pFRQRPLVpVLJQLILFDWLIHWUHQWDELOLWpDQV ¬FRPSWDJHV
divisionnaires, temporisation des robinets les plus relevés mensuels, à prévoir avant
utilisés (> 15fois/j), remplacement des annuelles par les travaux d’amélioration)
des vivaces et des asperseurs par des gouttes à gouttes,
GTC, substitution de ressource, recyclage…, permettant
jPR\HQWHUPHG·REWHQLUXQJDLQMXVTX·j¬
PDLQWHQDQFHSRXUSpUHQQLVHUOHVpFRQRPLHV¬
- programme de sensibilisation pour augmenter le gain à
long terme (de l’ordre de 20% supplémentaires) et
donner l’exemple.

11
ETAPE 1, 2 et 3 : La collecte des données

Réduire ses consommations d’eau nécessite de - SpULPqWUHV DOLPHQWpV SDU OHV GLIIpUHQWHV
savoir d’abord à quoi sert l’eau. 2QUHFKHUFKHUD UHVVRXUFHVRXFRPSWHXUV,
GRQF OHV LQIRUPDWLRQV HVVHQWLHOOHV OLVWpHV - SKRWRJUDSKLHV GHV pTXLSHPHQWV OHV SOXV
FLDSUqV, permettant de décrire les différents VLJQLÀFDWLIV, ou souvent observés mais
SRVWHVGHFRQVRPPDWLRQG·HDX,QÀQHO·REMHFWLI GLIÀFLOHV j GpFULUH GRXFKHV SRXU O·pYHQWXHO
est de pouvoir : équipement hydroéconome à adapter,
HVWLPHUGHIDoRQÀDEOHO·RUGUHGHJUDQGHXU programmateur d’arrosage, compteur pour
du volume d’eau consommé par grands types une éventuelle tête émettrice, …).
d’usages, en distinguant ceux qui nécessitent
de l’eau potable et les autres (arrosage,
nettoyage) ; IV. ANALYSE DES CONSOMMATIONS D’EAU DES 3
- disposer d’un descriptif succinct des DERNIÈRES ANNÉES AU MINIMUM, 5 IDÉALEMENT
équipements existants (robinets, système
d’arrosage…) et de leurs contraintes et - j IDLUH VpSDUpPHQW SRXU FKDTXH
fréquences d’utilisation permettant de UHVVRXUFH HQ HDX (chaque compteur),
proposer, si nécessaire, de nouveaux et le cas échéant en distinguant les volumes
équipements adaptés et économes en eau. eau potable et eau+assainissement,
voir les compteurs intermédiaires non
Il est conseillé d’analyser les consommations associés à une facturation,
d’eau (évolution et comparaison à d’autres sites - FRPPHQWDLUH HQ FDV GH YDULDWLRQ
ou ratios) avant la phase d’enquête sur site, qui SHUPHWWDQW GH O·H[SOLTXHU (variation du
n’en sera que plus pertinente. nombre d’employés, de la fréquentation, du
chiffre d’affaires, de la production, travaux,
problème…),
I. DESCRIPTIF DU SITE : - si les données le permettent (ou
en recherchant) FRPSDUDLVRQ GHV
- QRPGXVLWH et s’il est différent, nom de FRQVRPPDWLRQV G¶HDX VXU G·DXWUHV VLWHV
facturation ou de redevance, VLPLODLUHVGHPrPHFDSDFLWp (ou en faisant
- ORFDOLVDWLRQ (coordonnées, plan du site), une règle de trois à partir d’une grandeur
- SHUVRQQHUHQFRQWUpH (référent, personne caractéristique),
ressource). - DSSUpFLDWLRQ GH O·RUGUH GH JUDQGHXU
« dans la moyenne » ou « anormal » des
consommations d’eau du(des) site(s)
II. RESSOURCE EN EAU : étudié(s), usage par usage ; le cas échéant
étude prioritaire, voire recherche de fuite
- HDXSRWDEOH : numéro et calibre du compteur, immédiate sur les « anormaux ».
adresse du branchement, type de facturation
(eau potable seule ou eau assainie) et prix
du m3, V. LISTE DES DIFFÉRENTS USAGE(S) DE L’EAU ET
- IRUDJHRX VRXUFH : nom, localisation, DISTINCTION DES QUALITÉS D’EAU REQUISES
N°BSS (type 08035X0567/F), profondeur,
nappe concernée, volume autorisé (ou débit - sanitaires (WC, douche, lavabo)
nominal si l’ouvrage n’est pas déclaré, et - restauration (préparation des repas,
Qmin et Qmax pour une source), estimation vaisselle, chambres froides)
du prix de l’eau (redevance + énergie eau
- laverie (linge, stérilisation …) potable
+ traitement éventuel ; en général 0,05 à - climatisation,
0,3 !/m3), exigée
- piscine,
- HDXGHSOXLH : toiture associée (nature du - logement de fonction,
revêtement et surface), volume de stockage,
SUpVHQFHG·XQÀOWUHGpELWGHODSRPSH - arrosage (sur site ou ailleurs, via le
remplissage de camions citernes)
- nettoyage (sols, sanitaires, autre
III. CROQUIS SCHÉMATIQUE : matériels, véhicules, voiries, ….), ressource
- fontaine décorative, possible
- ORFDOLVDWLRQ GX GHV  FRPSWHXU V , par - autres usages : services techniques
rapport aux bâtiments et voiries (avec N° de (ateliers déchèterie, désherbage,
rue), et en cas de site complexe, croquis des hydro curage, incendie, borne à eau à
canalisations de liaison entre bâtiments, usage divers, …).
12
VI. POUR CHAQUE USAGE, DESCRIPTIF DES ÉQUIPEMENTS 1HWWR\DJH
EXISTANTS ET DE LEURS FRÉQUENCES ET CONTRAINTES - pas de précision pour le nettoyage des sols
D’UTILISATION et sanitaires « à la main » : poste en général
peu consommateur,
6DQLWDLUHV - pour les matériels et camions :
- :& : réservoir classique (avec simple ou ‡QDWXUHVHWQRPEUHV
double commande ou interrompable) ou ‡ HW DXWDQW TXH SRVVLEOH YROXPH XQLWDLUH
suspendu ou bâti support ou pneumatique ; ou par lavage et fréquence de lavage pour les
chasse temporisée (classique ou à détection voiries et parkings,
infrarouge). ‡ YROXPH G·HDX XWLOLVp SRXU UHPSOLU XQH
- ODYDER: eau froide seule ou eau chaude et balayeuse x fréquence de remplissage
froide (et dans ce cas mélangeur ou mitigeur), par jour x nombre de balayeuses x jours
à commande temporisée ou non, présence ou d’activité /an,
non de bague dévissable au bout du bec du ‡ DWWHQWLRQ DX[ QHWWR\DJHV SRQFWXHOV
robinet. au jet, très consommateurs (noter leurs
- GRXFKH GRXFKHWWH HW ÁH[LEOH RX durées et le débit du jet).
douche murale, mélangeur ou mitigeur,
thermostatique ou non, à commande &OLPDWLVDWLRQ
temporisée ou non pour chaque bloc sanitaire : - YROXPHG·DSSRUWV aux circuits fermés,
accessible au personnel et/ou au public, et - FOLPDWLVDWLRQ: systèmes à air, à eau, ou
appréciation de sa fréquence d’utilisation : hybride (apport ponctuel souvent important),
intensive (> 15 fois/j), moyenne ou apports d’eau (rechercher les relevés du
faible (< 3 fois/j). compteur, obligatoire), volume climatisé.

5HVWDXUDWLRQ 3LVFLQHV
- QRPEUHGHUHSDV préparés par jour ou par - QRPEUHPR\HQGHEDLJQHXUVSDUMRXU, en
an, pris sur place ou livrés x jours d’activité, distinguant les bassins d’été et les bassins
- YDLVVHOOH : manuelle ou lave-vaisselle ouverts toute l’année,
(consommation d’eau par cycle ou âge du - YROXPH GHV EDVVLQV, précision du
lave-vaisselle), et fréquence d’utilisation par désinfectant et du stabilisant éventuel,
jour x nombre de jours d’activité par an, - WDX[ GH UHQRXYHOOHPHQW GH O·HDX des
- FKDPEUHVIURLGHV : volume, température de bassins (l/baigneur et m3/j),
fonctionnement, contrôle de cette dernière - QRPEUHGHYLGDQJHVDQQXHOOHV,
et technologies utilisées pour les groupes - GHVFULSWLI GHV VDQLWDLUHV HW GRXFKHV (voir
froids. la rubrique concernée).

$UURVDJH HIIHFWXp j O·HDX SRWDEOH RX )RQWDLQHVGpFRUDWLYHV


j SDUWLU G·XQH QDSSH GX 6$*( HQ FDV GH - FLUFXLWRXYHUWRXUHF\FODJH,
UHVVRXUFHDOWHUQDWLYHFHVSUpFLVLRQVQHVRQW - GpELWQRPLQDOHWSpULRGHGHIRQFWLRQQHPHQW
SDVQpFHVVDLUHV : par jour et dans l’année.
- VXUIDFHDUURVpH approximative,
- QDWXUHGHVSODQWDWLRQVDUURVpHV : pelouse, 6HUYLFHVWHFKQLTXHVDWHOLHUV
PDVVLIV GH ÁHXUV RX DUEXVWHV DYHF XQH - préciser autant que possible OHVXVDJHVHW
répartition en % de la surface arrosée totale OHXUIUpTXHQFH pour pouvoir leur associer un
établie visuellement, volume d’eau,
- SpULRGH G·DUURVDJH : nombre de jours, de - distinguer OHVSRVWHVRXQGpELWLPSRUWDQW
mois dans l’année, HVWQpFHVVDLUH.
- V\VWqPHG·DUURVDJH :
- aspersion, goutte à goutte, camions /RJHPHQWVGHIRQFWLRQ
citernes…, - préciser OHXU QRPEUH HW DSSUpFLHU OH
- débit ou volume nominal (l/m2 ou m3/h QRPEUHG·RFFXSDQWV, l’âge des équipements
ou l/min), sanitaires.
- réglage/fréquence : présence d’un
programmateur, ou fréquence et
GXUpH À[HV GDQV OHV  FDV SUpFLVHU VII. SYNTHÈSE DES CARACTÉRISTIQUES TECHNIQUES À
la programmation. Présence d’un NOTER
pluviomètre, d’un tensiomètre associés.
- Pour chaque grand ensemble de bâtiments,
/DYHULHVWpULOLVDWLRQ PHVXUH GH OD SUHVVLRQ (à l’aide d’un
- FRQVRPPDWLRQ G·HDX par cycle ou âge du manomètre à lecture directe sur un robinet
lave-linge ou du stérilisateur, ou par analyse du débit sur un robinet),
- IUpTXHQFHG·XWLOLVDWLRQSDUMRXU x nombre
de jours d’activité par an. - au niveau des différents points de puisage
de type robinet ou douche, PHVXUH GX
GpELW (à l’aide d’un débitmètre à lecture
13
instantanée ou en chronométrant le temps de d’un gros débit, de pression, de
remplissage d’un récipient de volume connu). remplissage de grands récipients, utilité
Pour les sites très importants où des mesures d’une commande au genou, robinet
V\VWpPDWLTXHVVRQWGLIÀFLOHPHQWUpDOLVDEOHV fréquemment retrouvé ouvert…) et
PHVXUHU DX PRLQV OHV GpELWV XQLWDLUHV GHV fréquences d’utilisation (faible soit
pTXLSHPHQWV OHV SOXV IUpTXHQWV (pour un moins de 3 fois par jour, moyenne, ou
lavabo, en fonction de la pression et du intensive soit plus de 15 fois par jour)
type de robinet, le débit peut varier de 12 à et apprécier l’adéquation du matériel
20 l/min), y compris ceux qui sont censés à son usage. Un minimum d’échanges
être déjà hydroéconomes, est conseillé dans tous les cas de façon
- pour les points de puisage d’arrosage ou à prendre en compte ces éléments
de nettoyage, OHV GpELWV WKpRULTXHV GHV pour le choix des éventuels nouveaux
pTXLSHPHQWV SHXYHQW rWUH XWLOLVpV HQ OHV équipements (pour éviter plaintes et
FRPSOpWDQW SDU GHV WHVWV GH FRKpUHQFH démontage), et éviter d’équiper des
VLPSOHV (type chronométrage du temps de points de puisage de l’eau inutilisés.
remplissage d’un seau), ‡ O H V  p Y H Q W X H O V  S U R E O q P H V  G H
fonctionnement et de qualité d’eau
- HQWUHWLHQ DYHF OHV XWLOLVDWHXUV SRXU (douches écossaises, retours d’eau,
FRQQDvWUH stagnation,…) : ils devront être résolus
‡OHVFRQWUDLQWHV (nécessité ponctuelle avant d’envisager un équipement
hydroéconome.

ETAPE 4 et 5 : Analyse des données

'pWHUPLQHU GH IDoRQ ÀDEOH OH YROXPH DVVRFLp 1% $QQH[H Qƒ  SULQFLSDX[ UDWLRV GH
à chaque usage est fondamental pour pouvoir FRVRPPDWLRQG·HDX
proposer un plan d’action pertinent. ZZZMHFRQRPLVHOHDXRUJ IRXUQLW pJDOHPHQW
Cela nécessite parfois des aller-retours GHV GRQQpHV PR\HQQHV QRQ RSWLPLVpHVGH
méthodologiques vers la phase de recueil de GRVHV G·DUURVDJH SDU VXUIDFH HW W\SH GH
données, en la complétant par une éventuelle SODQWHV
campagne de mesures.
- H Q  H [ S O L F L W D Q W  O H V  P p W K R G H V
G·pYDOXDWLRQ, même si elles sont basées
I. EVALUATION ET VALIDATION DES VOLUMES CONSOMMÉS en partie sur des hypothèses (qui seront
précisées) ou des appréciations des
PAR LES DIFFÉRENTS USAGES
personnes rencontrées sur le site. Cela
permettra si nécessaire de reprendre
6\QWKqVH GHV pOpPHQWV UHFXHLOOLV HW O·DQDO\VHXOWpULHXUHPHQWRXGHPRGLÀHUXQ
GpWHUPLQDWLRQ GHV YROXPHV G·HDX DVVRFLpV seul élément de calcul parmi d’autres ;
DX[GLIIpUHQWVXVDJHV - H Q  G L V W L Q J X D Q W  D X  P L Q L P X P  
- j SDUWLU GHV FRPSWHXUV HQ SODFH FDWpJRULHV : les sanitaires, l’arrosage (et
(compteurs divisionnaires) pour chaque le nettoyage), et les autres usages.
usage. Il s’agit du cas idéal où les
consommations en eau sont facilement 9pULÀFDWLRQTXHOHWRWDOREWHQXFRUUHVSRQG
TXDQWLÀDEOHV DXYROXPHHIIHFWLYHPHQWFRQVRPPp
- VXUODEDVHGHGRQQpHVUpHOOHV (nombre Souvent en additionnant les différentes
d’employés et appréciation de la fréquence consommations d’eau par poste, on obtient
d’utilisation des sanitaires, temps de beaucoup plus que le total réel.
fonctionnement de système d’arrosage et
débit théorique…) ;
- HQ XWLOLVDQW OH PRLQV SRVVLEOH GHV
UDWLRV, qui peuvent donner l’illusion
II. SI NÉCESSAIRE, ENQUÊTES COMPLÉMENTAIRES, OU

G·XQHVLWXDWLRQQRUPDOHHWQHSDVUHÁpWHU CAMPAGNE DE MESURES


la réalité (un poste de consommation
surestimé peut masquer une fuite ou la 6·LO Q·HVW SDV SRVVLEOH G·pWDEOLU OH ELODQ
consommation d’eau importante d’un SUpFpGHQW RX TX·LO SDUDvW SHX ÀDEOH
équipement inadapté). Dans l’absolu, LO IDXW DORUV FKHUFKHU j SUpFLVHU XQ
pour réaliser une bonne analyse, les ratios PLQLPXP G·LQIRUPDWLRQV FRPSOpPHQWDLUHV
ne devraient servir à déterminer que le j UHFKHUFKHU HW XQ PLQLPXP
volume consommé d’un seul usage parmi G·LQYHVWLVVHPHQWV RX GH WHPSV j SDVVHU 
tous les autres ; SRXUpWDEOLUXQELODQÀDEOH
14
/HV SULQFLSDX[ FRPSOpPHQWV G·LQIRUPDWLRQ
SHXYHQWrWUHREWHQXVSDU
-SRVHGHFRPSWHXUVGLYLVLRQQDLUHV : il est
judicieux de prévoir dès maintenant les
FRPSWHXUVTXLSHUPHWWURQWGHFODULÀHUGHV
consommations d’eau en phase d’analyse,
et ensuite de mesurer les économies d’eau
obtenues après travaux.

- UHOHYpGHVFRPSWHXUV :
‡ VRLU HW PDWLQ SRXU HQFDGUHU XQH
période sans activité et lever un doute
sur une fuite potentielle. En cas de
débit positif, renouveler l’opération
SRXUFRQÀUPHUOHGpELWGHIXLWH
‡ j  G H V  S p U L R G H V  G · D F W L Y L W p V
particulières, et en temps normal pour
préciser les consommations de ces
SRVWHVVSpFLÀTXHV
‡ VHORQ OH WHPSV GLVSRQLEOH HW OD
variabilité de l’activité, relève tous
les jours pendant une semaine, ou
toutes les semaines pendant 2 mois ou
tous les mois, en notant une grandeur
caractéristique associée (nombre de
personnes, production….). Au-delà de
l’analyse de la situation, cela permettra
de disposer d’une base de comparaison
avant/après.

- PHVXUHV SRQFWXHOOHV GH GpELWV (24h


minimum, 10 jours conseillés) HWRX GH
SUHVVLRQ (au minimum à 2 périodes dans
la journée ou de l’année : forte activité et
très faible activité) sur des canalisations
intermédiaires, pour :
‡LVROHUGHVSRVWHVGHFRQVRPPDWLRQRX
des (parties de) bâtiments,
‡LVROHUSDUWUDQFKHKRUDLUHOHVGLIIpUHQWV
XVDJHVHWDLQVLOHVTXDQWLÀHU
‡ FRQILUPHU RX LQILUPHU XQH IXLWH
(certains bâtiments présentent des
consommations à toutes heures et
VRQW GLIÀFLOHV j pWXGLHU PDLV DYHF XQ
enregistrement sur un pas de temps
WUqV ÀQ  PLQXWH  ORJLTXHPHQW RQ
doit observer des débits nuls),

1% 3RXU PHVXUHU GHV GpELWV HWRX SUHVVLRQV


HQ SOXVLHXUV SRLQWV G·XQ UpVHDX RX G·XQ VLWH
DOLPHQWp j SDUWLU G·XQH PrPH UHVVRXUFH
FRPSWHXU  LO HVW UHFRPPDQGp GH UpDOLVHU
OHV PHVXUHV VXU XQH PrPH SpULRGH DYHF
SOXVLHXUV DSSDUHLOV TXL SHXYHQW rWUH ORXpV 
SOXW{W TX·DYHF XQ XQLTXH DSSDUHLO TXL VHUDLW
GpSODFp

- PHVXUHGHODIUpTXHQWDWLRQ à l’aide d’une


cellule de comptage ou d’interview des
utilisateurs ou du personnel d’entretien.

15
ETAPE 6 et 7 : Propositions de scénarios

Le risque dans un programme d’action est de II. ECONOMIES PASSIVES


se focaliser trop rapidement sur un poste de
consommation et/ou un seul type d’action Dans tous les cas, si nécessaire (P> 4 bars), SRVH
pour réduire les volumes d’eau consommés ou G·XQUpGXFWHXUGHSUHVVLRQ :
les substituer par une autre ressource en eau.
,O HVW LPSRUWDQW G·pWXGLHU OHV DPpOLRUDWLRQV - GqV TXH OD SUHVVLRQ HVW VXSpULHXUH j 
HQYLVDJHDEOHV SRXU OHV GLIIpUHQWV SRVWHV GH EDUV OD OLPLWHU j  RX  EDUV (un robinet
FRQVRPPDWLRQG·HDXHWHQSDUWLFXOLHUOHVSOXV standard fournit 12 litres/minutes à 3 bars
JURV FRQVRPPDWHXUV ; et ensuite d’envisager mais 17 litres/minutes à 6 bars),
une substitution, avec si possible plusieurs - attention aux usages nécessitant une
ressources de substitution (forage dans une pression importante (nettoyage, incendie …),
nappe hors SAGE, source, eau de puie …). et aux immeubles de grande hauteur ; dans
FHFDVLQVWDOOHUGHVUpGXFWHXUVVXUOHVVHXOV
/·DXWUH SRLQW IRQGDPHQWDO HVW O·pWDSH EkWLPHQWVVDQVFRQWUDLQWH, ou une limitation
GH FRPSDUDLVRQ WHFKQLTXH PDLV VXUWRXW par étage.
pFRQRPLTXHGHVGLIIpUHQWVVFpQDULRV - l’économie est fonction de la pression
initiale. Les fuites sont aussi limitées.
(QÀQ RXWUH OHV WUDYDX[ TXL JpQqUHQW GHV
économies d’eau passives ou permettent
d’utiliser une autre ressource en eau, LO QH III. AMÉLIORATIONS ENVISAGEABLES USAGE PAR USAGE
IDXW SDV RXEOLHU OD UpGXFWLRQ GH SUHVVLRQ
DLQVLTXHOHFRPSWDJHHWOHVXLYLFDUOHVIXLWHV
UHSUpVHQWHQW XQH JUDQGH SDUW GHV JDVSLOODJHV 3RXU OHV VDQLWDLUHV SRVWH VRXYHQW VRXV
pYLWDEOHV. 'H PrPH XQH VHQVLELOLVDWLRQ GHV pYDOXp UHSUpVHQWDQW IUpTXHPPHQW  j
XVDJHUVJpQpUDQWGHVpFRQRPLHVDFWLYHV,HWXQ GHODFRQVRPPDWLRQWRWDOH :
SURJUDPPHGHPDLQWHQDQFHGHVpTXLSHPHQWV
TXLSpUHQQLVHOHVUpVXOWDWVVRQWjSUpYRLU Les aménagements proposés sont graduels, des
SOXVVLPSOHV PDLVDXVVLOHVSOXVHIÀFDFHV DX[
plus complets (situation idéale).
I. PRÉALABLE DANS TOUS LES CAS (ÉCONOMIES
ACTIVES) - LQVWDOODWLRQ V\VWpPDWLTXH G·DpUDWHXUV
GRXFKHV pFRQRPHV HW VDFV RX SODTXHWWHV
6XLYL GHV FRQVRPPDWLRQV TXDQWLÀFDWLRQ :&. On retient que ce poste «équipement
ORFDOLVDWLRQGHVIXLWHVpYHQWXHOOHV sanitaire hydroéconome simple » permet
d’économiser entre 10 à 30% du volume
- SRVH GH FRPSWHXUV GLYLVLRQQDLUHV (et de annuel de l’usage sanitaire, et est rentabilisé
robinets ou de vannes de sectionnement en moins d’un an, souvent même en moins
associés pour pouvoir isoler des portions de de 6 mois (en intégrant les économies
réseaux en cas de fuite) : d’énergie liées aux économies d’eau chaude
‡ GqV TXHO·DPSOHXU GX VLWH OH MXVWLÀH sanitaire),
(plusieurs bâtiments, surface importante, - WUDYDX[ GH SORPEHULH (pose de robinets
linéaire de canalisations internes important, temporisés sur lavabos, douches ou WC…)
volume consommé important,…), et que uniquement si la fréquence d’utilisation
la répartition des volumes par usage a (> 15 fois par jour environ) et/ou les défauts
pWp GLIÀFLOH OD UHFKHUFKH G·XQH IXLWH de fermeture des robinets (ils restent
ultérieure le serait aussi), RXYHUWV OHMXVWLÀHQW
‡ VXU OD EDVH GHV UpVXOWDWV GH OD YLOOH GH On retient que ce poste « amélioration
Mérignac, ce poste « compteur et suivi » des équipements de plomberie » permet
permet d’économiser environ 5% du d’économiser 5 à 30% du volume annuel (gain
volume annuel en routine, et souvent 10 à d’autant plus important que la fréquence
20% au départ. d’utilisation est importante).
L’économie d’eau s’ajoute ou pas à la
- VXLYL DX PLQLPXP PHQVXHO GH WRXV OHV précédente (certains robinets temporisés
FRPSWHXUV : proposer la mise en place d’une fournissent aussi un débit limité) ; elle est
procédure de suivi, et si nécessaire une radio rentabilisée en moins de 3 ans.
ou télé relève. *OREDOHPHQW RQ UHWLHQW TXH SRXU OHV
VDQLWDLUHV LO IDXW LPSpUDWLYHPHQW UpDOLVHU
OHVDPpQDJHPHQWVSUpFpGHQWV FRPSWHXUV
 DPpQDJHPHQWV VLPSOHV  UHPSODFHPHQW
16
QUELS ÉQUIPEMENTS HYDROÉCONOMES CHOISIR POUR OPTIMISER
LA CONSOMMATION D’EAU DES SANITAIRES EXISTANTS ?

$&! &

  &!  


 &  ' !(  '+(
 "!
 ##"$!%"##  5#
%"( #  
 "##"  #"!#$!
'!#$! "$!
!#%"##$ #!"" "$!3"#""#
'""$ $##" )$!""$! 0/$!#- "$
" $" 
  &

"$!"#$
"#
  %%  

 &!   ' !(  '+(


 & '+&! 
  
#"#$"$""'  5#'3'
! &!&!  
$&,&&!# +   $"##$3  #"!#$!
 +!  $"1#" "$!3"#""#
%"(  !$!"&$!"" 4#! #

!#"#!"'"& !'$!" "*
"!#"""$#"'"
 1+& 
$" ,"2
#$!"3"!" "$#'#
!'$#$!!"" #,&
"")2$#$%
##"' $#"

 !     ' !(  '+(


&! ! !  !'3###  $    5#'3'
)-+&!!  +   "##$3
!$*! &  !'3#
$& $"1$4 #"!#$!"$!
!""1#! 3"#""#1.

%"(  $!" "
#1$!"&$$#'&  1
,& ,"
"'1$!"
$$ "$#'##
#!"'" ,& ,"")2$#$%
##"' $#"

17
SORPEHULHjXVDJHLQWHQVLI OHVpFRQRPLHV 3RXUOHVORJHPHQWVGHIRQFWLRQ
G·HDX VRQW LPSRUWDQWHV GH  j  
j  HQ PR\HQQH SRXU O·HQVHPEOH GHV - ils sont souvent non visitables. Proposer un
WUDYDX[ HWYLWHUHQWDELOLVpHV compteur divisionnaire s’il n’existe pas et des
- 5HPSODFHPHQW GH WRXV OHV pTXLSHPHQWV systèmes hydroéconomes nécessitant peu de
SHX DGDSWpV VXU OHV DXWUHV SRVWHV WUDYDX[ GRXFKHWWHpFRQRPHHWVRQÁH[LEOH
j IUpTXHQFH G·XWLOLVDWLRQ IDLEOH RX renforcé, sac WC, et 2 aérateurs pour l’évier
PR\HQQH SDU GX PDWpULHO LGpDO (robinets et le lavabo).
temporisés, mitigeur double butée (évier)
ou thermostatique (douche), chasse WC 3RXUOHVSLVFLQHV
temporisée…) pour optimiser complètement
le poste sanitaire. Le gain supplémentaire - mise en place de matériels hydroéconomes
est d’au plus 20%, pour des investissements (pomme de douche avec limiteur de débit
élevés (rentabilisés en plus de 5 ans). La intégré anti-vol, associée à un robinet
généralisation des équipements de conception temporisé ; sacs WC ou mieux WC temporisés,
hydroéconome est en revanche recommandée aérateurs sur lavabo, avec si possible robinets
pour les installations neuves où le surcoût temporisés),
est très faible par rapport à des installations - piscines > 200 m2 : étude globale, éventuel
classiques. changement de désinfectant (l’eau de javel
associée à un stabilisant génère souvent des
ATTENTION ! consommations plus faibles que le chlore
si nécessaire, prévoir en complément la mise stabilisé). Dans les petits bassins uniquement,
en conformité des équipements qui présentent si le taux de chloramines est élevé,
initialement des problèmes de fonctionnement installation d’un déchloraminateur (voir aussi
(douches écossaises, retours d’eau,…) via par la ventilation). Et surtout récupération de
exemple une meilleure gestion des pressions, l’eau de renouvellement et de vidange pour
des clapets anti-retour ou disconnecteurs, un l’arrosage ou le nettoyage extérieur,
mode de chauffage de l’eau plus adapté,… - piscines < 200 m2 ou très utilisée (camping…) :
pWXGH JOREDOH VL TXDQWLWp VXIÀVDQWH
3RXUODUHVWDXUDWLRQ récupération de l’eau de vidange et de
renouvellement (HDX GH UHQRXYHOOHPHQW
- peu de gain possible pour la préparation des  HDX GH ODYDJH GHV ÀOWUHV  HDX XVpH j
repas, UHMHWHU LPSpUDWLYHPHQW j O·pJRXW), pour
- pour le lavage des mains, robinet économe arrosage ou, après dérogation préfectorale,
à commande au genou ou au pied, chasses WC.
- conserver la possibilité d’avoir un débit
important sur au moins un point de puisage 3RXUOHVIRQWDLQHVGpFRUDWLYHV
eaux chaude et froide. Les robinets à
manette clic-clac ou à double butée - abandon des circuits ouverts.
peuvent être un bon compromis (robinets
fonctionnant habituellement à un faible 3RXU OH QHWWR\DJH SHUoX FRPPH JURV
débit, et débrayables, pour obtenir un débit FRQVRPPDWHXU PDLV VRXYHQW GpMj
ponctuellement plus important), RSWLPLVp :
- s’il est amorti ou proche de l’être, ou paraît
ancien, remplacement du lave-vaisselle - pour les sols et sanitaires, limiter le nombre
par un modèle récent et économe en eau de points de puisage au minimum nécessaire
(consommation divisée par 2), voire mise en (ils risquent de rester ouverts),
place d’un lave-ustensiles économe pour les - pour les camions, le matériel et la voirie :
nombreux plateaux et ustensiles ou d’une rechercher une ressource alternative à
armoire de stérilisation pour les couteaux. l’eau potable, proposer des systèmes bas
débit et haute pression (en conservant un
3RXUOHVVHUYLFHVWHFKQLTXHV GpELW VXIÀVDQW SRXU JDUDQWLU O·HIÀFDFLWp GX
nettoyage : une baisse de 30% de débit, pas
au cas par cas. plus, est souvent adaptée).

3RXUODODYHULH 3RXUO·DUURVDJH

- s’il est amorti ou proche de l’être, ou Les aménagements proposés sont graduels, des
paraît ancien, remplacement du lave-linge SOXVVLPSOHV PDLVHIÀFDFHV DX[SOXVFRPSOH[HV
par un modèle récent et économe en eau (qui nécessitent une évolution des pratiques et
(consommation divisée par 2), de nouveaux aménagements et demandent du
- si le volume de linge est important, opter temps). Dans tous les cas on cherchera à optimiser
pour des machines à plus grandes capacités, les volumes consommés avant d’envisager une
proportionnellement moins consommatrices. substitution de la ressource :

18
QUELS ÉQUIPEMENTS ÉCONOMES EN EAU POUR L’ARROSAGE ?

"$! $

   $!  !  % !&  %(&



 
$  
!   5  


$   


                          !   
     &1
0' . 
#
   
  
      !
"""
  ##  

!  ! $   % !&  %(&


!      5 "   
!

$ '  !  


! !   "  
(     !      +!  
% 
 ., *
(  )
 "  "          "    ) 
" 4 3

!  ! $   % !&  %(&


*!   !        5""
)!       
$ 

 2  " 
           !    
    /- 
  " " 
  "
   "  
& 2 
"2'
 ,-!*

19
- mise en place (ou ajustement du 3RXUOHQHWWR\DJH
fonctionnement) d’un programmateur, en
fonction des saisons, du sol et des besoins - une substitution de la ressource est plus
(différents pour un stade d’honneur et un rapidement rentabilisée pour cet usage, qui
VWDGHG·HQWUDvQHPHQWRXGHVPDVVLIVGHÁHXUV a lieu toute l’année, que pour l’arrosage.
et une pelouse), de la pluviométrie (arrosage Elle est économiquement intéressante autant
coupé en cas de pluie) et de la réserve utile pour la récupération d’eau de pluie (si le
en eau du sol (tensiomètre). nombre de gouttières à ramener au niveau
Bien souvent, des doses d’arrosage plus faibles de la cuve n’est pas trop important) que pour
VXIÀVHQW IDLUH GHV WHVWV  HW IDYRULVHQW SDU un forage hors nappe du SAGE.
ailleurs un meilleur enracinement,
- choix de végétation et d’aménagement plus 3RXUO·DUURVDJH
économe en eau :
‡ SRXU OHV JD]RQV PpODQJH GH IpWXTXH - envisager la mise en œuvre d’une
élevée, de pâturin des près et de ray grass ressource alternative (forage dans une nappe
(terrain de sport) ou prairie naturelle VXSHUÀFLHOOHRXVRXUFHHDXGHSOXLH« GDQV
(agrément) à la place de ray grass seul ; l’ordre d’un intérêt économique décroissant
‡SRXUO·HPEHOOLVVHPHQWSODQWHVYLYDFHV des ressources énumérées précédemment
DUEXVWHV ÁHXULV RX j IHXLOODJH FRORUp (plus le stockage est important plus le temps
et décorations minérales plutôt que de retour sur investissement est long) ;
PDVVLIV GH ÁHXUV HW SODQWHV DQQXHOOHV« - pour des besoins importants (stade), un
‡SDLOODJHPXOFKWRQWHKDXWHSODQWDWLRQ stockage réduit (une journée de besoin) est
de haie (limite le dessèchement) et à prévoir si la productivité de la nappe ou le
dissociation des secteurs d’arrosage (doses débit de la source est faible.
sur arbustes < doses sur massifs) …,
 PRGLÀFDWLRQ GX V\VWqPH G·DUURVDJH OHV
plantes vivaces ou arbustes peuvent en outre V. ECONOMIES ACTIVES
être arrosées par goutte à goutte (limite
l’évaporation) et non plus par aspersion, 5DSSHO VXLYL DX PLQLPXP PHQVXHO GHV
- gestion centralisée de l’arrosage : pour FRQVRPPDWLRQV G·HDX HW WUDQVPLVVLRQ GH
des sites importants ou multiples, système O·LQIRUPDWLRQDX[XVDJHUV
radio ou pilotage informatique centralisé et
rapidement ajustable de l’arrosage (on peut )RUPDWLRQ HW VHQVLELOLVDWLRQ GX SHUVRQQHO
faire des tests et réajuster les doses en cas G·HQWUHWLHQHWGHVXVDJHUV
de besoin : marges de « sécurité » sur les
doses réduites), Les actions suivantes génèrent à plus long terme
- gestion différenciée des espaces verts. GHVpFRQRPLHVDFWLYHVVLJQLÀFDWLYHV GHO·RUGUH
de 20% au moins) ; elles doivent faire partie d’un
1%SRXUSOXVG·LQIRUPDWLRQVVXUOHVpFRQRPLHV programme de maîtrise des consommations :
G·HDXGDQVO·DUURVDJHYRLUOHJXLGHGHVERQQHV - favoriser la déclaration des fuites visibles
SUDWLTXHV GH O·DUURVDJH GHV HVSDFHV YHUWV HW DIÀFKDJH GH OD SHUVRQQH HW GX QXPpUR GH
GHVWHUUDLQVGHVSRUWVWpOpFKDUJHDEOHVXUZZZ téléphone à joindre) et leur réparation rapide
MHFRQRPLVHOHDXRUJ effective ;
- sensibiliser à une consommation
SDUFLPRQLHXVH ,QWUDQHW DIÀFKHV ERLWH j
IV. SUBSTITUTION DE RESSOURCE, ENVISAGÉE USAGE idée, démonstration de matériel, conférences
PAR USAGE avec des collègues ayant mis en œuvre la
démarche, sensibilisation rapide intégrée
3RXUOHVFKDVVHVG·HDXGHV:& systématiquement aux formations et
formations dédiées, …) ;
- l’utilisation de l’eau de pluie dans DIÀFKHUOHVERQVUpVXOWDWVREWHQXV
les chasses d’eau des WC est soumise à VLSRVVLEOHUpSHUFXWHUOHJDLQÀQDQFLHUVXU
dérogation préfectorale. Dans les projets le service qui l’a effectué.
neufs, si les points de puisage sont concentrés
dans l’espace et peu éloignés de la cuve de 0DLQWHQDQFHGHVpTXLSHPHQWV
stockage, l’opération, est souvent rentabilisée
en 3 à 5 ans ; Elle est fondamentale pour pérenniser les gains
- l’utilisation d’une source est une piste obtenus. Il faut s’assurer que de nouvelles
potentielle également, elle peut nécessiter fuites n’apparaissent pas, remplacer le matériel
un stockage (si le débit de la source est trop pFRQRPH HQ ÀQ GH YLH j O·LGHQWLTXH HW QRQ
faible); pas par du matériel standard), et prévoir une
HQÀQODUpDOLVDWLRQG·XQIRUDJH QDSSHKRUV maintenance préventive (remplacer les joints,
SAGE) n’est économiquement envisageable régler les temporisations, …).
que pour les besoins très importants
(> 1000m3/an donc rarement pour les WC).
20
1 - QUELLE RESSOURCE DE SUBSTITUTION POUR L’ARROSAGE ?

Les différentes Aide a la décision


ressources

Eau de surface Critères techniques!: Critères financiers!:


ORDRE DE RECHERCHE DÉCROISSANTE

'4& .(( ,.'  5.'4 ,''





 . . ,.   .4'

 
    
.  . ,
-
.4'
1(
.  4)
 ,.   ( &
. +)
4
 ,. ( ,4 
. . ,.4,.
  
 4.' 4
&

. '. 
 ,.  ,.
%#" /,,

Forage peu profond / 1  Critères techniques!: Critères financiers!:


,'"$
 
133 19  ;3. 13
311-  .   3:,+ 1   - 1,
+ 1, 1 - .3+ 1,
+:3 13 +
+ 1 3 0 1  
 11  1
 ,3   3
3  3 1 + 1 13131:
.
 13  
:
 13 3 ,3 
 13  13
:3, :
+
3   4191
,3 1
/4, .:
.

Récupération eau de pluie Critères techniques!: Critères financiers!:


-
31:   ;3. 13
(79
3 , 31
-3 3
 2
:. 1

3 3 3 3+ 131 +


5.1,  ,. 33 9
 139: 3 : 1,+ 1 .  
(&%
1.!9
1

Evitez la brumisation (aspersion, haute pression…) avec de l’eau autre que l’eau potable
Mesurez les volumes substitués

2 - QUELLE RESSOURCE DE SUBSTITUTION POUR LES AUTRES USAGES NECESSITANT DE L’EAU TOUTE L’ANNÉE ?
EXTERNES (NETTOYAGE DE VÉHICULES OU DE MATÉRIELS),
OU INTERNES (CHASSES D’EAU DES WC - SOUMIS À DÉROGATION PRÉFECTORALE)

Récupération eau de pluie Critères techniques!: Critères financiers!:


 -
3  133 4.
'3 33):, 3 (&% 4191
RECHERCHE

  39
 .  /*#
-- 13 (&% 419
 1 +83 131-
       (&% 5
1.
1  1   +83 13
1 1

Eau de surface Critères techniques!: Critères financiers!:


 3 3  3 ,3 

 - +
3 0.-- 13  13  13
 
   (&% 4191


Forage peu profond /  1  Critères techniques!: Critères financiers!:


,'"$  3 33 0.  (&%
1.!9
: 3 1 + 1 -   3
,: .  1 + *# 9

13 1 +
:/ 
9133 4
21
VI. REMARQUE : INFORMATION LORS DE LA MISE EN ‡DSSUpFLDWLRQGHO·HIÀFDFLWpJOREDOHGHV
ŒUVRE DU MATÉRIEL HYDRO ÉCONOME QRXYHDX[pTXLSHPHQWV, du gain en m3 et
en !, du fait de l’économie d’eau voire
- 3RXU OHV XVDJHV GRPHVWLTXHV, installer d’énergie pour l’eau chaude
des équipements hydroéconomes sur une ‡ FR€W GX P3 pFRQRPLVp ou temps de
zone test, en informant peu le personnel et retour sur investissement.
les usagers (des cas de plainte pour mauvais
fonctionnement sur des équipements non 5HPDUTXH
PRGLÀpV RQW pWp IUpTXHPPHQW QRWpV  $WWHQWLRQSRXUOHFRPSDUDWLI
Quand des économies sont avérées, les
TXDQWLÀHUHWOHVIDLUHVDYRLUSXLVJpQpUDOLVHU DX[GLIIpUHQWVSUL[GHO·HDXSRVVLEOH
les équipements en impliquant alors les ‡HDXSRWDEOHVHXOH
usagers et le personnel dans la démarche, ‡HDXSRWDEOHHWDVVDLQLVVHPHQW
voire le choix du matériel ; ‡ HDX GH IRUDJH FR€W  UHGHYDQFH
prélèvement + énergie + éventuel
- SRXU O·DUURVDJH, les retours d’expérience traitement)
montrent au contraire qu’il est nécessaire
d’associer en amont le personnel - aux économies d’énergie, à intégrer via les
d’entretien, voire de le former. Il faut surtout économies d’eau chaude sanitaire.
positiver la démarche (penser aux aspects
pFRQRPLH ÀQDQFLqUH RX REOLJDWLRQ OpJDOH
ou projet d’équipe, au-delà de l’aspect
environnemental) et éviter de blâmer les
anciennes pratiques (et les plus anciens).
Quant aux usagers, ils doivent impérativement
être largement informés en cas d’utilisation
d’une ressource de substitution (pour éviter
l’effet négatif de ce qui pourrait sinon être
perçu comme un gaspillage).

VII. SYNTHÈSE ET COMPARATIF DES SCÉNARIOS

Pour pouvoir retenir les actions les plus


pertinentes, il est fondamental de pouvoir les
comparer entre elles. Pour cela, il est préconisé
d’établir :

 XQ ELODQ SRXU FKDTXH pTXLSHPHQW


SURSRVp :
‡GHVFULSWLIVRPPDLUH,
‡FR€WXQLWDLUH (voir bordereau de prix en
annexe), nombre, coût total en distinguant
le matériel, et la pose, et pour cette
dernière en précisant le temps de pose, et
si elle est réalisable par un employé non
spécialisé,
‡ H I I L F D F L W p ( % d ’ é c o n o m i e s u r
l’équipement).

XQHV\QWKqVHTXLSHUPHWWUDGHFRPSDUHU
(et hiérarchiser) OHV GLIIpUHQWHV DFWLRQV
SRVVLEOHV (économies et substitutions), pour
chaque usage et entre usages (sanitaires,
restauration, arrosage, nettoyage, ...). Elle
mentionnera les points suivants :
‡ GHVFULSWLI JOREDO, et le cas échéant
contraintes de mise en oeuvre,
‡FR€WWRWDO (investissement (fourniture et
pose) et fonctionnement),
‡YROXPHG·HDX associé à l’usage,

22
ORDRE DANS LEQUEL ENVISAGER LES PRINCIPAUX SCÉNARIOS DE RÉDUCTION
DES CONSOMMATIONS D’EAU ET POINTS INCONTOURNABLES

Réduction de pression
si P> 4 bars

Equipement hydro économe des


sanitaires

Economies passives : avec du


matériel, adaptable sur l’existant
ou en remplacement impact en
majorité à très court terme Optimisation des équipements
voire à moyen terme d’arrosage

Nouvelles conceptions
d’espaces verts
Diagnostic initial

Recyclage ou réutilisation des


eaux de refroidissement ou de
piscine

Scénarios d’économie d’eau,


d’optimisation des usages et et Suivi des compteurs (existants et
éventuellement si l'usage le permet. nouveaux divisionnaires) : limite
les fuites et informe

Economies actives : sensibilisation


des usagers, nouvelles pratiques
impact à court terme
Scénarios de substitution de l’eau et à plus long terme
Sensibilisation des usagers :
potable ou des nappes profondes
économies supplémentaires
par une autre ressource
induites par nouveaux
comportements

ou Maintenance des équipements :


pérennise les économies

Nappe superficielle Eau de pluie


(hors SAGE), source,
lac, rivière…
Toute l’année
Filtre Usages externes
(nettoyage, arrosage
de serre …)

ou
Eventuelle autorisation
règlementaire de
prélèvement E v e n t u e l Saisonniers
traitement (arrosage extérieur…)

Dérogation préfectorale Filtre Usages internes


pour utilisation (type chasse d’eau)

Légende :
Temps de retour sur investissement court, très efficace en
volume : priorité
Temps de retour sur investissement raisonnable : recommandé
Temps de retour sur investissement très long : déconseillé
Aspects sanitaires priment sur aspects environnementaux et
économiques : voir la DDASS
23
ETAPE 8 : Plan d’action

3RXU UHOHYHU OH GpÀ JLURQGLQ GH SUpVHUYDWLRQ GDQVXQSUHPLHUWHPSVGpPRQWUHUO·HIÀFDFLWpGH


GHV QDSSHV SURIRQGHV LO HVW QpFHVVDLUH la démarche :
G·rWUHHIÀFDFHUpDOLVHUGHVpFRQRPLHVG·HDX
LPSRUWDQWHV  PLOOLRQV GH P3 DX PRLQV  j - VXLYLGHVFRPSWHXUVUHFKHUFKHIXLWH (gain :
FRXUW WHUPH G·LFL   3DU DLOOHXUV OHV 10 à 20% la 1ère année, 5% en routine),
pFRQRPLHV G·HDX FRQVWLWXHQW XQH GHV UDUHV - pTXLSHPHQWK\GURpFRQRPHGHVVDQLWDLUHV
DFWLRQVHQPDWLqUHGHGpYHORSSHPHQWGXUDEOH (et économie d’énergie via l’économie d’eau
TXL SHXW rWUH DVVRFLpH j GHV pFRQRPLHV chaude sanitaire) : en général, plus de 20%
ÀQDQFLqUHV d’économie sur la consommation,
- UpGXFWLRQGHSUHVVLRQ si P > 4 bars,
Par conséquent, sur la base du comparatif - SURJUDPPDWLRQ H[LVWDQW RX j SUpYRLU 
précédent, il est recommandé de retenir un DX SOXV MXVWH GH V\VWqPH G·DUURVDJH en
plan d’action fondé d’abord sur un suivi des association avec un pluviomètre ou un
consommations, du petit matériel adaptable, et tensiomètre,
des gestes simples. Un bon programme associe les - UpHQVHPHQFHPHQW GH SHORXVH avec un
économies passives immédiates et les économies mélange fétuque élevée/pâturin des près/
passives à plus long terme suivantes : ray grass (plutôt que ray grass seul).

- OHVpTXLSHPHQWVOHVSOXVHIÀFDFHVDYHFXQ
FR€WGXP3pFRQRPLVpIDLEOHRXXQWHPSV (QÀQGHVVXEVWLWXWLRQVGHUHVVRXUFHVRQWjSUpYRLU
GHUHWRXUVXULQYHVWLVVHPHQW 75, LQIpULHXU ensuite, pour les usages qui le permettent.
jDQV,OIDXWDJLUHQSULRULWpVXUOHVVLWHV Retenez que pour l’arrosage, il faut rechercher
RX XVDJHV OHV SOXV FRQVRPPDWHXUV DYHF HQSULRULWpXQHQDSSHVXSHUÀFLHOOHKRUV6$*(XQ
XQHDFWLRQV\VWpPDWLTXHVXUOHVVDQLWDLUHV. étang ou une source. La récupération d’eau de
Les scénarios rentabilisés à long terme (au pluie n’est pas recommandée ; elle est rarement
plus 15 ans) sont abandonnés. rentabilisée en moins de 15 ans. En revanche, elle
3DUPL OHV DFWLRQV j HIÀFDFLWp LQWHUPpGLDLUH est intéressante pour du nettoyage de véhicules
les critères de choix sont la visibilité (ou ou de matériels (usage toute l’année).
plutôt le potentiel de communication voire
d’imitation par les usagers chez eux), le
confort d’utilisation, la facilité de mise en
œuvre et la durabilité ;

- XQ SURJUDPPH GH VHQVLELOLVDWLRQ GHV


XVDJHUV XQH YDORULVDWLRQ GHV UpVXOWDWV
SRXU DXJPHQWHU OH JDLQ j ORQJ WHUPH
(20% supplémentaires liés aux économies
actives) ;

- XQH PDLQWHQDQFH GHV pTXLSHPHQWV


K\GURpFRQRPHV (réglages des temporisations
et programmations, remplacement des joints
HWjO·LGHQWLTXHHQÀQGHYLH« IRQGDPHQWDOH
pour pérenniser les résultats obtenus ;

- XQH SURFpGXUH GH VXLYL (mensuel au


moins) des compteurs (d’abonnement et
divisionnaires) pour évaluer les résultats et
limiter les fuites. Il est souhaitable de la lancer
avant d’engager des actions d’amélioration
pour disposer d’un bilan initial.

A titre d’illustration, les actions suivantes sont


HIÀFDFHVjFRXSVXUUHQWDELOLVpHVHQPRLQVG·XQ
an et facilement mises en œuvre ; elles peuvent

24
Conclusion

En matière d’économies d’eau, établir un 6XUODEDVHGHVVFpQDULRVGHFRQVRPPDWLRQV


programme d’actions pertinent nécessite RSWLPLVpHV GHV pYHQWXHOOHV VXEVWLWXWLRQV
d’pWXGLHUOHVGLIIpUHQWVSRVWHVGHFRQVRPPDWLRQ GHUHVVRXUFHjO·HDXSRWDEOHSHXYHQWDORUV
G·HDX (sanitaires, restauration, nettoyage, rWUH HQYLVDJpHV OH FR€W GH OD VXEVWLWXWLRQ
arrosage, refroidissement ….), sans focaliser a Q·HQ VHUD TXH PRLQGUH  SRXU OHV XVDJHV
priori sur un usage, fût-il (apparemment) le plus TXL OH SHUPHWWHQW DUURVDJH QHWWR\DJH GH
consommateur. YpKLFXOHVRXGHPDWpULHOO·XWLOLVDWLRQG·HDX
Il est également recommandé d’pWXGLHU QRQSRWDEOHGDQVOHVFKDVVHVG·HDXGHV:&
O·HQVHPEOH GX SDWULPRLQH. Cela permet QpFHVVLWHXQHGpURJDWLRQSUpIHFWRUDOH 
des comparaisons en phase d’analyse, puis
des économies d’échelle en phase travaux ,O HVW HQVXLWH LQGLVSHQVDEOH G·pWDEOLU XQ
(commandes groupées moins onéreuses, et FRPSDUDWLI GHV GLIIpUHQWV VFpQDULRV VXU
regroupement d’usages pour les ressources OHXUVDVSHFWV :
substituées).
- WHFKQLTXHV (volume économisé, facilité
8Q GLDJQRVWLF LQLWLDO GH TXDOLWp UHSRVH HQ de mise en œuvre, visibilité ou potentiel
JUDQGHSDUWLHVXU de communication, durabilité des
équipements,…).
- XQH pYDOXDWLRQ ÀDEOH GHV YROXPHV G·HDX
FRQVRPPpV SDU FKDFXQ GHV SRVWHV GH - PDLV VXUWRXW pFRQRPLTXHV FR€W HQ ½
FRQVRPPDWLRQ (basée sur des temps de P3 pFRQRPLVp RX WHPSV GH UHWRXU VXU
fonctionnement, des débits unitaires, plutôt LQYHVWLVVHPHQW 75, . En effet, pour
que sur des appréciations ou des ratios). préserver les nappes profondes, il nous faut
rWUH WUqV HIÀFDFHV DJLU YLWH G·LFL 
- XQH DSSUpFLDWLRQ MXVWH GH OD IUpTXHQFH sur des volumes importants, au moins 15
HW GHV FRQWUDLQWHV G·XWLOLVDWLRQ GHV millions de m3). 3DUDLOOHXUVOHVpFRQRPLHV
pTXLSHPHQWV. G·HDX VRQW XQ GHV UDUHV GRPDLQHV HQ
PDWLqUH GH GpYHORSSHPHQW GXUDEOH
Pour y parvenir, il ne faut pas hésiter à réaliser R O·RQ SHXW UpDOLVHU GHV pFRQRPLHV
des mesures ponctuelles (de débit / volume) ou ÀQDQFLqUHV facilement (en tout cas, pour les
à installer des compteurs divisionnaires. Outre premiers 20 à 30% d’eau économisés). C’est
la découverte de fuites, parfois anciennes et aussi la technique d’économie d’énergie la
importantes, un suivi régulier (idéalement tous SOXVHIÀFDFHYLDOHVpFRQRPLHVG·HDXFKDXGH
les mois) des compteurs permettra aussi de sanitaire.
détecter plus rapidement d’éventuelles fuites
ultérieures et surtout de disposer d’un bilan 3RXU DQDO\VHU O·LQWpUrW ÀQDQFLHU G·XQ SURMHW
LQLWLDOHWGHTXDQWLÀHUOHVUpVXOWDWVREWHQXVDSUqV local de substitution de ressource, on peut aussi
travaux. Ce suivi des consommations permet retenir le coût de revient moyen des substitutions
de réaliser des économies d’eau de 10 à 20% la de ressource pour la production d’eau potable à
première année, et de 5% en routine. l’échelle départementale : 5 !/m3.

5HPDUTXHVLGHVSUREOqPHVGHIRQFWLRQQHPHQW &·HVWSRXUTXRLHQFRQFOXVLRQXQSURJUDPPH
RXGHTXDOLWpSUpH[LVWHQWGDQVOHVEkWLPHQWV G·DFWLRQVFRPSRUWHREOLJDWRLUHPHQW
GRXFKHV pFRVVDLVHV UHWRXUV G·HDX
VWDJQDWLRQV«  OH GLDJQRVWLF LQLWLDO GHYUD OHV - GHV pFRQRPLHV DFWLYHV (encouragements
DQDO\VHUFDUOHVpTXLSHPHQWVK\GURpFRQRPHV aux changements de comportements, qui
ULVTXHQWGHOHVDPSOLÀHU. génèrent un gain à plus long terme);

&RQQDvWUH OHV FRQVRPPDWLRQV HQ HDX GH - HW GHV pFRQRPLHV SDVVLYHV (équipements
FKDTXH SRVWH SHUPHW HQVXLWH G·HQYLVDJHU hydro économes, qui génèrent un gain à
SOXV MXGLFLHXVHPHQW GHV pTXLSHPHQWV court terme).
pFRQRPHV HQ HDX DGDSWpV. 3RXU FHOD LO
IDXWSULYLOpJLHUOHVpTXLSHPHQWVVLPSOHVHW ,OGRLWVXUWRXWLQWpJUHU :
DGDSWDEOHV HW OHV VLWHV RX SRVWHV OHV SOXV
FRQVRPPDWHXUV. - ODSDUW DXPRLQV G·pFRQRPLHVSDVVLYHV
IDFLOHPHQWPLVHVHQRHXYUHUHQWDELOLVpHVHQ
PRLQVG·XQDQHWHIÀFDFHVLPPpGLDWHPHQW

25
EDVpHV VXU GHV DPpQDJHPHQWV VLPSOHV HW - une PDLQWHQDQFH des dispositifs installés
DGDSWDEOHV : équipement hydroéconome des (réparation des fuites, remplacement des
sanitaires (aérateurs sur les robinets existants, joints, réglage des temporisations, et surtout
sacs ou plaquettes dans les réservoirs des remplacement du matériel hydroéconome en
WC, douchettes économiques, réglage des ÀQGHYLHjO·LGHQWLTXHHQH[FOXDQWOHPDWpULHO
temporisations…), réduction de pression, standard…), fondamentale pour pérenniser
programmation ajustée de l’arrosage les économies,
actuel avec pluviomètre ou tensiomètre,
remplacement du ray grass par de la fétuque, - une VHQVLELOLVDWLRQ des usagers en parallèle
paillage ou mulch …. (numéro de téléphone pour signalement de
fuite, incitation aux petits gestes économes
- un suivi (au moins mensuel des SDU SODTXHWWHV ,QWUDQHW DIÀFKDJH
consommations), pour limiter les fuites, intégration de la problématiques « eau »
avant d’être plus ambitieux. (et « énergie ») dans toutes les formations
Or ce sont parfois les programmes les plus techniques (boite à idées, …), qui permettra
volontaristes qui méconnaissent ces actions. à plus long terme de faire évoluer les
comportements, et de réaliser des économies
,O YLVH DX PLQLPXP  G·pFRQRPLH G·HDX passives supplémentaires (20% au moins),
HW SHXW DWWHLQGUH DX PRLQV  GH JDLQ VL liées à ces changements.
HQ SOXV GX VXLYL GHV FRQVRPPDWLRQV HW GHV
DPpQDJHPHQWV UHQWDELOLVpV HQ PRLQV G·XQ
DQ FLWpV SUpFHGHPPHQW RSWLPLVDWLRQ GHV
pTXLSHPHQWV VDQLWDLUHV HW G·DUURVDJH  , il
prévoit :

- OH UHPSODFHPHQW GHV pTXLSHPHQWV


WUqV XWLOLVpV HW LQDGDSWpV (temporisation
des robinets et des chasses d’eau les plus
fréquemment utilisés, soit plus de 15 fois par
jour), OHUHPSODFHPHQWGHVÁHXUVDQQXHOOHV
HWGHOHXUV\VWqPHG·DUURVDJHSDUDVSHUVLRQ
SDU GHV SODQWHV YLYDFHV HW GHV JRXWWHV j
JRXWWHV,….
Ces nouveaux équipements ou aménagements
sont généralement rentabilisés en moins de 3
à 5 ans,

- le recyclage des eaux de refroidissement ou


de piscine, une gestion technique centralisée
de l’arrosage, une gestion différenciée des
espaces verts,… &HV DPpQDJHPHQWV VRQW
UHQWDELOLVpVjSOXVORQJWHUPH jDQV 
FHUWDLQVG·HQWUHHX[HQSDUWLFXOLHUSRXUOHV
HVSDFHV YHUWV FRUUHVSRQGHQW DXVVL j XQH
QRXYHOOH IDoRQ GH WUDYDLOOHU TXL GHPDQGH
GXWHPSVHWXQHLPSOLFDWLRQUHQRXYHOpHGX
SHUVRQQHO,

- ODVXEVWLWXWLRQGHO·HDXSRWDEOHRXGXIRUDJH
HQ QDSSH SURIRQGH SDU XQH UHVVRXUFH QRQ
GpÀFLWDLUH. Pour l’arrosage, il faut penser à
un forage peu profond, à un étang ou à une
source avant d’envisager la récupération
d’eau de pluie qui nécessite un important
stockage et est rarement rentabilisée en
moins de 15 ans. Elle n’est pas recommandée
pour l’arrosage ; elle est mieux adaptée au
nettoyage de véhicules ou matériels voire
à l’alimentation des chasses d’eau des
WC des bâtiments neufs (après dérogation
préfectorale),

26
Guide Methodologique
ANALYSE ET RÉDUCTION DES CONSOMMATIONS D’EAU
DANS LES ÉTABLISSEMENTS TERTIAIRES
Introduction

Saviez-vous qu’en Gironde, l’eau du robinet Ce guide est destiné aux maîtres d’ouvrages,
provient à 99% des nappes souterraines gestionnaires de patrimoines privés ou publics,
profondes et qu’elle a 20 000 ans ? Pour préserver et à leurs conseillers techniques. Il concerne les
cette précieuse ressource, actuellement trop établissements tertiaires (par opposition aux
sollicitée, le SAGE (Schéma d’aménagement activités agricoles et industrielles, qui ne sont
et de gestion des eaux) nappes profondes de pas concernées si ce n’est pour leurs services
*LURQGH D pWp DGRSWp ÀQ  6XU OD EDVH administratifs). Il propose une méthode pour
G·pWXGHV K\GURJpRORJLTXHV LO À[H XQ REMHFWLI analyser les consommations d’eau puis mettre
nécessaire pour la préservation des nappes en œuvre les travaux d’optimisation ou de
profondes : réduire les prélèvements de 30 substitution de ressource les mieux adaptés à
millions de m3 d’ici 2013, sur les 150 millions chaque contexte. Les recommandations pour
de m3 actuellement prélevés. Et il propose une réaliser des économies d’eau sont valables quel
nouvelle stratégie plus durable, en faisant des que soit le contexte d’analyse ; en revanche,
économies d’eau une priorité, puisqu’elles les substitutions de l’eau potable par une autre
doivent représenter un volume d’au moins 15 ressource sont envisagées dans un contexte plus
millions de m3 par an, soit la moitié au moins de VSpFLÀTXHPHQWJLURQGLQ
l’objectif.
Ce guide technique est dense et détaille
(WYRXVYRXVVHQWH]YRXVFRQFHUQpSDUFHGpÀ" volontairement, en huit étapes, la méthode
On pense souvent que les grands établissements de diagnostic et les possibilités d’économie
industriels ou publics le sont au premier chef, d’eau pour chaque poste de consommation. Il
car nous estimons, à tort, qu’ils consomment se veut aussi directement opérationnel. C’est
la plus grande partie de l’eau potable. En pourquoi, il comporte un résumé, conçu pour
réalité, ils représentent, chacun, à peine 10% être lu en totalité et des paragraphes détaillés
des prélèvements pour la production d’eau usage par usage, auxquels vous pouvez vous
potable (120 millions de m3 par an). Ce sont reporter si nécessaire pour plus de précisions.
les consommations d’eau sanitaire, à travers Pour aller plus loin dans un premier temps, le
les habitants et la multitude d’établissements chapitre « élaboration du plan d’actions » ainsi
tertiaires, qui représentent globalement les plus que les exemples en annexe sont vivement
importantes consommations (80 millions de m3 recommandés.
par an).
Ce document a été réalisé par le CREAQ (Centre
A titre d’illustration, le diagnostic des régional d’éco-énergétique d’Aquitaine), avec
consommations d’eau de l’aéroport de l’appui et pour le compte du SMEGREG (Syndicat
Bordeaux-Mérignac, qui a servi de base à mixte d’études pour la gestion de la ressource
l’élaboration du présent guide : auriez-vous en eau de la Gironde), en collaboration avec un
imaginé que plus de la moitié du volume groupe de travail associant :
d’eau consommé, soit plus de 20 000 m3/an, - l’Agence de l’Eau Adour-Garonne,
disparaissait dans les lavabos et WC, en majorité - le Conseil Régional d’Aquitaine,
ceux des employés ? De même, 30 à 50% des - le Conseil Général de la Gironde,
volumes consommés dans les supermarchés - la DDASS (Direction départementale des
sont utilisés dans les sanitaires. Ces constats actions sanitaires et sociales) de la Gironde,
sont surprenants. D’autant plus quand on sait - la DDAF (Direction départementale de
qu’il existe des dispositifs hydroéconomes l’Agriculture et de la forêt) de la Gironde.
adaptables, faciles à installer sur les sanitaires,
qui permettent de réduire d’au moins 30% les Pour les consommations d’eau dans les
consommations d’eau sanitaire et qui sont pWDEOLVVHPHQWV SXEOLFV OHV pFRQRPHV GH ÁX[
rentabilisés en moins d’un an. pourront aussi utilement se référer au « guide
des mesures d’économie et de maîtrise des
En matière de consommation et d’économie usages de l’eau dans les collectivités », réalisé
d’eau, un certain nombre d’idées reçues par le CREAQ en parallèle pour le compte du
existent. Elles peuvent laisser penser que la Conseil Général de la Gironde.
VLWXDWLRQ DFWXHOOH HVW QRUPDOH GLIÀFLOHPHQW
améliorable, ou pire, orienter les décisions vers
GHVWUDYDX[SHXHIÀFDFHV&·HVWGDQVFHFDGUH
et pour vous aider à faire les bons choix, qu’a
été réalisé le présent « guide d’analyse et de
réduction des consommations d’eau dans les
établissements tertiaires ».
28
1. Contexte girondin d’élaboration du guide

I.1 RESSOURCES EN EAU EN GIRONDE L’eau est un constituant normal du sous-sol.


Elle occupe les vides des roches en profondeur
'·RSURYLHQWO·HDXGXURELQHWHQ*LURQGH" (porosité) et le stock d’eau représente une
proportion notable du volume de la roche (de
Tous usages confondus l’eau potable, industrie, quelques % à plus de 20%). Cette eau est toujours
agriculture, …) les besoins en eau du département tombée à la surface sous forme de précipitations
de la Gironde s’établissent à près de 300 millions avant de percoler plus ou moins rapidement en
de m3 par an. La moitié environ de ces besoins sont profondeur.
satisfaits par les nappes profondes du Miocène,
de l’Oligocène, de l’Eocène et du Crétacé (de la La nappe phréatique est la première nappe
SOXVVXSHUÀFLHOOHjODSOXVSURIRQGH  rencontrée dans le sous-sol. C’est généralement
&HVQDSSHVSURIRQGHVIRXUQLVVHQWGHO·HDX une nappe à écoulement libre, c’est-à-dire une
SRWDEOHGXGpSDUWHPHQW nappe alimentée directement par percolation
verticale des précipitations depuis la surface du
Il s’agit d’une situation exceptionnelle : en sol.
moyenne en France, les nappes fournissent
environ 60% de l’eau potable, et il ne s’agit en Les nappes captives sont isolées de la nappe
général pas de nappes profondes. phréatique par des couches de roches
imperméables, généralement argileuses. L’eau
est sous pression sous ce toit imperméable
et l’on dit que la nappe est artésienne. Si la
SUHVVLRQHVWVXIÀVDQWHFHVQDSSHVSHXYHQWrWUH
jaillissantes. La circulation et le renouvellement
de l’eau dans les nappes sont généralement
très lents et l’eau peut être ancienne, jusqu’à
quelques dizaines de milliers d’années.

Illustration N°1 :
Schéma de circulation des eaux souterraines en Gironde

/HVGLIIpUHQWHVUHVVRXUFHVHQHDX
Illustration N°3 :
Les ressources en eau peuvent être réparties en Les vitesses d’écoulement de l’eau dans la nature
trois catégories :
OHVHDX[VXSHUÀFLHOOHV ULYLqUHVODFVHWF 
- les nappes phréatiques (premières nappes Hormis dans les rares aquifères karstiques où
rencontrées dans le sol) ; l’eau peut parfois circuler à des vitesses
- les nappes profondes. de plusieurs centaines de mètres par jour
GDQV GHV ÀVVXUHV RX GHV FRQGXLWV SDUIRLV GH
grandes dimensions (systèmes accessibles aux
spéléologues), l’eau circule en sous-sol d’un
point à un autre de la même couche à la vitesse
de quelques mètres par an (et parfois moins).

4XHOOHV VRQW OHV FDUDFWpULVWLTXHV G·XQH


QDSSH©SURIRQGHª"

(Q FRPSDUDLVRQ DYHF OHV HDX[ VXSHUÀFLHOOHV


les nappes dites profondes présentent les
VSpFLÀFLWpVVXLYDQWHV
- une grande stabilité dans leurs
caractéristiques physico-chimiques ;
Illustration N°2 : Les différents types de nappe

29
- une faible vulnérabilité vis-à-vis des L’eau de l’Eocène est d’ailleurs commercialisée
pollutions accidentelles sauf dans les zones en bouteille (Abatilles et certaines sources de
d’alimentation des nappes ; Cristalline).
- une répartition géographique large ;
- une faible sensibilité aux aléas climatiques 4XHOOHHVWODVLWXDWLRQGHVQDSSHVJLURQGLQHV
du fait de l’importance des stocks. DFWXHOOHPHQW"

A l’inverse de l’eau des rivières qui sont plus Depuis la réalisation en 1996 du Schéma
YXOQpUDEOHV DX[ SROOXWLRQV VXSHUÀFLHOOHV O·HDX départemental d’alimentation en eau potable,
des nappes profondes a une excellente qualité nous savons que les nappes profondes sont
constante. Elle ne nécessite pratiquement aucun localement trop sollicitées. Cette exploitation
traitement avant sa mise en distribution dans localement intensive menace la pérennité de
le réseau public, si ce n’est une déferrisation cette précieuse ressource. Pour que nos enfants
(on enlève une partie du fer, souvent abondant SXLVVHQWHQSURÀWHULOIDXWUpGXLUHOHVYROXPHV
dans le sous-sol) et une désinfection (cet ajout prélevés dans nos nappes.
de chlore est nécessaire pour garantir une
bonne qualité bactériologique de l’eau jusqu’au A titre d’exemple, en 1998, le prélèvement dans
robinet. En effet, si l’eau des nappes est pure, l’Eocène atteignait environ 58 millions de m3.
les tuyaux qui la transportent sont parfois Or les études hydrogéologiques ont montré que
anciens et corrodés). le prélèvement ne doit pas dépasser environ 45
millions de m3 pour préserver cette nappe.
Ces qualités sont particulièrement recherchées
et bien valorisées pour un usage tel que l’eau 4XHOHVWOHULVTXH"
potable. En revanche, certaines caractéristiques
des nappes profondes rendent complexe /H ULVTXH OLp j OD VXUH[SORLWDWLRQ GHV QDSSHV
l’organisation de leur gestion : HVWGHGHX[RUGUHV

- elles sont invisibles et donc absentes de  TXDQWLWDWLI  le niveau de la nappe


notre conscience collective ; s’abaissant, il faut toujours plus d’énergie
- elles sont multiples, complexes, superposées pour en extraire un volume équivalent.
et présentent des caractéristiques variables A l’extrême, dans le cas d’une nappe
dans l’espace ; captive, si le niveau de la nappe descend
- elles ne sont connues que très ponctuellement sous le sommet du réservoir la productivité
à la faveur de forages. s’effondre brutalement ;

Ces caractères deviennent fondamentaux  TXDOLWDWLI  VRXV O·HIIHW GH OD EDLVVH
lorsque l’on s’engage dans une politique dite GH SUHVVLRQ GHV pFRXOHPHQWV SHXYHQW
de «gestion durable», car les concepts de risque V·LQYHUVHU GDQV OHV UpVHUYRLUV VRXWHUUDLQV
(surexploitation et pollution) et de solidarité JpQpUDQW XQ ÁX[ G·HDX[ VXSHUÀFLHOOHV
doivent s’envisager sur des durées très longues SDUIRLVVDOpHV (elles proviennent de l’océan
(une à plusieurs décennies). ou de l’estuaire, qui sont les exutoires
naturels des nappes), RX SROOXpHV (dans
4XHOOHV VRQW OHV FDUDFWpULVWLTXHV GH O·HDX ce cas les eaux viennent d’une nappe plus
GHVQDSSHVSURIRQGHVJLURQGLQHV" VXSHUÀFLHOOH RX GH ULYLqUH  3RXU XQH QDSSH
captive, la descente de niveau sous le toit du
Ces eaux profondes sont issues d’un cycle naturel réservoir se traduit par une oxygénation de
très lent : O·HDX GX URELQHW HQ *LURQGH D HQ l’eau qui perd alors ses propriétés (un nouvel
JpQpUDODQV. équilibre physico-chimique s’installe).

L’eau de l’Eocène provient en effet de l’eau


de pluie tombée sur les contreforts du Massif
Central du temps de l’homme de Cro Magnon, qui
V·HVWLQÀOWUpHGDQVOHVRXVVROHW\DSHUFROpWUqV
doucement jusqu’à parvenir sous nos pieds (elle
se déverse ensuite naturellement dans l’océan
ou l’estuaire de la Gironde, en profondeur).
L’eau de l’Oligocène est moins âgée ; sa zone de
réalimentation est aussi géographiquement plus
proche de nous.

$XFRXUVGXWHPSVO·HDXGHVQDSSHVSURIRQGHVD
pWpÀOWUpHHWDDFTXLVXQHFRPSRVLWLRQFKLPLTXH
WUqVVWDEOH(OOHHVWGRQFG·H[FHOOHQWHTXDOLWp.
Illustration N°4 :
Coupe schématique d’une nappe captive et d’un forage

30
4XLXWLOLVHO·HDXGHVQDSSHVSURIRQGHV" 4XHIRQWOHVSRXYRLUVSXEOLFVSRXUDPpOLRUHU
ODVLWXDWLRQ"
Environ 120 des 150 millions de m3 prélevés en
2004 dans les nappes profondes servent à produire Face à la nécessité de préserver cette
de l’eau potable. Les agriculteurs utilisent ressource naturelle unique et fondamentale, la
environ 26 millions de m3 pour l’irrigation, mais Communauté Urbaine de Bordeaux et le Conseil
seuls 2,5 millions de m3 sont issus des nappes Général de la Gironde ont décidé :
SURIRQGHV GpÀFLWDLUHV RX j O·pTXLOLEUH  HW OHV
industriels prélèvent environ 4 millions de m3. - de créer un établissement public de
coopération, le Syndicat Mixte d’Etudes
pour la gestion de la ressource en eau du
département de la Gironde (SMEGREG),

- et d’élaborer un Schéma d’Aménagement et


de Gestion de l’Eau (SAGE) Nappes Profondes.
,OÀ[HOHVUqJOHVTXLSHUPHWWURQWG·DVVXUHUXQ
« bon état » (quantitatif et qualitatif, au sens
de la Directive cadre européenne) des nappes
souterraines de Gironde.
Illustration N°5 :
Principaux usages de l’eau des nappes profondes de Gironde 3RXU SUpVHUYHU OHV QDSSHV SURIRQGHV OHV
(en volume)
FROOHFWLYLWpVGRLYHQWrWUHH[HPSODLUHVDXWDQW
Par ailleurs, une étude réalisée en 2006 par le HQWDQWTXH
SMEGREG, à partir des consommations d’eau
potable de 60% des abonnés girondins, a montré - JHVWLRQQDLUH GX SDWULPRLQH GHV UpVHDX[
que, contrairement aux idées reçues : G·HDXSRWDEOHOHVFROOHFWLYLWpVFRQFHUQpHV
VRQW DORUV OHV FRPPXQHV HW OHXUV
- OHVSOXVJURVFRQVRPPDWHXUVG·HDXSRWDEOH JURXSHPHQWV TXL VRQW FRPSpWHQWV HQ HDX
VRQWJOREDOHPHQWOHVKDELWDQWV : en cumulé SRWDEOH V\QGLFDWVGHVHDX[« ;
les 1 375 000 girondins consomment plus de
la moitié de l’eau prélevée dans les nappes - FRQVRPPDWULFHV G·HDX  OHV FRPPXQHV
profondes ; VRQW GLUHFWHPHQW FRQFHUQpHV (OOHV VH
GRLYHQW G·rWUH H[HPSODLUHV HQ PDWLqUH
- OHV pWDEOLVVHPHQWV SXEOLFV FRPPXQHV GH FRQVRPPDWLRQ G·HDX SRXU LQFLWHU OHV
DGPLQLVWUDWLRQV pFROHV K{SLWDX[  KDELWDQWVjIDLUHGHPrPH.
XWLOLVHQW VHXOHPHQW  GH O·HDX SUpOHYpH
SRXUODSURGXFWLRQG·HDXSRWDEOH ; environ
1/3 de cette eau sert à l’arrosage et 2/3 I.2. SAGE NAPPES PROFONDES DE GIRONDE
en majorité dans les sanitaires. Dans les
FRPPXQHV FH UDWLR HVW SOXV VSpFLÀTXHPHQW Le SAGE nappes profondes de Gironde est un
en moyenne de 50% pour l’arrosage et de 50% document à portée réglementaire élaboré par la
dans les bâtiments ; &RPPLVVLRQ/RFDOHGHO·(DX &/( ,OGpÀQLWOHV
règles de gestion des eaux des nappes profondes
- OHVDFWLYLWpVpFRQRPLTXHV GXÁHXULVWHDX de Gironde.
supermarché en passant par les industries et
les campings) XWLOLVHQWHQYLURQGHO·HDX /D SRUWpH GX 6$*( QDSSHV SURIRQGHV GH
SUpOHYpHSRXUODSURGXFWLRQG·HDXSRWDEOH ; *LURQGH

-  GH O·HDX SUpOHYpH GDQV OHV QDSSHV Le SAGE nappes profondes Gironde est
SURIRQGHV HVW © SHUGXH ª GDQV OHV IXLWHV applicable depuis son approbation par le Préfet
GHVUpVHDX[G·HDXSRWDEOH (25 millions de m3) de la Gironde le 25 novembre 2003. Il encadre et
et leurs eaux de service (6 millions de m3 ; ces oriente les décisions de l’administration qui doit
HDX[VRQWXWLOLVpHVSRXUOHODYDJHGHVÀOWUHV nécessairement s’appuyer sur son contenu pour
les nettoyages, les purges…). motiver ses décisions dans le domaine de l’eau
souterraine. En cela, il constitue la référence
obligatoire sur son territoire d’application (le
département de la Gironde).

/HVREMHFWLIVGX6$*(QDSSHVSURIRQGHV

(Q WHUPH GH JHVWLRQ TXDQWLWDWLYH OH 6$*(


QDSSHV SURIRQGHV GH *LURQGH V·HVW À[p XQ
REMHFWLI GH UpGXFWLRQ GHV SUpOqYHPHQWV GH
 PLOOLRQV GH P3 GDQV OHV QDSSHV SURIRQGHV
Illustration N°6 :
Principaux usages de l’eau potable en Gironde
GpÀFLWDLUHVRXjO·pTXLOLEUHG·LFL
(Millions de m3, données 2004)
31
3RXUFHODLODRSWpSRXUXQHVWUDWpJLHGXUDEOH La Commission locale de l’eau est composée de
HQIDLVDQWGHVpFRQRPLHVG·HDXXQHSULRULWpHOOHV 3 collèges distincts :
GRLYHQWSHUPHWWUHGHUpGXLUHOHVSUpOqYHPHQWV
G·DXPRLQVPLOOLRQVGHP3SDUDQ PHVXUHV - les représentants des collectivités territoriales
 HW    OHV UHVVRXUFHV GH VXEVWLWXWLRQ et des établissements publics locaux : 12
GHYDQW TXDQW j HOOHV UHSUpVHQWHU  PLOOLRQV sièges,
GHP3VXSSOpPHQWDLUHV PHVXUH 
- les représentants des usagers, des propriétaires
riverains, des organisations professionnelles et
des associations : 6 sièges,

- les représentants de l’Etat et de ses


établissements publics : 6 sièges dont un pour
le représentant du préfet coordonnateur de
bassin et un pour le représentant de l’agence
de l’eau.
Illustration N°7 :
Principe de réduction des prélèvement d’eau dans les nappes /H60(*5(*
profondes adopté par le SAGE nappes profondes de Gironde

Les missions de cet établissement public de


/D&RPPLVVLRQORFDOHGHO·HDX &/( GX6$*( coopération entre la Communauté Urbaine de
QDSSHVSURIRQGHVGHOD*LURQGH Bordeaux et le Conseil général de la Gironde
consistent à proposer et à étudier la faisabilité
La CLE est le véritable noyau opérationnel du WHFKQLTXHpFRQRPLTXHMXULGLTXHHWÀQDQFLqUH
SAGE nappes profondes de Gironde Elle est de solutions de substitution aux prélèvements
chargée de l’élaboration, de la révision et du dans les nappes d’eau souterraine profondes du
suivi de la mise en œuvre de ce SAGE. Dans ce département.
cadre, elle est amenée à :
Par ailleurs, le SMEGREG assure le secrétariat
- préciser les modalités pratiques d’application technique de la CLE pour l’animation et le suivi
et la portée de certaines mesures, de la mise en œuvre du SAGE nappes profondes
de Gironde.
GpÀQLUGHVSULRULWpVG·DFWLRQV

- examiner la compatibilité avec le SAGE


des projets concernant les eaux souterraines
profondes,

 pYDOXHU O·HIÀFDFLWp GHV PHVXUHV GX 6$*(


et leurs incidences sur le comportement des
ressources en eau.

La CLE émet ainsi des avis, élabore des guides


pratiques ou des cahiers des charges et édite
chaque année un tableau de bord du SAGE.
&H GHUQLHU SHUPHW G·pYDOXHU O·HIÀFDFLWp GH
cette nouvelle politique de gestion, de la faire
évoluer, de sensibiliser le public à la valeur de la
ressource en eau et de promouvoir l’intérêt d’un
usage raisonné sur le long terme.

Illustration N°8 :
Schéma de principe de fonctionnement de la CLE

32
1I. Contenu du guide et utilisation

Les rédacteurs de ce guide ont délibérément (QÀQYRXVWURXYHUH]HQDQQH[HSOXVLHXUVRXWLOV


choisi d’entrer dans le détail de chaque étape pour vous accompagner :
de l’approche méthodologique, pour tous les
usages de l’eau.  XQH ÀFKH GH UHFXHLO GH GRQQpHV SRXU OHV
différents postes de consommation,
Ce guide technique est structuré en trois grandes
parties : - un descriptif sommaire des principaux
équipements hydroéconomes,
- diagnostic de la situation :
‡UHFXHLOGHGRQQpHV - un tableau commenté qui récapitule les
‡pYHQWXHOOHVLQYHVWLJDWLRQVFRPSOpPHQWDLUHV principaux ratios de consommation d’eau,
‡H[SORLWDWLRQGHVGRQQpHV
- un tarif indicatif des principaux équipements
SXLVGpÀQLWLRQGHVVFpQDULRVHQYLVDJHDEOHV hydroéconomes,
‡ pFRQRPLH G·HDX RSWLPLVDWLRQ GH OD
consommation, - des exemples d’analyse des consommations
‡ VXEVWLWXWLRQ GH OD UHVVRXUFH VL O·XVDJH d’eau et de plans d’actions.
le permet,

- et choix du plan d’actions, /H V\QRSWLTXH HQ SDJH VXLYDQWH SUpVHQWH


XQH V\QWKqVH GHV GLIIpUHQWHV pWDSHV GH OD
et chaque étape méthodologique est décomposée PpWKRGRORJLHSURSRVpHLOYRXVVHUDXWLOHSRXU
usage de l’eau par usage de l’eau. YRXVUHSpUHU

6RQFRQWHQXHVWGRQFWUqVGHQVHLOHVWFRQoX
FRPPHXQRXWLOPpWKRGRORJLTXH©jWLURLUVª 5HPDUTXH
1RXVYRXVUHFRPPDQGRQVGHOLUHOHUpVXPpHW
ODFRQFOXVLRQDÀQG·DYRLUXQHYLVLRQJpQpUDOH Ce guide a été réalisé sur la base d’une synthèse
GX VXMHW HW GH OD PpWKRGH 9RXV SRXUUH] des éléments techniques et économiques
HQVXLWH YRXV SORQJHU GDQV OH JXLGH j O·DLGH ainsi que des retours sur expérience connus
GH OD WDEOH GHV PDWLqUHV YRORQWDLUHPHQW WUqV à ce jour en matière d’économie d’eau. De
GpWDLOOpHDÀQGHUHFKHUFKHUGHVLQIRUPDWLRQV nombreuses actions ont été réalisées, parfois
SOXV GpWDLOOpHV SRXU XQ XVDJH VSpFLÀTXH RX depuis longtemps (notamment en Bretagne) ;
XQHTXHVWLRQSDUWLFXOLqUH elles ciblaient en général des établissements
VSpFLÀTXHV O\FpHVpFROHVTXHOTXHVFRPPXQHV
Si dans un premier temps, vous souhaitez aller pilotes…). La mise en œuvre d’un programme
au-delà du résumé, nous vous recommandons de d’économie d’eau à grande échelle, est
lire les parties consacrées : nouvelle et s’enrichit rapidement de nouvelles
expériences. C’est pourquoi le présent guide
- au contexte, qui vous préciserons les sera actualisé au cours du temps. Vous pouvez
motivations de la démarche. Ces éléments faire part de vos remarques ou expériences,
SHXYHQW YRXV SHUPHWWUH GH PLHX[ MXVWLÀHU WpOpFKDUJHUODYHUVLRQODSOXVUpFHQWHGXJXLGH
votre action auprès de vos collègues ou de RXFRQVXOWHUOHVÀFKHVGHVFULSWLYHVGHVUpDOLVDWLRQV
communiquer auprès des usagers ; girondines sur le site ZZZMHFRQRPLVHOHDXRUJ

- à l’élaboration du plan d’action, qui détaille


les étapes incontournables et propose des
programmes d’actions type pour les cas de
ÀJXUHOHVSOXVIUpTXHQWV SURJUDPPHjEXGJHW
UpGXLW PDLV WUqV HIÀFDFH SRXU FRQYDLQFUH
d’aller plus loin, programme classique
rentabilisé en moins de 3 ans, programme
plus ambitieux,…).

33
SYNTHÈSE DE LA MÉTHODE D’ANALYSE ET DE RÉDUCTION
DES CONSOMMATIONS D’EAU

Lien
c o m p t e u r s
ETAPE 1. Recueil des données disponibles sans investigation physiques / factures ou
Collecte des données

de terrain (plans, relevés des compteurs, factures,…), déclarations


Bilan de l’évolution des
ETAPE 2. Identification sur site des entrées (ressources en eau) consommations (ou volumes
et sorties en eau (usages ou postes de consommation), prélevés) sur au moins 3 ans.
Comparaison entre sites ou usages
identiques et ciblage des valeurs
ETAPE 3. Bilan sur site des équipements en place¬ élevées ou croissantes sans
- caractéristiques techniques et fréquence/mode
d’utilisation, pour évaluer leurs consommations d’eau, justification
- contraintes éventuelles d’utilisation,
- et bilan des qualités d’eau nécessaires.
Analyse des données

ETAPE 4. Evaluation du volume d’eau consommé pour 4bis. Si évaluation


chaque usage (sanitaires, arrosage, nettoyage, des volumes associés à
restauration,…), tableau entrées/sorties et ciblage des chaque usage impossible,
postes gros consommateurs
détermination des compléments
de données nécessaires, et
enquête complémentaire OU
ETAPE 5. Validation des informations recueillies et
DFTXLVHVSDUGHVGRQQpHV©¬pSURXYpHV¬ª FRPSDUDLVRQHQWUH campagne de mesures (relevés du
différents sites, à des ratios ou valeurs de référence, compteur soir/matin ou lors
volumes estimés par deux méthodes différentes,….) d’activités spécifiques,...)

ETAPE 6. Détermination du potentiel et des techniques


Propositions de scénarios

- d’économie d’eau, pour tous les usages,


- de substitution de l’eau potable par une autre
ressource, pour les usages d’arrosage et de nettoyage.
Appréciation de l’adéquation des équipements aux besoins
des utilisateurs (fréquence et contraintes d’utilisation,….).

ETAPE 7. Comparatif technico–économique des


DPpOLRUDWLRQVHQYLVDJHDEOHV¬HWhiérarchisation des actions
VHORQOHXU
- efficacité (volume économisé/volume total, coût du m3
économisé ou temps de retour sur investissement),
- exemplarité vis-à-vis des usagers ou visibilité,
facilité de mise en œuvre ou délai de réalisation.

ETAPE 8. Choix du plan d’actions, qui associe


- un suivi (minimum mensuel) des compteurs, avec
détection de fuites, pour un gain de 10 à 20% la 1ère
année, et 5% en routine;
Plans d'actions

- des équipements adaptables, rapidement (< 1 an)


rentabilisés (matériels hydroéconomes sur les sanitaires,
programmation d’arrosage, …), pour un gain minimum Penser à se donner les moyens
GH¬ de mesurer les résultats
- des travaux plus onéreux mais efficaces (volume (compteur, dédié si nécessaire, et
pFRQRPLVpVLJQLILFDWLIHWUHQWDELOLWpDQV ¬FRPSWDJHV
divisionnaires, temporisation des robinets les plus relevés mensuels, à prévoir avant
utilisés (> 15fois/j), remplacement des annuelles par les travaux d’amélioration)
des vivaces et des asperseurs par des gouttes à gouttes,
GTC, substitution de ressource, recyclage…, permettant
jPR\HQWHUPHG·REWHQLUXQJDLQMXVTX·j¬
PDLQWHQDQFHSRXUSpUHQQLVHUOHVpFRQRPLHV¬
- programme de sensibilisation pour augmenter le gain à
long terme (de l’ordre de 20% supplémentaires) et
donner l’exemple.

34
1II. La collecte des données

III.1. IDENTIFIER ET DÉLIMITER LE PÉRIMÈTRE ÉTUDIÉ III.2. IDENTIFIER LES RESSOURCES EN EAU (ENTRÉES)

Le premier impératif est de délimiter l’objet 8QH IRLV OH SpULPqWUH G·pWXGH GpÀQL LO HVW
de l’étude. Cela peut être évident pour un QpFHVVDLUHG·LGHQWLÀHUOHVUHVVRXUFHVHQHDXTXL
établissement délimité et simple, cela peut alimentent le site :
être plus compliqué pour des sites comportant
des bâtiments multiples et éventuellement de - adduction d’eau potable depuis le
multiples activités. réseau public (à partir d’un ou plusieurs
compteurs),
([HPSOH1ƒ6LWHVWHUWLDLUHV
- alimentation en eau depuis le milieu
- un immeuble de bureaux, avec un espace naturel : puits, forage, prélèvement de
vert arrosé, surface (rivière, étang…), bassin de rétention
ou citerne alimenté(e) depuis un réseau de
- un groupe scolaire avec une cantine, et un récupération d’eau de pluie ou d’eau de
centre de loisirs, drainage,…

- un camping avec un bar, une piscine et des Pour chacune de ces ressources il sera nécessaire
espaces verts arrosés, de collecter des informations sur :

- un centre de congrès comportant diverses - les compteurs d’eau :


salles (spectacles, réunions), un bar- ‡ ORFDOLVDWLRQ V  HW QXPpUR V   SRXU
UHVWDXUDQWGHVMDUGLQLqUHVGHÁHXUVHQIDoDGH valider le lien avec les factures d’eau ou
et une pelouse à l’arrière, les déclarations de volume(s) prélevé(s) à
l’Agence de l’Eau ou au BRGM ;
- une plateforme aéroportuaire… ‡ VL SRVVLEOH OHXU V  kJH V  PDUTXH V 
type(s) et diamètre(s) : pour savoir s’ils
3RXU WRXV FHV FDV LO VHUD QpFHVVDLUH GH GpÀQLU peuvent être équipés d’une tête émettrice ;
sans ambiguïté le périmètre étudié : liste des ‡ 1%  OHV VRXVFRPSWHXUV QRQ OLpV j XQH
bâtiments étudiés, liste des activités étudiées, facturation seront aussi recherchés.
ressources en eau concernées…
A défaut de compteur, localiser le (ou les)
,O IDXW QRWHU GqV OH GpSDUW TXH O·DQDO\VH VHUD point(s) d’entrée de l’eau dans le site, (à
SOXVSHUWLQHQWHVLO·pWXGHSRUWHVXUO·HQVHPEOH situer sur un plan de masse), le matériau
GX SDWULPRLQH G·XQ PDvWUH G·RXYUDJH, plutôt et le diamètre de la canalisation ainsi que
que sur une partie seulement, et cela pour son accessibilité (longueur de bout droit
plusieurs raisons : accessible) ;

- l’analyse de la situation sera facilitée, et Et pour le cas particulier des forages ou


les consommations excessives seront plus sources noter également les éléments
facilement mises en évidence si on peut suivants :
comparer les consommations de divers nom, N°BSS, profondeur, nappe concernée,
services ou sites ; volume autorisé, débit nominal des pompes
ou estimation du débit de la source,
- les éventuels travaux seront moins onéreux éventuel volume de stockage associé,…
si les commandes de matériels sont groupées
et si certains choix rationnels sont effectués - les secteurs ou usages alimentés par chaque
(par exemple si la mise en oeuvre d’une ressource ou chaque compteur d’eau ;
ressource de substitution est envisagée pour
de l’arrosage sur un site, on peut y prévoir - les consommations des trois dernières années
aussi une borne de remplissage pour de au minimum (idéalement 5 ans, surtout
l’arrosage à la tonne sur d’autres sites, ou s’il s’agit d’arrosage). Deux grands types
une zone de lavage de véhicules). d’informations sont à rechercher (il faut
surtout noter les questions auxquelles on n’a
$FHVWDGHO·pFRQRPHGHÁX[pWDEOLUDODÀFKH pas de réponse et qui orienteront l’inspection
G·LGHQWLÀFDWLRQGXVLWH pWDSHYRLUDQQH[H  sur site et l’analyse ultérieure des usages de
SRXUOHVVLWHVOHVSOXVFRPSOH[HVLOSHXWrWUH l’eau) :
QpFHVVDLUH GqV FHWWH pWDSH G·HIIHFWXHU XQH
YLVLWHVRPPDLUHGXVLWH
35
- l’évolution dans le temps de la consommation. 120m3/an). Le prix de l’eau potable seule
Plusieurs cas sont possibles : correspond en général à un peu moins de
(a) la consommation est relativement la moitié du prix de l’eau assainie ;
stable (variation inférieure à + ou – 10% (b) ou estimation du coût du m3 prélevé
d’une année à l’autre) ou les variations au niveau d’un forage ou d’une ressource
importantes peuvent être expliquées VXSHUÀFLHOOHSRXUFHODDMRXWHUOHFR€WGH
(travaux, incident,…) : il est toutefois la redevance à l’Agence de l’Eau et le coût
possible que des fuites non visibles existent de l’énergie (pompage) et de l’éventuel
depuis longtemps; traitement de l’eau ;
(b) la consommation a évolué sensiblement A titre indicatif, le prix d’un m3 d’eau
dans le temps : SUpOHYp GDQV XQH QDSSH VXSHUÀFLHOOH HW
utilisé sans traitement particulier varie en
‡en lien avec la fréquentation du site,
général de 0.1 à 0.5 !/m3 selon le volume
ou son éventuel agrandissement : il s’agit pompé ;
d’une évolution « normale ». Toutefois
(c) coût de l’énergie pour le chauffage
certains usages peuvent être source de
de l’eau chaude sanitaire à prendre en
gaspillages évitables : lors du bilan des
compte en sus, le cas échéant (en général
©VRUWLHVªG·HDXGXVLWHRQYpULÀHUDVL
supérieur à 1 !/m3).
les équipements sont adaptés à l’usage
(par exemple robinets temporisés pour
En outre, pour s’éviter un déplacement ultérieur,
les postes de lavage des mains utilisés
il peut être utile de relever dès le départ les
fréquemment) ;
autres ressources en eau non utilisées sur le site
‡ en lien avec la climatologie (en cas (source, étang, puits, surface de toiture…). Elles
d’arrosage) : la canicule de 2003 peut pourront le cas échéant être envisagées comme
expliquer une surconsommation, alors ressource de substitution à l’eau potable.
que l’interdiction d’arroser au cours de
O·pWp  HQ *LURQGH  SHXW MXVWLÀHU
une consommation plus faible. De même $ OD ÀQ GH FHWWH pWDSH O·pFRQRPH GH ÁX[
une période de plantation explique une GHYUDSRXYRLUpWDEOLUODÀFKHG·LGHQWLÀFDWLRQ
consommation ponctuellement plus GHVUHVVRXUFHV pWDSHYRLUDQQH[H 
importante ;
‡doucement, sans lien avec l’évolution
de la fréquentation ou d’événement
connu : dans ce cas au cours de l’étape
suivante, on cherchera à connaître III.3. IDENTIFIER LES USAGES (SORTIES)
l’âge des équipements et l’existence ou
non d’un contrat de maintenance : le Le présent chapitre liste les principaux postes
vieillissement des canalisations ou des de consommation d’eau qu’il est possible de
équipements sanitaires (robinets ou WC rencontrer dans les multiples catégories de
TXLIXLHQW« SHXWMXVWLÀHUGHVGpULYHV bâtiments tertiaires, ainsi que les questions à se
poser pour chacun d’entre eux.
‡ brusquement, sans lien avec un
événement connu, et en se stabilisant Au cours de cette étape, la tâche de l’économe
par la suite : on recherchera en priorité GHÁX[VHUDGHOLVWHUGHPDQLqUHH[KDXVWLYHFHV
XQ pYpQHPHQW VSpFLÀTXH TXL SHXW différents postes de consommation d’eau, et
MXVWLÀHU FHWWH pYROXWLRQ  LO SHXW V·DJLU de décrire les équipements correspondants de
d’une fuite survenue récemment. Et IDoRQjSRXYRLULQÀQH
celle-ci peut paraître anodine : par
exemple un WC qui fuit c’est 50 à 100 - donner un ordre de grandeur du volume
m3/an supplémentaires ; d’eau consommé par chaque usage,
‡ de façon aléatoire : préciser les
périodicités de relève des compteurs qui - avoir une description du matériel existant
peuvent être différentes d’une année à et des contraintes du site permettant, si
l’autre et être à l’origine d’une évolution nécessaire, de proposer des aménagements
apparente seulement. ou des nouveaux matériels, économes en eau
et adaptés.
- le coût de l’eau : La précision de la description sera fonction
(a) coût du m3 d’eau potable (abonnement de la complexité du site et des équipements,
et part liée à la consommation), avec 2 mais elle sera la plus succincte possible.
JUDQGVFDVGHÀJXUHSRVVLEOHVHDXSRWDEOH
seule, ou eau potable et assainissement ;
A titre indicatif, le prix moyen de l’eau
assainie en Gironde est de 3.1 !/m3 (sur
la base d’une consommation moyenne de

36
III.3.1. LISTER LES DIFFÉRENTS POSTES DE - s’assurer qu’il n’y a pas de fuite, et dans le
CONSOMMATION FDVFRQWUDLUHOHVTXDQWLÀHU

A titre indicatif, les principaux usages ou postes - préciser la fréquentation du site étudié
de consommation qui peuvent être rencontrés (nombre d’employés et de personnes
sont : externes), en notant pour les sites complexes
si la fréquentation est homogène pour tous
- sanitaires pour le personnel les équipements (nombre de repas différent
et/ou le public, du nombre d’employés, fréquentation
- nettoyage, différente de certains blocs sanitaires,
- arrosage, sanitaires accessibles à tous ou aux seuls
- restauration, employés, fréquentation des différents
- lavage du linge, bassins de baignade, équipements ouverts
- climatisation, toute l’année ou seulement l’été…),
- sécurité incendie,
- piscine, - dresser un historique des évènements sur
- bassin décoratif, les 3 dernières années au moins (sur la même
- logement de fonction, période que les données de consommation
- services techniques, d’eau) :
- autre usage. ‡UpQRYDWLRQH[WHQVLRQGHVEkWLPHQWV
‡IXLWHV
$ OD ÀQ GH FHWWH pWDSH OHV GLIIpUHQWV XVDJHV ‡ GpJUDGDWLRQV YDQGDOLVPHV DFWHV GH
FRQVRPPDWHXUV G·HDX VRUWLHV G·HDX  VRQW malveillance,
SUpFLVpV YRLUDQQH[HÀFKHpWDSH ‡FKDQJHPHQWGHPDWpULHOV

- préciser l’ouverture du site, les heures


d’accessibilité des locaux ou installations,
III.3.2. DÉTERMINER LE VOLUME D’EAU UTILISÉ POUR
- autant que possible, se mettre en relation
CHAQUE USAGE, ET CARACTÉRISER LES DIFFÉRENTS
avec la ou les personne(s) ressource selon les
ÉQUIPEMENTS ET LEUR ADÉQUATION AUX CONTRAINTES usages (gestionnaire, responsable technique,
D’UTILISATION responsable de la maintenance, plombier…)
HWHQYLVDJHUVDSUpVHQFHORUVGHODYLVLWHDÀQ
C’est l’étape fondamentale de l’analyse initiale. G·REWHQLUXQHLQIRUPDWLRQSOXVÀQH
Cela se fait en précisant les caractéristiques
techniques des équipements associés à chaque En outre, il peut être utile de se munir du
usage de l’eau et en relevant leur mode de matériel suivant pour la visite de site :
fonctionnement. Il faut noter le terme de
« relevé » : on évitera autant que possible les - une vue en plan des bâtiments niveau par
appréciations grossières. Et on recherchera les QLYHDXDÀQGHUHSpUHUOHVGLIIpUHQWVpOpPHQWV
caractéristiques techniques des équipements (une copie des plans d’évacuation incendie
(débit nominal, temps de fonctionnement…), en SHXWVXIÀUHjVHUHSpUHU 
se rapprochant autant que possible et surtout OHVÀFKHVG·LGHQWLÀFDWLRQGHVpTXLSHPHQWV
pour les gros équipements, de la personne qui vierges (voir annexes),
gère ou utilise les équipements).
 OHV ÀFKHV © DLGH j O·LQYHQWDLUH GH OD
En parallèle, il faut également noter les robinetterie » (voir annexes),
contraintes du poste de consommation - un appareil photo,
(fréquentation, usage intensif ou faible, usage - un débitmètre à lecture directe (pour
nécessitant un débit important sur une durée robinets et douches) ou un seau avec un
donnée, usage médical…). chronomètre,
- un manomètre,
3RXUFHODGHVÀFKHVG·DLGH©OLVWHG·pTXLSHPHQWV
W\SHªVRQWGLVSRQLEOHVHQDQQH[H - du colorant alimentaire (ou des blocs type
« eau bleue » pour détecter les fuites sur
WC)
- une pince à outils (type clef anglaise).
III.3.2.1 RECHERCHER DES INFORMATIONS COMMUNES
À TOUS LES USAGES

Avant d’aborder la caractérisation des différents


usages possibles, les éléments listés ci-dessous
correspondent à des informations communes, à
rechercher pour tous les usages : Débimètre Manomètre
Source : Ecoperl

37
III.3.2.2. SANITAIRES DU PERSONNEL OU DU PUBLIC - fréquence de maintenance et/ou âge des
équipements / fuites visibles :
- équipements présents, à préciser parmi les ‡ V·HQTXpULU GH O·H[LVWHQFH G·XQ FRQWUDW
VXLYDQWV j O·DLGH GHV ÀFKHV SOXV GpWDLOOpHV de maintenance et de son contenu
jointes en annexe : (réparation des fuites, remplacement des
joints, réglage des temporisations prévus ?)
ou de la maintenance interne ;
3RVWHVGH 3ULQFLSDX[pTXLSHPHQWV
8VDJH ‡ HQ O·DEVHQFH G·XQH PDLQWHQDQFH
FRQVRPPDWLRQ SRVVLEOHV
régulière, la date de réalisation
à réservoir classique ou des sanitaires permet de supposer
3/6l ou interrompable, d’éventuelles petites fuites éparses
WC ou suspendu ou (robinet qui ferme mal, WC légèrement
pneumatique, ou à
chasse temporisée fuyard…) ; noter celles qui sont visibles,
HWVLSRVVLEOHOHVTXDQWLÀHU
temporisé ou à détection
Urinoir
infrarouge

eau froide ou eaux III.3.2.3. NETTOYAGE


chaude et froide
(dans ce cas mélangeur III.3.2.3.1. NETTOYAGE DES SURFACES À L’EAU
ou mitigeur),
Evier / Lavabo à commande temporisée
ou non voire à détection,
Dans tous les cas, il faut préciser :
6DQLWDLUH
avec aérateur/limiteur
de débit ou non OU à ODVXSHUÀFLHFRQFHUQpH
double butée - le type de revêtement,
- le matériel de nettoyage, et ses contraintes
GRXFKHWWHHWÁH[LEOH
ou douche murale,
d’utilisation (il est souvent nécessaire de
économe en eau ou non, disposer de gros débits),
Douche - et la fréquence de nettoyage.
mélangeur ou mitigeur,
à commande temporisée
ou non 6ROVLQWpULHXUVFODVVLTXHV
Point de puisage
idem lavabo, avec
pour le
diamètre parfois Le nettoyage est fait soit à la main (balai et
« nettoyage du serpillière), soit à l’auto laveuse.
différent à noter
local »
Les volumes en jeu sont souvent peu importants
Tableau N°1 : en regard de la consommation totale du site
Principaux postes de consommation sanitaire bien que ce poste de consommation soit souvent
cité parmi les premiers.

- accessibilité : aux employés et/ou au 6XUIDFHVGHSURGXFWLRQ SUpSDUDWLRQGHUHSDV


public. Préciser les risques de vandalisme RX GH GHQUpHV DOLPHQWDLUHV GpFRXSDJH
pour le choix du matériel (il existe des SURFHVV«
séries hydroéconomes anti-vol, pour un coût
quasiment identique aux séries standard), Ces surfaces nécessitent souvent un nettoyage
fréquent et soigneux. Mais on rencontre aussi
- fréquentation d’utilisation par équipement : de nombreux gaspillages d’eau par des usagers
nombre approximatif d’employés et de qui évacuent par facilité à gros débit d’eau
visiteurs ou usagers, fréquence d’utilisation des déchets grossiers, plutôt que de balayer
(intensive soit > 15 fois/jour, moyenne, au préalable, de laisser agir une mousse
ou faible, soit < 3 fois/jour) et défaut de GpVLQIHFWDQWHHWHQÀQGHULQFHUjIDLEOHGpELW
fermeture (nombre de fois où le robinet a été Il faut relever ces habitudes pour le choix du
retrouvé ouvert). futur matériel hydroéconome.
En effet, dans un bloc sanitaire où les WC
sont très fréquemment utilisés, il est possible 9RLULHVHWSDUNLQJ
qu’un robinet de puisage ne le soit pas. Il n’est
GRQFSDVXWLOHGHSUpYRLUGHOHPRGLÀHU Certains sont nettoyés à l’aide d’une balayeuse,
1%,OHVWSUpIpUDEOHGHSODQLÀHUOHVYLVLWHV qui utilise en général de l’eau (noter le volume
des blocs sanitaires accessibles au public en embarqué et le linéaire de chaussée ou la
dehors des créneaux d’ouverture ; le travail surface de parking nettoyée correspondante ; le
de terrain en sera facilité. En effet, l’accès ratio moyen est de 5l/m linéaire de chaussée
aux sanitaires « mixtes » sera délicat voire nettoyée, soit environ 0.15 l/m2), d’autres
impossible pendant les heures d’ouverture. peuvent l’être au jet. Dans ce cas, se renseigner
sur le motif d’un nettoyage de ce type.

38
III.3.2.3.2. NETTOYAGE DE VÉHICULES OU DE III.3.2.4.1. PRÉPARATION DES REPAS ET VAISSELLE
MATÉRIELS
Plusieurs postes de consommation peuvent être
Il s’agit de préciser les consommations en eau présents :
provenant pour l’essentiel du nettoyage du
parc véhicule, et parfois de certains matériels 8VDJH 3RVWHGHFRQVRPPDWLRQ
(tondeuses, matériel de désherbage…) et de se
renseigner sur les points suivants :
Préparation des repas
- le mode de nettoyage utilisé (lavage
manuel, jet d’eau, haute pression, portique Lavage de la vaisselle
automatique) et la consommation d’eau 5HVWDXUDWLRQ
XQLWDLUHSDUFDWpJRULHGHYpKLFXOH,GHQWLÀHU Lavage du linge
le nombre de cycles/an et par type de
véhicule,
Chambre froide
 OHV FRQWUDLQWHV VSpFLÀTXHV SRXU FKDTXH
catégorie de véhicule : process et lieu de Tableau N°2 :
Principaux postes de consommation de restauration
nettoyage, et en particulier l’organisation
des tournées qui peut ou pas permettre le
regroupement ou le déplacement du site de Il faut penser aux points suivants :
nettoyage,
- utilisation de vaisselle jetable ou de plateaux
- la nécessité simultanée d’un point de thermomoulés,
puisage (pour le remplissage des balayeuses - nombre de repas préparés, et servis sur
de rues, des tonnes pour l’arrosage au jet, place (certains peuvent être livrés) par jour
ou le désherbage,…), et la quantité d’eau - mode de lavage de la vaisselle :
correspondante,
‡ DSSDUHLO GH ODYDJH  OH UHVSRQVDEOH
- l’éventuel recyclage de l’eau (circuit des cuisines peut en général préciser
fermé). leur nombre, leur consommation d’eau
par cycle ou à défaut leur âge (les plus
III.3.2.3.3. LAVAGE DU LINGE anciens modèles standard – 12 couverts -
consommaient environ 50 l/cycle, et les
Les éléments suivants seront recherchés : plus récents consomment 12 à 15 l/cycle),
leur usage (lave-vaisselle, lave-ustensiles,
- consommation d’eau par cycle ou à défaut âge autoclave,…).
du lave-linge (les plus anciens (plus de 15 ans) ‡ PDQXHO  GHPDQGHU OH WHPSV PR\HQ
consomment 120 l d’eau par cycle, ceux vendus d’ouverture des robinets et le nombre et
il y a une dizaine d’années 80 à 100 l/cycle et les le volume des remplissages de bacs pour
plus récents 40 l à 50 l/cycle), effectuer le lavage.

- fréquence d’utilisation, (VWLPDWLRQ GH OD FRQVRPPDWLRQ HQ HDX SDU


UHSDV HQ JpQpUDO LO IDXW  j  O G·HDX SDU
- contraintes d’utilisation, en particulier s’il UHSDVG·DXWDQWSOXVTXHODYDLVVHOOHHVWIDLWH
existe plusieurs machines : certains linges ne VXU SODFH HW TXH OH QRPEUH GH UHSDV HVW
peuvent pas être mélangés, ce qui rendrait IDLEOH 
impossible l’achat d’une machine de grande
capacité, souvent plus économe en eau si elle III.3.2.4.2 CHAMBRES FROIDES
est utilisée à pleine capacité.
Une chambre froide est maintenue en
température par enlèvement de la chaleur
III.3.2.4. RESTAURATION due aux ouvertures de portes, à l’entrée des
denrées stockées et aux pertes à travers les
On rassemble sous ce paragraphe toutes les parois. Cet enlèvement de chaleur est obtenu
installations permettant aux salariés et visiteurs par une machine thermodynamique (groupe
de se restaurer (restauration collective, bar, froid) composée d’un évaporateur situé dans la
cafétéria,…). chambre froide et d’un groupe de condensation
situé à l’extérieur de la chambre froide. Le groupe
de condensation comporte un compresseur et
un condenseur, ce condenseur est un échangeur
permettant d’évacuer à l’extérieur la chaleur (à
un niveau de température plus élevé grâce au
cycle thermodynamique) évacuée de la chambre
froide.

39
Deux technologies de condenseurs peuvent être d’ouverture (inutile) du robinet pour atteindre la
rencontrées : ERQQHWHPSpUDWXUHYpULÀHUTXHOHFDORULIXJHDJH
est effectif.
- condenseur à eau (la chaleur est évacuée
par échange avec de l’eau),
- condenseur à air (la chaleur est évacuée III.3.2.5. PISCINES OUVERTES AU PUBLIC
par échange avec de l’air), c’est le cas le
plus courant surtout pour des chambres Ne seront étudiés dans ce paragraphe que les
froides de tailles moyennes. Dans ce cas, postes de consommation suivants (pour les
le refroidissement de la chambre froide ne sanitaires, se reporter à la rubrique « sanitaires ») :
conduit à aucune consommation d’eau. Pour analyser la consommation d’eau des
piscines, il faut rechercher les informations
Dans le cas de condensation à eau, l’eau de suivantes :
refroidissement peut avoir deux origines :
8VDJH 3RVWHGHFRQVRPPDWLRQ
- un circuit d’eau de refroidissement du site,
ou un échange avec un circuit d’eau glacée
Renouvellement en eau
du site. Dans ce dernier cas, la consommation
éventuelle sera analysée au chapitre « II.3.8 3LVFLQHEDVVLQ
Climatisation » ci-après, Traitement de l’eau
- un raccordement sur le réseau d’eau froide Tableau N°3 :
du site : l’eau de réseau sous pression est Principaux postes de consommation des piscines
raccordée au groupe de condensation,
une vanne dite pressostatique régule - ouverture du site (jours par an), en
l’arrivée d’eau en fonction des besoins distinguant les bassins d’été de ceux ouverts
de refroidissement. Cette technologie est toute l’année,
fortement consommatrice d’eau, elle ne
se rencontre normalement plus sur les - fréquentation (nombre de baigneurs annuels
installations récentes mais existe sur des et variations mensuelles),
installations anciennes, il est donc très - nombre de bassins, types (couvert, de plein
LPSRUWDQWGHO·LGHQWLÀHUFRPSWHWHQXGHVRQ air), surfaces et volumes,
impact sur les consommations. D’autre part, - traitement de l’eau (chlore stabilisé, eau
il n’est pas rare que par manque de contrôle de javel, javel + stabilisant, ozone, brome,
et d’entretien, la vanne de régulation chlore gazeux….),
pressostatique ne joue plus son rôle, - qualité de l’eau, sachant que les principales
l’écoulement d’eau est alors permanent. teneurs à ne pas dépasser sont les suivantes :
Dans le cas où une telle installation est chlore combiné (chloramines) < 0.6 mg/l,
présente, il faudra obligatoirement évaluer stabilisants < 0.75 mg/l. Un minimum de
FHWWH FRQVRPPDWLRQ VSpFLÀTXH SDU XQH 2mg/l en chlore libre est exigé en l’absence
campagne de mesure simple, comme exposé de stabilisant (et on recommande de se
au paragraphe III.2 ci après. limiter à 5 mg/l) et de 0.4 à 1.4 mg/l en cas
d’utilisation de stabilisant,
III.3.2.4.3. CHAUFFAGE
- renouvellement de l’eau : mode (% par le fond
De nombreuses fuites proviennent d’une et par la surface), asservissement et quantité
mauvaise fermeture de la soupape du d’eau (l/j/baigneur par bassin, sachant que
groupe de sécurité des ballons d’eau chaude la moyenne généralement observée varie de
électriques. Quand l’eau chauffe, il est normal 50 à 120 l/j/baigneur, et qu’elle doit être
que quelques gouttes s’échappent (l’eau se au minimum de 30 l/j/baigneur). Pour une
dilate en chauffant), mais parfois la soupape piscine de 25 m (soit 350m3 et 250m2), on
fonctionne mal (s’entartre) et évacue de l’eau observe en moyenne un renouvellement de
en permanence. 20 à 35 m3/j,
GHVFULSWLIGXV\VWqPHGHÀOWUDWLRQ GpELWHW
Par ailleurs, les chaudières gaz anciennes ne PDWpULDX[ÀOWUDQWV 
sont pas équipées d’une réserve (appelée - nombre de vidanges par an (pour les
accumulation ou micro accumulation), qui piscines, 2 vidanges annuelles doivent être
permet de disposer immédiatement d’eau effectuées au minimum, 4 pour les piscines
chaude, sans laisser couler l’eau au préalable : qui demeurent aux normes de 1969, mais dans
noter l’âge de la chaudière et l’existence ou non ce cas cela implique aussi un renouvellement
de cette accumulation. de l’eau journalier d’1/20ème du volume des
bassins),
(QÀQ OH FDORULIXJHDJH GHV FRQGXLWHV G·HDX - présence ou pas de déchloraminateur,
chaude permet de limiter le refroidissement
de l’eau entre la chaudière et le point de - pour les petites piscines de plein air :
prélèvement, et donc de limiter le temps présence d’une bâche de couverture (limite
l’évaporation hors période d’ouverture).
40
/HUHQRXYHOOHPHQWGHO·HDX

/RFDOLVDWLRQGHODSLVFLQH
...........................................................................

Période
Renouvellement
Nom du d’ouverture, Volume du Nombre de Nombre de
(l/j/baigneur Remarques
bassin et si été bassin (m3) vidange/an baigneurs/j
et m3/j)
couvert ?

/HWUDLWHPHQWGHO·HDX

/RFDOLVDWLRQGHODSLVFLQH
...........................................................................

Nom du Produit Concentration en Concentration en stabilisant Remarques


bassin désinfectant chloramines (si utilisé) 'LVSRVLWLIGHÀOWUDWLRQ

Mini Maxi Mini Maxi

Il faut noter que le renouvellement de l’eau et un remplissage fréquent) : pour cela, il faut
le traitement de l’eau sont deux paramètres savoir que l’évaporation moyenne annuelle
intimement liés, et qu’il convient de les analyser dans un bassin à ciel ouvert est de l’ordre
en parallèle pour apprécier les possibilités ou de 0.15 cm/jour. En moyenne en été (hors
non de réduire le premier. périodes de pluie), cette valeur est d’environ
0.5 cm/j. Par temps très chaud et de grand
vent, on peut observer une évaporation
III.3.2.6. BASSINS DÉCORATIFS d’au plus 1 à 1.5 cm/j. Au-delà, et de façon
certaine à partir de plus de 2 cm/j, on peut
Pour les bassins décoratifs, il faut noter : soupçonner une fuite.

- leur surface, et leur volume,


III.3.2.7. CLIMATISATION
- leur étanchéité (argile compactée, béton,
membrane…), Le terme de climatisation regroupe deux types
d’installation :
- l’apport d’eau annuel (en cas de
réalimentation par un forage ou par de l’eau - les installations de rafraîchissement, c’est-à-
potable), dire de contrôle de la température intérieure
en dessous de la température extérieure avec
- l’éventuel volume prélevé pour l’arrosage XQGLIIpUHQWLHOGpÀQL
(à défaut de la donnée voir le paragraphe
suivant), - les installations de climatisation, c’est-à-
dire de maintien d’une température et d’une
- la présence d’élément décoratif (type jet hygrométrie constante (dans la limite des
d’eau, cascade…). conditions extérieures prévisibles).

Dans ce cas, il faut s’assurer qu’il n’y a pas : Dans les deux cas, un système doit produire du
IURLGSRXUVDWLVIDLUHGHVH[LJHQFHVÀ[pHV&HWWH
- à partir de la ressource de réalimentation, production de froid est obtenue à partir d’une
de fonctionnement en circuit ouvert des PDFKLQHIULJRULÀTXHFRPSRVpHGHWURLVpOpPHQWV
éléments décoratifs, principaux (ces trois éléments pouvant être en
un seul bloc, en deux blocs ou en trois blocs) :
- de fuite importante du bassin (qui oblige à
41
- un évaporateur : échangeur permettant de D’autre part, il n’est pas rare que par manque de
dissiper le froid produit, contrôle et d’entretien, la vanne de régulation
pressostatique ne joue plus son rôle, l’écoulement
- un compresseur, un détendeur et des liaisons d’eau est alors permanent. Dans le cas où une
IULJRULÀTXHV SHUPHWWDQW GH UpDOLVHU OH F\FOH telle installation existe, la consommation d’eau
thermodynamique, VSpFLÀTXH VHUD REOLJDWRLUHPHQW SUpFLVpH SDU
une campagne de mesure simple comme exposé
- un condenseur : un échangeur permettant au paragraphe III.2 ci après.
d’évacuer la chaleur transférée par le système
à un niveau de température plus élevé que III.3.2.7.2. REFROIDISSEMENT PAR L’EAU ISSU D’UN
celui auquel il est prélevé. FORAGE OU D’UNE RESSOURCE DE SURFACE

Nous traitons dans ce chapitre des eaux issues


Deux technologies de condenseurs peuvent être d’un forage ou d’un pompage issu du milieu
rencontrées : naturel. Dans ce cas il faut collecter les éléments
permettant de juger de l’adéquation de cette
- condenseur à eau (la chaleur est évacuée consommation aux besoins, soit :
par échange avec de l’eau),
 UHOHYpV GX FRPSWHXU G·HDX VSpFLÀTXH j
- condenseur à air (la chaleur est évacuée par cet usage au cours des 3 dernières années
échange avec de l’air), c’est le cas le plus au moins : s’intéresser aux variations et aux
courant surtout pour les petites ou moyennes pointes ponctuelles. En cas d’absence de
installations. Dans ce cas, le fonctionnement compteur prévoir une campagne de mesure
de la climatisation ne conduit à aucune simple (mais assez longue) comme exposé
consommation d’eau. au paragraphe III.2 ci après,

SXLVVDQFHIULJRULÀTXHGHO·LQVWDOODWLRQ
Dans le cas d’une condensation à eau, celle-ci
peut être réalisée par : - temps de fonctionnement de l’installation,

- l’eau du réseau, - consommation énergétique (pour apprécier


éventuellement les gains ou surcoûts
- de l’eau issue d’un forage, pQHUJpWLTXHVHQFDVGHPRGLÀFDWLRQ 

- un circuit fermé refroidi par - surface et volume rafraîchis,


aérorefroidisseurs, qui peuvent fonctionner :
‡ HQ PRGH VHF LOV QH FRQVRPPHQW DORUV - autres besoins éventuels de froid.
pas d’eau, sauf s’ils sont arrosés par fortes
chaleurs, III.3.2.7.3. REFROIDISSEMENT PAR UN CIRCUIT FERMÉ
‡ RX HQ PRGH KXPLGH ,O V·DJLW DORUV GH
tours aéroréfrigérantes, qui peuvent avoir Les condenseurs sont refroidis par l’eau
un circuit primaire ouvert ou fermé ; d’une boucle circulant en circuit fermé dans
ou être hybrides. Dans tous les cas elles l’établissement, cette boucle est elle-même
consomment de l’eau, et du fait du risque refroidie par des aérorefroidisseurs (échange
associé de développement de légionnelles, entre eau et air). Si l’échange s’effectue en
depuis le décret du 1er décembre 2004, mode sec (pas d’évaporation d’eau dans la
elles sont soumises à déclaration ou veine d’air) le refroidissement ne consomme
autorisation (voir nomenclature ICPE pas d’eau. Ce mode parait au premier abord
rubrique 2921). optimal puisqu’il ne consomme pas d’eau, mais
les performances thermiques (température
III.3.2.7.1. REFROIDISSEMENT PAR L’EAU DU RÉSEAU minimum de refroidissement) sont liées à la
température sèche de l’air extérieur, ce qui a
C’est le cas du refroidissement « à eau perdue » : SRXUFRQVpTXHQFHTXHO·HIÀFDFLWpGHFHV\VWqPH
l’eau de réseau sous pression est raccordée diminue lorsque la température extérieure
au condenseur, une vanne dite pressostatique augmente pouvant aller jusqu’à des pannes du
régule l’arrivée d’eau en fonction des besoins de système lors de périodes caniculaires.
refroidissement. Cette technologie est fortement
consommatrice d’eau, elle ne se rencontre Pour pallier à cet inconvénient certains
normalement plus sur les installations récentes gestionnaires font arroser leurs aérorefroidisseurs
mais existe sur des installations anciennes et secs en période chaude. D’un point de vue de
de petites puissances, il est très important de la pérennité des équipements cette pratique
O·LGHQWLÀHU FRPSWH WHQX GH VRQ LPSDFW VXU OHV est sujette à caution car ces équipements ne
consommations. sont pas conçus pour être arrosés (corrosion),
du point de vue de la consommation d’eau

42
cette pratique est équivalente à celle du Pour l’analyse de ce poste climatisation,
refroidissement humide avec dans la plupart des O·pFRQRPHGHÁX[GHYUDFROOHFWHUOHVpOpPHQWV
cas une non maîtrise de la consommation et une permettant de juger de l’adéquation de la
IDLEOH HIÀFDFLWp GX SKpQRPqQH G·pYDSRUDWLRQ consommation aux besoins, soit :
(équipement non conçu pour l’usage recherché).
Lorsque les performances d’un refroidissement SUpVHQFHG·XQFRPSWHXUVSpFLÀTXH"&·HVW
en mode humide sont requises, il faut préférer normalement le cas pour une installation
un équipement conçu pour cet usage c’est-à- correctement conduite car la consommation
dire des tours de refroidissement. d’eau est un élément indispensable à la
conduite du traitement d’eau, fondamental
Les tours de refroidissement fonctionnent pour une telle installation (obligatoire pour
suivant le principe du refroidissement évaporatif : les tours aéroréfrigérantes en mode humide).
l’eau à refroidir est pulvérisée à contre courant Si ce n’est pas le cas (rares systèmes de
G·XQÁX[G·DLUO·HDXHVWDLQVLUHIURLGLHGHGHX[ refroidissement à eau perdue), prévoir une
manières : campagne de mesure simple comme exposé
au paragraphe III.2 ci après.
- d’une part par échange direct eau/air,
SXLVVDQFHIULJRULÀTXHGHO·LQVWDOODWLRQ
- d’autre part par évaporation d’une partie de
l’eau elle-même. La quantité d’eau évaporée - puissance unitaire, marques et types des
dépend de l’humidité de l’air à l’entrée du tours de refroidissement,
système, celui-ci entrant froid et sec dans le
système et en ressortant chaud et humide. La - surfaces et volumes rafraîchis,
quantité d’énergie nécessaire à l’évaporation
de l’eau étant prélevée à l’eau, ce système - temps de fonctionnement de l’installation,
permet de refroidir l’eau à une température
plus basse que le refroidissement sec. - consommation énergétique,

Ce système de refroidissement consomme de - autres besoins éventuels de froid,


l’eau :
- maintien ou non de l’hygrométrie de l’air.
- l’eau d’évaporation : l’eau évaporée doit
être remplacée dans le circuit,
III.3.2.8. ARROSAGE
- l’eau de déconcentration : l’eau du
circuit étant partiellement évaporée et Il s’agit de réaliser un inventaire des aires
remplacée, les sels minéraux contenus arrosées, en précisant leur surface, type de
dans l’eau et qui eux ne s’évaporent pas se plantation et nature (jardinière, plate-bande,
FRQFHQWUHQW DX ÀO GX WHPSV 3RXU JDUGHU j URQGSRLQW KDLH VWDGH«  HW G·LGHQWLÀHU
l’eau des caractéristiques physico chimiques pour chacune d’elle la technique utilisée pour
compatibles avec son usage, il est nécessaire l’arrosage.
de procéder à une déconcentration des sels
minéraux par évacuation et remplacement Il faut penser à préciser les points suivants :
d’une quantité d’eau. Cette déconcentration
peut être constante, chronoproportionelle ou ODRXOHVVXSHUÀFLHVDUURVpHV SRXUFRPSDUHU
régulée. le ratio du site à un ratio de référence).

Il existe différentes technologies de tours $FHVXMHWVXUZZZMHFRQRPLVHOHDXRUJj


de refroidissement, ouvertes, fermées ou ODUXEULTXH©GRFXPHQWDWLRQHWOLHQVªXQ
hybrides. Les tours ouvertes ou fermées ont FDOFXO HQ OLJQH SHUPHW GH GpWHUPLQHU OHV
des consommations d’eau similaires, les tours EHVRLQVHQHDXPR\HQV QRQRSWLPLVpV G·XQ
hybrides permettent des économies d’eau HVSDFH YHUW /HV EHVRLQV UpHOV VHURQW SOXV
importantes par l’optimisation de l’emploi des IDLEOHVVLO·DUURVDJHHVWRSWLPLVpHWOHFKRL[
modes secs et humides. GHVHVSqFHVYpJpWDOHVDGDSWp3DUUDSSRUWj
FHVGRQQpHVPR\HQQHVGHVSODQWDWLRQVVXU
3RXUSOXVGHUHQVHLJQHPHQWVHQSDUWLFXOLHUVXU VROVDEOHX[DXURQWXQEHVRLQSOXVLPSRUWDQW
OHVFR€WVG·LQYHVWLVVHPHQWHWGHIRQFWLRQQHPHQW TXHGHVHVSqFHVYpJpWDOHVVXUDUJLOH(WVXU
GHV V\VWqPHV GH FOLPDWLVDWLRQ YRLU O·pWXGH FH PrPH VLWH SRXU SOXV GH GpWDLOV YRXV
GX SRWHQWLHO GH PDvWULVH GHV FRQVRPPDWLRQV SRXYH] FRQVXOWH] OH © JXLGH GHV ERQQHV
G·HDXGDQVODJUDQGHGLVWULEXWLRQHQ*LURQGH SUDWLTXHVGHO·DUURVDJHGHVHVSDFHVYHUWVHW
WpOpFKDUJHDEOHVXUOHVLWHZZZVPHJUHJRUJ GHVWHUUDLQVGHVSRUWª

43
débits importants : est-ce réalisé en circuit
- le type de végétation en place (massifs ouvert ou fermé ? Où est située la pompe, y
ÁRUDX[ JD]RQV DUEXVWHV«  DYHF SDUIRLV a t il de l’espace ? en circuit ouvert, l’eau
certaines nuances à préciser : les massifs est-elle récupérée ?
ÁRUDX[FRUUHVSRQGHQWLOVjXQHKDELWXGHRXj
une volonté expresse ? parmi les terrains de
jeu, tous ont-ils besoin d’être arrosés de façon III.3.2.10. LOGEMENTS DE FONCTION
aussi importante (différence entre un terrain
d’entraînement et un terrain d’honneur) ?... Pour préciser le volume consommé, on cherchera
à préciser :
- pour chaque espace vert, fréquence et
volume d’eau utilisé par cycle d’arrosage, - le nombre de logements,
variation au cours de l’année,
- leurs consommations d’eau ou à défaut leurs
- descriptif des équipements d’arrosage types (Studio, T1, T2, T3,…) ou le nombre
(aspersion, goutte à goutte, arrosage manuel d’occupants, la présence d’un jardin ou d’une
au jet ou à partir d’une tonne …) et de piscine, de façon à apprécier la consommation
programmation (descriptif du programmateur, potentielle par rapport au volume consommé
de sa programmation actuelle et de ses par un logement moyen (environ 115 m3/an/
éventuelles contraintes pour une gestion plus logement pour 2,3 habitants).
ÀQHDYHFFRXSODJHRXQRQjXQSOXYLRPqWUH
et à un tensiomètre, gestion centralisée /·LGpDOpWDQWGHSRVHUXQFRPSWHXUVSpFLÀTXH
anticipant sur la météorologie,….)

En étant sur place, pour éviter d’y revenir, penser


à relever la présence éventuelle d’une source,
la localisation et la surface approximative d’une
éventuelle retenue d’eau, les bâtiments situés à
proximité et leurs surfaces de toiture (pour une
éventuelle récupération d’eau de pluie).

III.3.2.9. SÉCURITÉ INCENDIE

Ce paragraphe comprend tous les points de


prélèvements susceptibles d’être utilisés à
GHV ÀQV GH OXWWH FRQWUH O·LQFHQGLH SRWHDX[
incendie, bornes, citernes (réservoirs), matériels
roulants).

Les points suivants doivent être listés :

- plan de réseau « défense incendie » s’il


H[LVWH DÀQ G·LGHQWLÀHU HW G·LQYHQWRULHU OHV
bornes incendie,

- inventaire du matériel à disposition (citerne,


matériels roulant, bornes incendies),

- fréquence des essais réalisés sur une


année (retenir un volume de 150 litres d’eau
consommé par essai de poteau, soit 10
secondes de test),

- purges après les essais pour cause de


remise en suspension dans les canalisations
(phénomène d’eau rouge,…). Elles
occasionnent des pertes en eau bien plus
importantes que les essais incendie,

- présence d’un dispositif de protection


automatique contre l’incendie par un réseau
de sprinckleurs : la pompe qui alimente le
réseau doit être testée fréquemment (voir
exigences de l’APSAD), et correspond à des
44
1V. Analyse des données

IV.1. BILAN DES DONNÉES DISPONIBLES ET DES DONNÉES ([HPSOH 1ƒ    ([HPSOH GH PDXYDLVH
MANQUANTES pYDOXDWLRQ GHV SRVWHV GH FRQVRPPDWLRQ
G·HDX

$FHVWDGHO·pFRQRPHGHÁX[GRLWDYRLUUHPSOL Cas d’un immeuble de bureau avec 250 employés,


OD )LFKH G·LGHQWLÀFDWLRQ GHV pTXLSHPHQWV une cantine (repas livrés et non préparés sur
FRQVRPPDWHXUVSDUXVDJH SRXUO·pWDSHYRLU place) et un espace vert arrosé de 500m2.
O·H[HPSOHGHÀFKHG·HQTXrWHHQDQQH[H  Le gestionnaire pensait au départ que la
consommation annuelle de 4 500 m3/an était
Il doit surtout être capable de préciser le normale. En effet : 4 500m3/an / 250 employés
volume d’eau consommé par chacun des usages TXL WUDYDLOOHQW HQYLURQ  M SDU DQ   O 
répertorié (y compris les fuites) et l’adéquation employé et par an, ce qui est effectivement
des équipements correspondants à ce besoin. dans la fourchette des valeurs courantes (30
à 150 l/j/employé). Il souhaitait agir pour la
6L O·pFRQRPH GH ÁX[ QH SDUYLHQW SDV j IDLUH protection des nappes profondes.
une estimation des volumes associés aux
différents postes de consommation ou que Une discussion avec le gestionnaire a conduit à
les diverses données qu’il obtient ne sont pas l’estimation suivante qui paraissait plausible :
FRKpUHQWHV RX QH OXL SDUDLVVHQW SDV ÀDEOHV
des investigations complémentaires, voire une VDQLWDLUHVOMSHUV P3/an
campagne de mesures, doivent être réalisées.
&HOD OXL SHUPHWWUD G·DIÀQHU VD SHUFHSWLRQ GX - cantine : 30 l/repas * 200 repas/jour * 220 j
fonctionnement du site, de pondérer les données P3/an
brutes, et de mieux apprécier les changements à
apporter. - arrosage peu intensif : 3l/m2/j * 150 j * 500 m2
P3 /an
Ce chapitre présente les différentes technologies 2Q UHWURXYH ELHQ OH WRWDO UpHO GH   P3
GLVSRQLEOHVDÀQGHPHQHUjELHQFHWWHFDPSDJQH DQ
de mesures ou de collecte de données
complémentaires, en fonction des éléments Sur la base de ce constat, des appareils hydro
à mesurer, du temps disponible et des moyens économes sur les sanitaires ont été installés, ainsi
ÀQDQFLHUVDOORXpVjFHWWHFDPSDJQH qu’un lave-batterie pour le lavage des plateaux
de repas. Un an plus tard, la consommation
n’avait baissé que de 780 m3/an, alors qu’au
moins 1 100 m3/an d’économie étaient attendus
Remarque : (30% de 3 100 et 15% de 1 320).

$WWHQWLRQ OD UpSDUWLWLRQ ÀQDOH GH OD Mais, après l’installation de compteurs
consommation d’eau globale entre les divers divisionnaires, il s’est avéré que le système
postes de consommation ne doit pas être basée d’arrosage présentait une fuite et qu’en réalité
sur une estimation à base de ratio pour plus d’un ce poste représentait 1 400 m3/an, avec une
des postes. L’utilisation de ratios (y compris fuite de plus de 1 000 m3/an (soit 2 l/min,
l’utilisation du volume dédié à l’arrosage) ne TXL V·LQÀOWUHQW IDFLOHPHQW HW Q·pWDLHQW SDV
GRLWHQHIIHWVHUYLUTX·jYpULÀHUODFRKpUHQFHGH visibles…).
données obtenues sur site.
On pourrait en effet concevoir que l’économe L’économie sur les sanitaires était donc
GHÁX[©FRQVWUXLVHRXVLPXOHªXQHUpSDUWLWLRQ conforme aux attentes (la consommation initiale
de la consommation globale en divers postes de des sanitaires avait était un peu surévaluée, en
consommation qui paraisse tout à fait cohérente… réalité elle atteignait seulement 2 500 m3/an).
mais qui peut être totalement fausse aussi, En revanche, l’achat d’un lave-batterie (6 000 !)
comme le montre le contre-exemple ci-dessous. aurait pu être évité, car la consommation d’eau
initiale pour le lavage des plateaux n’était pas
excessive. C’est la pose de 3 sous-compteurs
(soit 350 !) qui a permis les économies d’eau les
SOXVVLJQLÀFDWLYHV

45
Il faut donc être très prudent vis-à-vis des Nous avons classé ci-après les investigations en
reconstitutions de volumes qui peuvent paraître deux catégories :
ÀDEOHVPDLVTXLQHUHSRVHQWVXUDXFXQHGRQQpH
Dans ce cas, il ne faut pas hésiter à poser - réalisables sans investissement à partir des
quelques sous-compteurs pour se donner le équipements en place, ou d’appareils simples
temps de valider certaines suppositions (coût à manipuler (et à moins de 30!),
unitaire : environ 30! pièce sur du Ø15 au plus,
compter environ 100! posé, ce qui - réalisables avec des moyens plus importants
correspond au prix d’environ (plus de 2 000!).
35m3 d’eau). Dans le
futur, ils permettront
Astuce ! une détection plus IV.3. INVESTIGATIONS OU MESURES RÉALISÉES SANS
rapide des fuites, INVESTISSEMENT
Dans le cas de l’exemple, et une meilleure
une simple relève le soir optimisation du (coût
puis le matin suivant aurait de) fonctionnement IV.3.1. ENTRETIEN AVEC LES GESTIONNAIRES OU
permis de mettre en des équipements. UTILISATEURS AU QUOTIDIEN
évidence la fuite.
Dans le cas où la personne qui réalise l’analyse
des consommations d’eau n’est pas directement
son gestionnaire au quotidien, un entretien
IV.2. NATURE DES INFORMATIONS COMPLÉMENTAIRES approfondi avec une personne ayant une
connaissance de terrain du site ainsi qu’une
À RECHERCHER
vision globale du fonctionnement de celui-ci est
largement conseillé. Cet entretien peut être
Les informations complémentaires à rechercher
UpDOLVpDXFRXUVGHODYLVLWHVLO·pFRQRPHGHÁX[
GRLYHQW SHUPHWWUH GH PLHX[ TXDQWLÀHU OHV
HVWDFFRPSDJQpG·XQHSHUVRQQHDXSURÀOUHTXLV
volumes utilisés. Il peut s’agir :
soit (et ce sera la meilleure solution pour un site
étendu) après la visite, une fois que l’économe
- d’un recueil de données de fonctionnement :
GH ÁX[ DXUD SX SUHQGUH XQ WHPSV GH PLVH HQ
‡ DXSUqV GHV XWLOLVDWHXUV IUpTXHQFH ordre de ses notes.
d’utilisation, temps de fonctionnement…) ;
‡ DXSUqV GHV IDEULFDQWV RX LQVWDOODWHXUV L’objectif de cet entretien est de parvenir
(ou de la notice d’installation) : on à obtenir un maximum de données sur le
recherche les caractéristiques théoriques fonctionnement des appareils. Il peut s’agir
de fonctionnement (débit de pompe, d’un échange de données écrites (carnet de
programmation d’un système d’arrosage…) ; relevé du fonctionnement d’un équipement,
relevé de compteurs, notice de fonctionnement
- d’une campagne de mesures. Dans ce cas, ou de programmation…) ou orales connues de
les trois types d’informations qui peuvent l’interlocuteur (le nettoyage ou l’arrosage se
être mesurées sont : font de telle heure à telle heure, avec un débit
‡ OD SUHVVLRQ GH O·HDX  HOOH LQÁXH d’autant, qui est connu car il a été mesuré ou que
directement sur les débits des équipements l’installateur l’a précisé à telle occasion…).
(robinets…) et les éventuelles fuites. Une
SUHVVLRQ GH  j  EDUV HVW VXIÀVDQWH HW IV.3.2. RELEVÉS DE COMPTEURS SUR DES PÉRIODES
au-delà de 4 bars il est recommandé de la PARTICULIÈRES
réduire, sauf pour des usages particuliers
ou des immeubles de grande hauteur ; Chaque compteur, même s’il n’est pas relevé
‡ OH GpELW GH O·HDX j XQ SRLQW GRQQp régulièrement par l’usager, est une source
de l’installation (pour préciser le potentielle d’informations complémentaires. En
débit instantané des équipements de effet un certain nombre d’usages ont lieu dans
robinetterie, de nettoyage ou d’arrosage), XQHSODJHKRUDLUHGpÀQLHHWGHVUHOHYpVVLPSOHV
et surtout le cumul sur une journée qui à des périodes données peuvent permettre de
fournit le volume journalier consommé cerner certaines consommations.
(pour préciser le volume lié au poste de
consommation. Attention, la période &LWRQVjWLWUHG·H[HPSOH
de mesures doit être représentative de
l’année) ; - les fuites : un relevé le soir après l’arrêt
‡ OD IUpTXHQWDWLRQ GHV pTXLSHPHQWV des activités et un relevé le lendemain matin
(comptage des usagers). avant la reprise d’activités permettent de
mettre en évidence des consommations liées
à des fuites. Il est néanmoins important
G·DQDO\VHU ÀQHPHQW FHV UpVXOWDWV LO SHXW
rester des consommations hors activités du
site : équipes de nettoyage, veilleurs de nuit,
refroidissement de machines…
46
- un relevé peut également être fait à certaines ,9'pELWPqWUHjOHFWXUHGLUHFWHSRXU
plages horaires ou périodes données pour cibler ODYDERRXGRXFKH
un usage particulier (arrosage notamment, ou
activité n’ayant pas lieu le week-end…).

IV.3.3. ANALYSE DE LA PROGRAMMATION DES SYSTÈMES


D’ARROSAGE
Illustration N°10 :
L’accès aux données des programmateurs des Débitmètre à lecture directe (Source : Sider)

systèmes d’arrosage (voire des centrales de


programmation à distance) n’est pas toujours Le débitmètre sert à mesurer le débit en sortie
aisé ou accessible à une personne non formée de robinet. L’appareil, gradué, permet de donner
à ce domaine particulier. Il peut être nécessaire instantanément une valeur du débit en sortie de
de se rapprocher du technicien de maintenance point de puisage et donc de savoir si l’équipement
ou de la société qui a installé le système pour en en place est économe ou pas. Il se place sous
connaître le détail de fonctionnement. le jet d’eau, et comporte un petit seuil calibré
à l’intérieur. Ainsi, le niveau d’eau se stabilise
IV.3.4. MESURES PONCTUELLES À L’AIDE D’APPAREILS à une hauteur donnée, correspondant au débit
COURANTS
d’écoulement. Une échelle de graduation permet
de lire directement le débit correspondant en
,96HDXHWFKURQRPqWUH fonction de la hauteur d’eau atteinte.

L’utilisation du seau gradué avec un chronomètre Un robinet classique NF devrait fournir 12 l/


permet avec une précision perfectible de min sous 3 bars, et une douche 15 l/min. Les
déterminer le débit en sortie de robinet. robinets hydroéconomes fournissent un débit
Cette méthode « grossière » présente au moins de 6 l/min (cas général), allant de 3 l/min
l’avantage de pouvoir déceler la présence d’un (lavage des mains des enfants) à 8 l/min (en cas
débit élevé avec un investissement modeste. de chauffe eau instantané pour permettre son
déclenchement). Les douches hydroéconomes
,90DQRPqWUH délivrent en général 8 à 10 l/min (pas moins,
pour préserver le confort).
La pression peut être mesurée en utilisant un
manomètre manuel à lecture directe et qui IV.3.5. INVESTIGATIONS OU MESURES PLUS POUSSÉES
sera positionné en sortie de robinet. Le coût AVEC DES INVESTISSEMENTS PLUS IMPORTANTS
d’un tel équipement avoisine les 30/50 !. Une
pression supérieure à 4 bars est synonyme de ,9 3RVH GH FRPSWHXUV G·HDX
surpression. GLYLVLRQQDLUHV

La pose de compteur d’eau intermédiaire pour


connaître le volume d’eau consommé par un
bâtiment ou un usage particulier est souvent une
aide très précieuse. Un compteur d’eau classique
Illustration N°9 : (canalisation de diamètre inférieur à 15 mm) a
manomètre à lecture directe (Source Sider) un coût d’environ 30 !HT. Pose comprise, il faut
compter environ le double, voire au maximum
100 ! dans des endroits peu accessibles.
Il existe aussi, plus rarement, des appareils
À[HVLQVWDOOpVVXUXQSLTXDJHVXUODFDQDOLVDWLRQ
principale ; la valeur de la pression sera donnée - le prix d’un compteur est beaucoup plus
par simple lecture du cadran. élevé dès que la diamètre de la canalisation
augmente
(QÀQRQSHXWDXVVLGpWHFWHUXQHVXUSUHVVLRQj - s’il est nécessaire de réaliser un regard
l’aide d’une mesure de débit. En effet, le débit extérieur pour poser le compteur, le coût est
de référence en sortie des robinets (norme NF) plus élevé : préférer une installation sur une
DOLPHQWDQW OHV ODYDERV HVW À[p j  OPLQXWH conduite interne.
sous 3 bars, pour les douches ce dernier se situe - Pour obtenir des informations utilisables pour
autour de 15 l/minute. Sur un robinet NF, un débit déterminer le volume consommé par un poste de
supérieur aux valeurs de référence énoncées ci- FRQVRPPDWLRQLOIDXWSUHQGUHJDUGHGHYpULÀHU
GHVVXVVLJQLÀHODSUpVHQFHG·XQHSUHVVLRQpOHYpH la représentativité de la période de relève. Il est
à l’origine de consommations importantes avec préférable de disposer de plusieurs relèves sur
des équipements standard. une période assez longue.

47
principaux types de compteurs
Astuce ! en place).
Au-delà du contexte de - pour les autres, de louer
bilan des consommations, on ce matériel, ou de faire
considère qu’il est souhaitable appel ponctuellement à
Illustration N°11 : de relever les compteurs tous les un prestataire de service
compteurs d’eau (Source Sider) PRLVSRXUXQVXLYLHIÀFDFH(WLO (distributeur de compteurs
faut alors environ une année de d’eau, bureau d’études
données pour pouvoir noter les ou exploitant des réseau
,9 0HVXUH GH GpELW variations qui pourraient d’eau potable).
SRQFWXHOOH révéler des fuites.

,9 (QUHJLVWUHPHQW VXU XQH


Le suivi d’un compteur pendant
SpULRGHGRQQpHGXGpELWVXUXQFRPSWHXU
une semaine et l’analyse des données
G·HDXH[LVWDQW
revient à environ 1 000 ! pour une prestation
unique. Le prix unitaire diminue beaucoup en
Il est possible d’équiper les compteurs les plus
cas de prestations multiples ou récurrentes.
récents d’une tête émettrice ou compteur
Certains exploitants de réseau d’eau potable
d’impulsions. Elle envoie par impulsions les
proposent aussi cette prestation à titre gratuit
données relevées (date et heure et index du
ou à un prix très réduit. Sinon, le prix de
compteur) au niveau d’un boîtier d’acquisition
location du matériel est d’environ 70 à 100!
de données. Une fois les informations récupérées
par semaine, auquel il faut ajouter l’achat de la
(directement sur place avec un ordinateur
tête émettrice (30 ! environ) et du logiciel (voir
portable ou transmises par radio ou autre),
le prestataire, par exemple HYDREKA). Pour
l’exploitation des données pourra être faite sur
l’achat du matériel (un enregistreur, un logiciel
un ordinateur. Les données ainsi enregistrées
d’exploitation et quelques têtes émettrices), il
pourront alors être exprimées en valeurs de
faut compter d’environ 1 500 !. Cette dernière
débit.
formule est donc conseillée pour un patrimoine
important, avec un parc de compteurs peu
GLYHUVLÀpHWVLXQPHPEUHGXSHUVRQQHOHVWSUrW
à s’investir dans la formation au logiciel et aux
mesures de terrain.

,9'pELWPqWUHjXOWUDVRQV
Illustration N°12 :
Têtes émettrices (Source Sappel)
Les débitmètres à temps de transit exploitent
le temps mis par une onde ultrasonore pour
Pour l’équipement en tête émettrice, voici traverser la canalisation pour déterminer la
quelques éléments d’information pour les YLWHVVH G·pFRXOHPHQW G·XQ ÁXLGH GDQV XQH
marques les plus courantes : conduite fermée. Les impulsions ultrasonores
VRQW pPLVHV GLDJRQDOHPHQW j O·D[H GX ÁX[ SDU
- marque ACTARIS (anciennement GHX[ WUDQVGXFWHXUV À[pV HQ GLUHFWLRQ DYDO HW
Schlumberger) : le compteur est équipable HQGLUHFWLRQDPRQW,OVVHÀ[HQWSDUVHUUDJHVXU
si son N° de série commence par un numéro l’extérieur de la conduite fermée ou canalisation,
supérieur à 97 (97, 98, 99, 00, 01, 02…), et peuvent être utilisés sur des diamètres Ø15
ou Ø30 (selon les fabricants) à Ø800 (en mm).
- marque SAPPEL : le compteur est équipable
si le N° de série commence par 90 ou plus. Le débitmètre à ultrasons doit être installé :

Sinon, prenez directement contact avec le - sur un tronçon de la canalisation qui


distributeur et/ou fabricant (SENSUS, AVENSYS, présente une section uniforme et qui,
SOCAM, WATEAU, KENT, FARNIER, ZENNER…), ou en amont de l’appareil, est droit sur une
envoyer un mail à la société DISTEC (distec@ distance égale à au moins 10 fois le diamètre
distec.fr), qui commercialise des dispositifs de la canalisation et, en aval de celui-ci, sur
d’alarme ou de coupure d’eau en cas de fuite une distance minimale de 3 fois le diamètre,
et qui pourra vous répondre dans la plupart des
cas. - dans un endroit exempt de turbulences
générées par la présence de raccords,
Pour réaliser ce type de mesure, il est possible : pompes, robinets, vannes…,

- pour les gestionnaires d’un parc important de - sur une canalisation faite d’un matériau
compteurs, d’acheter le matériel nécessaire approprié en évitant les matériaux poreux
(centrale d’acquisition de données, et un lot de tels que le béton, ou revêtus (fonte…).
quelques têtes émettrices correspondant aux

48
La présence de bulles d’air, de particules Les sondes à insertion évaluent le débit dans
VROLGHV GDQV OH ÁXLGH YRLUHG·XQ UHYrWHPHQW la canalisation sur la base d’une mesure de
interne, peut atténuer le signal ultrasonore, débit ponctuelle dans la section d’écoulement
de même qu’un revêtement interne de la (principe de la Loi de Faraday). Elle peuvent
canalisation. être utilisées sur des diamètres Ø80 à Ø2000,
quel que soit le matériau.
1%LOIDXWSHQVHUj
Ce type d’appareil permet comme le précédent,
 SRVLWLRQQHU OHV VRQGHV VXU XQH FDQDOLVDWLRQ une mesure bidirectionnelle, de l’ordre de
GXUpVHDXTXLSHXWrWUHLVROpH URELQHWYDQQH  0.2m/s à quelques m/s. Sa location pour une
DÀQ GH SRXYRLU SURFpGHU j O·pWDORQQDJH GH semaine revient également à environ 400!.
O·DSSDUHLO RQIDLWOH©]pURªjGpELWQXO 
1%SHQVHUjYpULÀHUOHGLDPqWUHLQWHUQHGHOD
YpULÀHUUpJXOLqUHPHQWOHERQIRQFWLRQQHPHQW FDQDOLVDWLRQDYHFXQHMDXJHDGDSWpH YDULDEOH
GHO·DSSDUHLOHQSDUWLFXOLHUVLRQVHWURXYHj VHORQOHUHYrWHPHQWHWO·HQWDUWUDJHGHIDoRQ
SUR[LPLWp GH SRPSHV RX GDQV XQH ]RQH GH jELHQSRVLWLRQQHUOHFDSWHXU 
YLEUDWLRQV FHOOHVFLGpVROLGDULVHQWOHVFDSWHXUV
GHODFDQDOLVDWLRQUHPHWWUHXQSHXGHÁXLGH
HW UHVVHUUHU O·DSSDUHLO VXIÀW HQ JpQpUDO j ,9&RPSWDJHGHODIUpTXHQWDWLRQ
UHODQFHUOHVPHVXUHV 
L’utilisation d’un compteur de fréquentation
associé à un ensemble « cellule photoélectrique/
UpÁHFWHXU ª SHUPHW GH GpWHUPLQHU OD
fréquentation d’un site donné. En connaissant la
consommation en eau de ce dernier, il est possible
de déterminer un ratio qu’il sera alors possible
de comparer à une valeur de référence.
Illustration N°13 :
Sonde positionnée sur une canalisation
(Source CREAQ)

Illustration N°16 :
Cellule photoélectrique (Source : CREAQ)

Illustration N°14 :
Débitmètre à ultrason DigiSonic (Source CREAQ)

La location de ce type d’appareil revient à


environ 400! pour une semaine, hors logiciel.
Illustration N°17 :
,9 0HVXUH GH GpELW SDU VRQGH 5pÁHFWHXU 6RXUFH&5($4
pOHFWURPDJQpWLTXHjLQVHUWLRQ

La mise en œuvre de cette technique est IV.3.6. DÉFINITION DE LA CAMPAGNE DE MESURES


évoquée, mais elle sera plus rarement réalisée, ADAPTÉE
car elle nécessite une prise en charge (pour
pouvoir introduire la sonde à l’intérieur de la Le choix du matériel dépendra de plusieurs
conduite). paramètres :

- les données recherchées (volume, débit,


pression, fuite, fréquentation)
- le budget prévu pour la campagne de
mesures
- la priorité au niveau des données
manquantes
- la précision d’information nécessaire
- le temps de pose
Illustration N°15 : - le temps de formation du personnel à
Sonde à insertion (source Hydreka) la maîtrise de l’appareil de mesures et à
l’exploitation des données recueillies.

49
Le tableau ci-dessous recense pour chacun des
objectifs recherchés le (ou les) appareil(s) de
mesures le(s) mieux adapté(s) :

Recueil et
Appareil de Objectif Précision des
exploitation des Investissement Remarques
mesures recherché résultats
données
Débitmètre à Mesure débit lecture
< 50! + -
lecture directe (0.5 à 25l/min) instantanée
Seau gradué+ Mesure débit (0.5 lecture directe
< 50! approximative -
chronomètre à 25l/min) approximative
++
appareil indique
- lecture directe des mesures
Manomètre Mesure pression + -
- à mémoire fausses si limite
de pression
dépassée une fois
Mesures 50! à 200! pour
ponctuelles de ++
compteur Ø15,
volume et débit recherche de
Compteur lecture directe posé -
fuite délicate si
Recherche de coût augmente
activité 24h/24
fuites vite avec le Ø
Compteur avec Mesure en
< 200 ! si
tête émettrice continu de Enregistrée +++ Formation
ponctuel
et centrale volume et débit, sur une base permet une conseillée pour
(1 semaine)
d’acquisition (ou de données DQDO\VHÀQHGHV l’exploitation des
Recherche de > 1000 ! si long
transmission des informatiques consommations données
fuites terme
données)
Mesure en Formation
continu de obligatoire pour
volume et débit Enregistrée +++ l’utilisation de
Débitmètre à sur une base permet une l’appareil et
+++
ultrasons de données DQDO\VHÀQHGHV l’exploitation des
Recherche de informatiques consommations données
fuites sur Ø15 à Ø800,
non revêtu
Mesure en Formation
continu de obligatoire pour
volume et débit l’utilisation de
Enregistrée +++ l’appareil et
sur une base permet une l’exploitation des
Sonde à insertion +++
de données DQDO\VHÀQHGHV données
Recherche de informatiques consommations sur Ø80 à Ø2000,
fuites prise en charge
nécessaire

Intervention d’un
Compteur de Comptage des Enregistrement
++ +++ électricien pour la
fréquentation usagers mécanique
pause

Tableau N°4 :
Appareils de mesures adaptés à la recherche de différentes informations et à différents contextes

$ÀQ GH QH SDV V·pFDUWHU GH O·HQYHORSSH (Q WRXW pWDW GH FDXVH HW H[FHSWp SRXU OHV
budgétaire allouée à la campagne de mesures, PHVXUHVSRQFWXHOOHVLOIDXGUDSUpYRLUXQVXLYL
il ne faut pas oublier de tenir compte du taux GHVGLVSRVLWLIVGHPHVXUHVPLVHQSODFHRXXQ
horaire du professionnel qui posera le matériel, SODQQLQJ G·XWLOLVDWLRQ GX PDWpULHO GH PHVXUH
ainsi que le coût généré par le technicien qui DFKHWp/HVGRQQpHVFROOHFWpHVGHYURQWDXVVL
effectuera les mesures puis l’exploitation des rWUHWUDLWpHVV\VWpPDWLTXHPHQWO·LGpDOpWDQW
données. GH SUpYRLU XQ GLVSRVLWLI G·DOHUWH HQ FDV GH
GpSDVVHPHQWG·XQVHXLOG·DOHUWH

50
V. Exploitation des données

L’objectif de l’exploitation des données est de manière linéaire dans ce document mais en
SDUYHQLUjSUpFLVHUGHIDoRQÀDEOH fait un processus itératif pourra s’établir pour
les sites complexes, jusqu’à l’obtention d’un
- pour chaque ressource en eau (en distinguant tableau entrées/sorties satisfaisant :
chaque point d’entrée) et pour chaque site (si
plusieurs sont étudiés) ; et il est rappelé le Collecte des données
conseil de faire un bilan sur le périmètre le
plus large possible, l’idéal étant l’ensemble
du périmètre d’un même maître d’ouvrage, Tableau entrées/sorties
(N°1), puis N°2

- la répartition du volume annuel consommé


en différents postes de consommation, Détection
d’incohérence

- l’adéquation ou non du matériel de


fourniture d’eau existant pour permettre une collecte complémentaire
(éventuellement mesures)
consommation optimisée (et s’il n’est pas
adapté, les contraintes de fonctionnement à
prendre en compte pour le choix d’un éventuel
$ FH VWDGH GH O·pWXGH O·pFRQRPH GH ÁX[ YD
futur matériel économe en eau).
SRXYRLUpWDEOLUOHWDEOHDXGHVHQWUpHVVRUWLHV
G·HDX VXU OH VLWH &HWWH pWDSH FRQVWLWXH OD
FKDUQLqUHHQWUH
V.1. ELABORATION DU TABLEAU ENTRÉES/SORTIES DES
CONSOMMATIONS D’EAU  OD SUHPLqUH SDUWLH GH O·pWXGH 
FDUDFWpULVDWLRQGHVFRQVRPPDWLRQVGXVLWH
L’ensemble des données collectées doit être SDUXVDJH
mis en forme pour établir un tableau entrées/
sorties des consommations d’eau du site. Ce  HW OD GHX[LqPH SDUWLH  VROXWLRQV
tableau entrées/sorties est l’outil indispensable G·pFRQRPLHVHWGHVXEVWLWXWLRQ
à toute étude d’économie et de substitution.
La cohérence des valeurs de ce tableau permet 6DQVO·pWDEOLVVHPHQWULJRXUHX[GHFHWDEOHDX
G·LGHQWLÀHU OHV LQFRKpUHQFHV GDQV OHV UHOHYpV ODGHX[LqPHSDUWLHQHSRXUUDSDVrWUHUpDOLVpH
de données. La méthodologie est présentée de GHPDQLqUHHIÀFDFHHWÀDEOH

([HPSOH 1ƒ   7DEOHDX HQWUpHV  VRUWLHV SRXU XQ LPPHXEOH GH EXUHDX[ HPSOR\DQW 
SHUVRQQHV
8VDJH (TXLSHPHQW
5HVVRXUFH $GpTXDWLRQDX
1DWXUH 9ROXPHXWLOLVp 'HVFULSWLI 8WLOLVDWLRQ
EHVRLQ
8 WC 3/6 l intensive Adapté
par déduction : 4 lavabos, robinets mitigeurs
intensive Inadapté
sanitaires 898 m3/an, cohérent sans aérateurs
(42 l/j/employé)
1 douche, à douchette non
faible Peu adapté
économique
eau potable nettoyage du hall (50 m2) à la 6 seaux
conso nettoyage 8l*6*50 semaines
serpillière, et des sanitaires à d’eau 2 fois / Adapté
totale intérieur P3/an
l’éponge semaine
P3/
an 20l/min*30min toutes les Inadapté car
nettoyage
*50 semaines au jet, à 20 l/min semaines, non nécessaire
extérieur
P3/an 30 minutes

10 l/m2/h * 20 min arbustes 100 m2 20 min/j de Inadapté


arrosage * 100 m2 M  arrosage par aspersion, à 10 mai à goutte à goutte
m3/an mm/h2 septembre préférable

2 relevés soir/matin pendant la


fuites 0 m3/an
phase d’analyse
51
V.2. VÉRIFICATION DE LA COHÉRENCE DU TABLEAU
3RXU XQ LPSRUWDQW SDWULPRLQH HW XQ WRWDO
Ce paragraphe correspond à une éventuelle JpQpUDO GH FRQVRPPDWLRQ  VL HQ  YRXV
itération dans le processus d’analyse, décrite en GHPDQGH] j XQ H[SORLWDQW GH UpVHDX G·HDX
introduction. SRWDEOH GHV GRQQpHV  RX DXWUH  HOOHV
ULVTXHQW G·rWUH LQFRPSOqWHV HW OHXU WRWDO
/D YpULÀFDWLRQ GHV GRQQpHV UHFXHLOOLHV HVW QH FRUUHVSRQGUD SDV DX WRWDO TXL DXUDLW pWp
fondamentale avant de poursuivre. De leur IDLW HQ  (Q HIIHW O·H[SORLWDQW pFUDVH
ÀDELOLWp HW GH OHXU ERQQH UHSUpVHQWDWLYLWp JpQpUDOHPHQWOHVGRQQpHVDXIXUHWjPHVXUH
GpSHQGURQWHQHIIHWODTXDOLWpHWO·HIÀFDFLWpGX HW LO QH VHUD FDSDEOH GH IRXUQLU HQ 
programme d’action. TXH OHV FRQVRPPDWLRQV  GHV FOLHQWV TXL
H[LVWHQWWRXMRXUVHQ
V.2.1. VÉRIFICATION DE L’ABSENCE DE FUITE

Les fuites constituent la première chose à V.2.4. COMPARAISON DES SITES OU ÉTABLISSEMENTS
YpULÀHUVLRQSDUYLHQWDXÀQDOjXQHLQFRKpUHQFH
dans l’addition des volumes consommés par ENTRE EUX
les différents usages et le total facturé (ou
mesuré). La comparaison de la consommation d’eau
de sites, bâtiments ou espaces verts entre
(Q FDV GH IXLWH RQ SHXW LPPpGLDWHPHQW eux est largement conseillée par rapport à
SDVVHU DX SDUDJUDSKH 9,  © UHFKHUFKHV GH OD FRPSDUDLVRQ j GHV UDWLRV SRXU YpULÀHU OD
IXLWHV ª ,O Q·HVW HQ HIIHW SDV QpFHVVDLUH GH cohérence d’une donnée. En effet, on compare
WHUPLQHU O·DQDO\VH SRXU SUHQGUH OHV PHVXUHV dans ce cas des consommations sur lesquelles on
QpFHVVDLUHVHWVWRSSHUFHWWHIXLWH a des informations (notion de la fréquentation,
GH D VXSHUÀFLH«  PrPH VL RQ QH JqUH SDV
directement les sites concernés. Alors que les
ratios ne sont des moyennes, avec parfois des
V.2.2. VÉRIFICATION DE LA COHÉRENCE DES PÉRIODES écarts-types très importants ; ils ont parfois
DE RELÈVE DXVVLpWppWDEOLVGDQVGHVFRQWH[WHVVSpFLÀTXHV
non transposables, et méconnus.
Il est fréquent que les périodes de relève des
compteurs ne soient pas homogènes (13 mois, &HWWH PpWKRGH DX GHOj GH OD YpULÀFDWLRQ GH
voire 14 entre 2 relèves au lieu de 12). Si les cohérence, est aussi utile pour l’établissement
volumes dédiés à certains usages, voire les d’un programme d’actions. La comparaison des
compteurs généraux, ont été évalués à partir consommations d’eau de plusieurs sites de même
de relèves de compteurs divisionnaires, penser type, ramenée à une grandeur caractéristique,
jYpULÀHUOHVSpULRGHVGHUHOqYHVHWVLQpFHVVDLUH permet de mettre en évidence les consommations
à les annualiser YRLUPpWKRGHG·DQQXDOLVDWLRQ anormales (fuite,…) ou élevées, sur lesquelles
VXU OH VLWH ZZZVPHJUHJRUJ HW YRLU VLWH GH les actions seront les plus démonstratives. Elle
WpOpGpFODUDWLRQGHVSUpOqYHPHQWVSRXUO·HDX est réalisable dès lors que le nombre de sites
SRWDEOH HQ *LURQGH KWWSZZZJLURQGH étudié est important (commune, chaîne ou
SUHIJRXYIUGHPDUFKHVFROOHFWLYLWHVWKHPB fédération d’établissements,…).
FROOHFWLYLWHVKWPO .
Ainsi par exemple, il est très instructif d’évaluer
V.2.3. RECHERCHE DE CONSOMMATIONS ANNUELLES la consommation d’eau et de hiérarchiser les
ANTÉRIEURES COMPLÉMENTAIRES sites en fonction de leurs caractéristiques,
fréquentation, … :
On conseille la plupart du temps de rechercher des
données de consommation sur au moins 3 années - nombre d’emplacements ou nombre de
antérieures. Cependant, il est possible que cela nuitées dans un ensemble de campings,
QH VXIÀVH SDV SRXU GpWHUPLQHU XQH PR\HQQH
représentative. Par exemple, pour l’arrosage : - nombre de chambres ou nombre de nuitées
2003 a été caniculaire avec des consommations dans un ensemble d’hôtels,
importantes, au cours de l’été 2005 il y a eu en
Gironde une interdiction d’arroser, et août 2006 - m2 arrosés, avec deux catégories
a été particulièrement pluvieux. (entraînement et honneur) par ensemble de
stades,
En cas de doute, et en particulier de variations
importantes dans les données, il faut rechercher - nombre de classe ou d’élèves dans un
d’autres consommations antérieures. ensemble d’écoles,….

Il est plus facile de s’interroger en procédant


par comparaison : pourquoi cet hôtel consomme
beaucoup plus que les autres (il a une blanchisserie

52
interne, un restaurant très fréquenté, un parc
arrosé… ou aucune particularité). Pourquoi ce $9(57,66(0(17
stade, alors qu’il n’est qu’un terrain d’honneur
peu utilisé, argileux, nécessite-t-il plus /D FRPSDUDLVRQ j FHV UDWLRV SHUPHW G·XQH
d’arrosage que cet autre stade d’honneur, plus SDUW GH VH VLWXHU JOREDOHPHQW SDU UDSSRUW
fréquenté et sableux ? DX[ pWDEOLVVHPHQWV VLPLODLUHV G·DXWUH SDUW
G·DSSRUWHUGHVLQIRUPDWLRQVFRPSOpPHQWDLUHV
Les consommations les plus faibles peuvent SHUPHWWDQWODUpSDUWLWLRQGHVFRQVRPPDWLRQV
aussi mettre en évidence des modes de gestion SDU XVDJH 1pDQPRLQV LO HVW QpFHVVDLUH GH
intéressants à reproduire ailleurs. Par exemple IDLUHOHVPLVHVHQJDUGHVXLYDQWHVFRQFHUQDQW
pour des stades ou espaces verts, certains O·XWLOLVDWLRQGHVUDWLRV
nécessitent beaucoup moins d’eau alors qu’ils
ne sont pas particulièrement moins utilisés ou  OHV pWXGHV VXU OHV FRQVRPPDWLRQV G·HDX
SOXVDUJLOHX[/DPrPHGRVHG·DUURVDJHVXIÀUDLW VRQW HQFRUH SHX QRPEUHXVHV HW SHX GH
peut-être ailleurs ? YDOHXUV GH UDWLRV VRQW GLVSRQLEOHV RQ
UHWURXYH HQ IDLW XQ FHUWDLQ QRPEUH GH
La comparaison des consommations, pour être YDOHXUVTXLVRQWUHSULVHVG·XQHSXEOLFDWLRQ
pertinente, doit se faire sur plusieurs années, en jXQHDXWUHFHWWHUpSpWLWLRQQHFRQVWLWXH
particulier pour des sites arrosés ou à activité SDVXQHYDOLGDWLRQ/HVUDWLRVGRLYHQWrWUH
variable. Pour ces sites, les consommations FRQVLGpUpV FRPPH GHV LQGLFDWLRQV GDQV
élevées peuvent aussi apporter des éléments O·DWWHQWH GH OD SXEOLFDWLRQ G·pWXGHV SOXV
d’analyse intéressants : que s’est-il passé en 2006 V\VWpPDWLTXHVSDUVHFWHXUVHWSDUXVDJHV
pour que la consommation d’eau soit si élevée ? Il
y a eu un incident. Celui-ci peut-il se reproduire  OHV FRQVRPPDWLRQV DFWXHOOHV GHV
ou s’est-on donné les moyens de pouvoir l’éviter EkWLPHQWV WHUWLDLUHV QH VRQW SRXU OD
à l’avenir (compteur divisionnaires ou de SOXSDUW SDV RSWLPLVpHV (Q FRQVpTXHQFH
vanne automatique de coupure d’eau ; pompe VH VLWXHU GDQV XQH PR\HQQH YRLUH PrPH
de secours sur une ressource de substitution, GDQV OH EDV GH OD IRXUFKHWWH QH VDXUDLW
procédure de contrôle fréquent de trop-plein …) ? rWUH XQH UDLVRQ VXIÀVDQWH SRXU QH SDV
PHQHUGDQVVRQpWDEOLVVHPHQWXQHDQDO\VH
GHV FRQVRPPDWLRQV HW XQH SROLWLTXH GH
V.2.5. COMPARAISON À DES RATIOS UpGXFWLRQGHVFRQVRPPDWLRQV

V.2.5.1. DÉTERMINER LES RATIOS PERTINENTS PAR


USAGE
V.2.5.2 TABLEAU DE VALEURS DE RATIOS DISPONIBLES
(VOIR ANNEXE)
Deux types de ratios existent :

- des ratios globaux par établissement : ils $WWHQWLRQ GHV UDWLRV QH GRLYHQW rWUH XWLOLVpV
sont exprimés en consommations annuelles TXH SRXU FRPSOpWHU GHV LQIRUPDWLRQV VL
par salarié, par m2 ou autre. Il est nécessaire DXFXQH DXWUH VROXWLRQ SUpVHQWpH FLGHVVXV
de s’assurer que les usages sont les mêmes Q·HVWSRVVLEOH'DQVWRXVOHVFDVLOQHIDXWSDV
pour faire un comparatif. Par exemple pour XWLOLVHUGHUDWLRVSRXUTXDQWLÀHUSOXVG·XQXVDJH
les bureaux, l’usage sanitaire est toujours YRLU H[HPSOH GH PDXYDLVH LQWHUSUpWDWLRQ DX
présent, il n’en est pas de même de la ,,, 
restauration, d’une éventuelle consommation
d’eau de climatisation, de la présence ou (QHIIHWXQUDWLRQHGRQQHSDVODFRQVRPPDWLRQ
non de visiteurs en plus des salariés…Cela UpHOOHLOSHUPHWVHXOHPHQWGHO·DSSUpFLHU
explique la grande amplitude entre les ratios
disponibles (1 à 5).
Et il n’existe à ce jour pas de bases de
- des ratios par usage exprimés en GRQQpHV DVVH] ÀDEOH FRPPH OH PRQWUH O·pWXGH
consommation par unité d’usage (litres par « la consommation d’eau des ménages en
repas, par utilisation unitaire de sanitaire, par France : Etat des lieux» (Marielle MONTJINOUL
m2 nettoyé, par m2 arrosé,…). Ces ratios sont CEMAGREF/ENGEES juin 2002) qui avait pour
plus précis, mais le nombre d’unité d’usages objet de recenser l’ensemble des publications
est parfois délicat à appréhender. sur le sujet et d’en comparer les valeurs citées.
L’auteur constate :

- une très grande disparité dans les valeurs


citées,

- l’absence de source ou d’étude statistique


pour des valeurs néanmoins couramment
utilisées.
53
Il faut noter que cette étude cite un chiffre de et avec climatisation fait apparaître une
consommation par habitant de 150 à 225 litres consommation de 102 litres/jour/employé au
/ jour.habitant incluant les usages domestiques, total (soit 22 m3/an/employé), se répartissant
professionnels et publics dont 120 litres / jour. de la façon suivante :
habitant pour les usages domestiques. Ce chiffre ‡  OLWUHVMRXUHPSOR\p SRXU OHV
moyen est cohérent avec les consommations bureaux,
constatées en Gironde. ‡  OLWUHVMRXU HPSOR\p SRXU OD
climatisation (* sur 365j/an)
/HWDEOHDXMRLQWHQDQQH[HGRQQHOHVSULQFLSDX[ ‡HWOLWUHVSDUUHSDV
UDWLRV FRQQXV j FH MRXU DYHF GHV UHPDUTXHV
TXL VRQW GHVWLQpHV j SHUPHWWUH G·DSSUpFLHU - un site de bureaux de 2 000 personnes,
OHXUDPSOLWXGHRXOHXUGRPDLQHG·HPSORL prenant en grande partie leurs repas sur
place, avec très peu d’arrosage, une
V.2.5.3 CAS PARTICULIER DES CONSOMMATIONS DES climatisation air/air, et recevant très peu de
public, a une consommation d’eau totale de
BUREAUX
63 litres/jour/employé, soit environ 14 m3/
an/employé ;
Nous avons souhaité apprécier les données très
variables pour les consommations de bureau
- un site de bureau employant 1 500
(30 à 150 l/j/employé) sur la base d’exemples
personnes et recevant beaucoup de public
FRQFUHWV&HWWHUHFKHUFKHDSHUPLVGHFRQÀUPHU
(à peu près autant que d’employés),
OHVGLIÀFXOWpVVXLYDQWHV
comportant une crèche, un restaurant et
une climatisation (tour de rafraîchissement)
 G·XQH SDUW OD GLIÀFXOWp G·REWHQLU GHV
a une consommation globale correspondant
gestionnaires de sites les valeurs des unités
à 92 litres/jour/employé (soit 15 m3/an/
de mesures des ratios (nombres d’occupants,
employé), se répartissant comme suit :
nombres de repas servis, m2 arrosés…).
‡UHVWDXUDWLRQHWFUqFKHOLWUHVMRXU
Contrairement à ce que l’on pourrait
employé ;
SHQVHU D SULRUL LO HVW VRXYHQW GLIÀFLOH SRXU
‡FOLPDWLVDWLRQOLWUHVMRXUHPSOR\p
un gestionnaire de connaître le nombre de
‡VDQLWDLUHVOLWUHVMRXUHPSOR\p
salariés et, plus généralement, de personnes
présentes sur son site à un instant donné
- un centre de spectacle et de congrès recevant
(congés, déplacements, RTT, temps partiel,
177 000 visiteurs par an fait apparaître une
visiteurs venant d’autres sites, accueil du
consommation de 42 litres par visiteur ;
public,….),
Les éléments recueillis ne sont pas encore
 G·DXWUH SDUW OD FRQÀUPDWLRQ GH OD JUDQGH
VXIÀVDPPHQW QRPEUHX[ HW GRLYHQW rWUH
disparité des consommations, si on les
complétés, cependant une tendance se dégage
considère globalement (sans préciser les
qui permet d’apprécier les domaines d’utilisation
autres usages que les sanitaires).
des 2 principaux ratios de consommation d’eau
GHV EXUHDX[ TXL ÀJXUHQW GDQV OH OLWWpUDWXUH
([HPSOH 1ƒ  &RQVRPPDWLRQV G·HDX GH
(à savoir 30 litres/jours/employé sans
SOXVLHXUV HQWUHSULVHV RX pWDEOLVVHPHQWV
climatisation et 100 à 150 litres/jour/employé
SXEOLFV©GHEXUHDX[ªJLURQGLQV
avec climatisation) :
- un site de bureaux de 12 personnes, ne
- les ratios précités laissent penser que la
prenant pas leurs repas sur place (sans
climatisation consommerait beaucoup d’eau.
préparation) et recevant un peu de public a
Or tous les systèmes de climatisation ne sont
une consommation d’eau globale de 36 litres/
pas de grands consommateurs d’eau :
jour/employé ;
‡ OHV WRXUV DpURUpIULJpUDQWHV GH SOXV HQ
plus rares du fait de problèmes sanitaires
- un site de bureaux de 47 personnes prenant
liés notamment à la légionellose)
en partie (sans préparation) leurs repas sur
consomment beaucoup (plusieurs milliers
place et recevant un peu de public a une
voire souvent dizaines de milliers de m3/
consommation d’eau globale de 45 litres/
an) : elles sont obligatoirement soumises
jour/employé ;
à autorisation ;
‡ OHV V\VWqPHV DLUDLU FRQVRPPHQW WUqV
- un site de bureaux de 280 personnes dont
peu ;
100 déjeunant sur place, sans arrosage
‡ OHV V\VWqPHV K\EULGHV DLUDLU j OD
et sans climatisation fait apparaître une
base, avec un système de brumisation
consommation de 47 litres/jour/employé
utilisable lors des fortes chaleurs,
pour les bureaux et 15 litres par repas (soit
peuvent ponctuellement consommer
au total en moyenne 11 m3/an/employé);
beaucoup (quelques milliers de m3/mois
très chaud).
- un site de bureaux de 790 personnes
prenant leurs repas sur place, sans arrosage
54
- les petits ensembles de bureaux (<50 - du fait de l’inadéquation des équipements
employés) ont une consommation de l’ordre à l’usage : un équipement mal adapté qui
de 30 à 50 litres/employé/jour (soit environ oblige à laisser l’eau couler sans véritable
6 à 11 m3/an/employé) qui correspond à la intérêt (absence de douchette de rinçage, ou
consommation sanitaire stricte. On est dans le de commande au genou en cuisine ; robinets
haut de la fourchette, voire un peu au-dessus non temporisés pour le lavage des mains en
dès que le travail est salissant ou exige une grand nombre…), ou encore des robinets
hygiène stricte (temps ou nombre journalier régulièrement retrouvés ouverts doivent être
de lavage des mains plus important) ; rapidement remplacés.

- les grands ensembles de bureaux, climatisés, La satisfaction des utilisateurs n’est pas un
UHFHYDQW VLJQLÀFDWLYHPHQW GX SXEOLF DYHF bon critère : un système d’arrosage peut
éventuellement des services associés (crèche, donner toute satisfaction à son utilisateur, mais
restauration…) ou un arrosage extérieur, ont représenter une consommation très importante
une consommation plus élevée de l’ordre HW QRQ RSWLPLVpH  LO HVW LPSpUDWLI GH PRGLÀHU
de 100 litres/jour/personne employée, soit cet équipement.
environ 20 m3/an/employé;

- on atteint 150 litres/personne/jour dans le


cas d’un accueil de public important, d’une Astuce !
climatisation air/eau (de plus en plus rare) et/
RXG·XQDUURVDJHG·HVSDFHVYHUWVVLJQLÀFDWLI NB : pour le déroulement
de l’analyse, il est
possible également de
V.3. HIÉRARCHISATION DES USAGES mentionner dans ce
tableau de hiérarchisation des
Une fois le tableau entrées / sorties d’eau usages, les qualités d’eau
(consommations / usages) élaboré et considéré requises par usage (voir
FRPPH ÀDEOH O·pWDSH VXLYDQWH FRQVLVWH j paragraphe VI.1).
envisager différents scénarios de maîtrise
des consommations d’eau. Au préalable il est
souhaitable de procéder à une hiérarchisation
des postes de consommation pour cibler ceux où
OHVpYHQWXHOVWUDYDX[VHURQWOHVSOXVHIÀFDFHV

Le classement pourra se faire en fonction de 4


critères :

- en volume absolu : plus un usage représente


un volume d’eau important, plus le gain
potentiel est important,
1%GDQVOHVFRPPXQHVOHVSRVWHVOHVSOXV
FRQVRPPDWHXUVVRQWVRXYHQWGDQVO·RUGUH
OHV SLVFLQHV OHV PDLVRQV GH UHWUDLWHOHV
FDPSLQJV HQ ]RQH OLWWRUDOH   HW OHV
JUDQGV EXUHDX[ 2Q VXUHVWLPH VRXYHQW OHV
FRQVRPPDWLRQV GpGLpHV DX QHWWR\DJH GHV
YRLULHVSHXFRQVRPPDWULFHV

- du fait d’une sur-consommation par rapport


à une consommation classique (par rapport
à des ratios) : plus un équipement génère
une consommation élevée par rapport à une
valeur classique plus il mérite d’être optimisé
ou remplacé,

- du fait d’une dérive dans le temps inexpliquée


(pas d’augmentation de la fréquentation
ou du nombre de bâtiments,…), qui peut
témoigner d’une fuite ou d’un vieillissement
des équipements,

55
VI. Scénarios de réduction des consommations d’eau

Pour chacun des usages, il s’agit maintenant   6XEVWLWXWLRQ : dans ce cas, si l’usage le
d’envisager différents scénarios de réduction permet (arrosage et nettoyage, voire, après
des consommations d’eau. dérogation préfectorale, chasses d’eau des
Ces scénarios sont de deux grands types, à WC), et qu’il est réglementairement possible
envisager l’un après l’autre : d’utiliser cette nouvelle ressource, il s’agit de
remplacer l’eau potable par une autre ressource
1) (FRQRPLHVG·HDXHWRSWLPLVDWLRQV, avec deux en eau (hors nappe profonde du SAGE).
grandes catégories :
La substitution ne doit être envisagée qu’après
- pFRQRPLHV SDVVLYHV générées par des
avoir optimisé le volume consommé, en effet :
équipements plus économes : une fois en
place, l’usager n’a pas d’action particulière
- le SAGE nappes profondes de Gironde a
à faire :
fait des économies d’eau une priorité : on
‡ OHV UpVXOWDWV VRQW TXDQWLÀDEOHV j WUqV ne déplace pas le problème ; on le réduit
court terme ; durablement ;
‡ les techniques sont de deux grands types :
matériel adaptable sur les équipements - les économies d’eau sont souvent moins
existant ou remplacement complet ; RQpUHXVHV HW GRQF ÀQDQFLqUHPHQW SOXV
ce dernier n’étant nécessaire que si les HIÀFDFHV TXHOHVVXEVWLWXWLRQVGHUHVVRXUFH
équipements sont très fréquemment et un usage optimisé coûte moins cher à
utilisés (plus de 15 fois par jour) ou les substituer (volume à substituer plus faible) ;
robinets souvent retrouvés ouverts ;
- les substitutions de ressource ne sont pas
‡ les principales techniques hydroéconomes
toujours réalisables.
sont les suivantes :
- réduction de pression,
Pour certains usages, l’utilisation de certaines
- équipement hydroéonome adaptable
ressources est économiquement plus avantageuse
sur les sanitaires,
(par exemple, pour l’arrosage, la récupération
- opti m i s a t i o n d e s é q u i p e m e n t s
d’eau de pluie est la plus onéreuse des solutions
d’arrosage et changement de
à envisager).
conception,
- recyclage ou réutilisation d’eau de
Tous ces éléments sont explicités en détails
refroidissement ou de piscine.
dans le présent chapitre. La table des matières
détaillée vous permet de rechercher rapidement
- pFRQRPLHV DFWLYHV liées aux nouveaux
les points qui vous concernent.
comportements des usagers :
‡HOOHVVRQWREWHQXHVjSOXVORQJWHUPH Le synoptique page suivante résume les
‡ elles passent par une connaissance des différentes étapes et scénarios recommandés.
consommations, on leur associe donc le
suivi des compteurs ;
‡ elles correspondent surtout à une
VHQVLELOLVDWLRQGHVXVDJHUVDÀQTXHFHX[
ci changent leur façon d’agir à chaque
utilisation ;
‡ mais elles intègrent aussi la maintenance
des équipements : elle est en partie
préventive (réglage des temporisations,
remplacement des joints,…) et en
partie curative (en particulier, en cas de
réparation, prévoir le remplacement du
matériel hydroéconome par du matériel
hydroéconome).

56
SYNOPTIQUE N°1 : ORDRE DANS LEQUEL ENVISAGER LES PRINCIPAUX
SCÉNARIOS DE RÉDUCTION DES CONSOMMATIONS D’EAU
ET POINTS INCONTOURNABLES

Réduction de pression
si P> 4 bars

Equipement hydro économe des


sanitaires

Economies passives : avec du


matériel, adaptable sur l’existant
ou en remplacement impact en
majorité à très court terme Optimisation des équipements
voire à moyen terme d’arrosage

Nouvelles conceptions
d’espaces verts
Diagnostic initial

Recyclage ou réutilisation des


eaux de refroidissement ou de
piscine

Scénarios d’économie d’eau,


d’optimisation des usages et et Suivi des compteurs (existants et
éventuellement si l'usage le permet. nouveaux divisionnaires) : limite
les fuites et informe

Economies actives : sensibilisation


des usagers, nouvelles pratiques
impact à court terme
Scénarios de substitution de l’eau et à plus long terme
Sensibilisation des usagers :
potable ou des nappes profondes
économies supplémentaires
par une autre ressource
induites par nouveaux
comportements

ou Maintenance des équipements :


pérennise les économies

Nappe superficielle Eau de pluie


(hors SAGE), source,
lac, rivière…
Toute l’année
Filtre Usages externes
(nettoyage, arrosage
de serre …)

ou
Eventuelle autorisation
règlementaire de
prélèvement E v e n t u e l Saisonniers
traitement (arrosage extérieur…)

Dérogation préfectorale Filtre Usages internes


pour utilisation (type chasse d’eau)

Légende :
Temps de retour sur investissement court, très efficace en
volume : priorité
Temps de retour sur investissement raisonnable : recommandé
Temps de retour sur investissement très long : déconseillé
Aspects sanitaires priment sur aspects environnementaux et
économiques : voir la DDASS
57
VII. Solutions d’économie

Les économies d’eau peuvent être obtenues par d’un réducteur de pression.
deux grands types d’actions : Pour une consommation faible (de type abonné
domestique), le coût d’un tel dispositif est très
- OD PLVH HQ SODFH GH PDWpULHOV réduit : environ 50! pour le matériel, et le
K\GURpFRQRPHV. Ils sont de deux types : soit double pose comprise.
ils sont conçus de façon à consommer moins
d’eau, soit ils peuvent être adaptés sur du
matériel existant. ,OVJpQqUHQWGHVpFRQRPLHV 3RXU GHV VLWHV j IRUWHV FRQVRPPDWLRQV LO
SDVVLYHV, qui se font automatiquement une IDXW YpULÀHU DXSDUDYDQW TX·LO Q·H[LVWH SDV
fois le matériel en place, sans que l’utilisateur G·XVDJH QpFHVVLWDQW XQH SUHVVLRQ LPSRUWDQWH
ait à intervenir. Les économies d’eau portent QHWWR\DJH DUURVDJH GpIHQVH FRQWUH
alors sur différents facteurs : le débit, la O·LQFHQGLH LPPHXEOH GH JUDQGH KDXWHXU« 
pression ou le volume d’eau pour chaque 'DQVFHFDVLOHVWVRXYHQWSUpIpUDEOHG·LQVWDOOHU
utilisation ; ce dernier facteur pouvant SOXVLHXUVUpGXFWHXUVGHSUHVVLRQHQHQWUpHRX
être direct (réglage de la temporisation) ou DX[GLIIpUHQWVpWDJHVGHVEkWLPHQWVTXLQ·RQW
indirect (fourniture d’eau à la température SDVG·H[LJHQFHSDUWLFXOLqUH0DLVGDQVFHFDV
désirée plus rapide par mitigeur ou robinet OHVIXLWHVSRWHQWLHOOHVVXUOHVUpVHDX[LQWHUQHV
thermostatique) ; LQWHUPpGLDLUHVQHVHURQWSDVUpGXLWHV

- OH FKDQJHPHQW GH FRPSRUWHPHQW des


utilisateurs des points d’eau qui génère des
VII.1.2. APPAREILS SANITAIRES (WC, LAVABOS,
économies actives. Il s’agit d’éduquer les
utilisateurs pour qu’à chaque utilisation, ils DOUCHES)
pensent à réduire le volume consommé. Les
facteurs sur lesquels on agit sont en général Les sanitaires représentent souvent un important
le temps d’utilisation et la vigilance aux poste de consommation, généralement sous-
anomalies. estimé. Les aménagements hydro économes
qu’on peut réaliser dans des sanitaires existants
VRQWSDUDLOOHXUVWUqVHIÀFDFHVHWSHXRQpUHX[
Ils ne nécessitent par ailleurs pas de main-
VII.1. ECONOMIES PASSIVES
d’œuvre spécialisée et sont rapidement mis en
place. Il faut donc réaliser ces aménagements
VII.1.1. RÉDUCTION DE PRESSION dans tous les cas. Et il s’agit bien d’aménager les
équipements existants, à l’aide d’équipements
La pression de service dans un réseau de adpatables, et très rarement de les remplacer.
distribution d’eau potable public est parfois
élevée. Or, si les abonnés se plaignent plutôt En effet, le choix à faire en matière
des faibles pressions, OHVIRUWHVSUHVVLRQVVRQW d’équipements sanitaires varie selon qu’il
DXVVL UHVSRQVDEOHV G·XQH XVXUH SUpPDWXUpH s’agisse de l’amélioration d’une installation
GHV pTXLSHPHQWV LQWHUQHV HW VXUWRXW G·XQH existante ou d’une installation neuve (voire
VXUFRQVRPPDWLRQ G·HDX. En effet, un robinet d’une rénovation lourde). La plupart des
standard délivre 12 litres/minute sous 3 bars ; équipements conçus comme hydro économes
il peut délivrer jusqu’à 17 litres/minute sous 6 ont un coût d’achat très proche de dispositifs
EDUV8QDERQQpGDQVFHFDVGHÀJXUHYHUUDGRQF classiques non économes. On les privilégiera
la plupart de ses consommations majorées. 3DU pour les installations neuves.
DLOOHXUVHQFDVGHIXLWHOHYROXPHSHUGXHVW
DXJPHQWpG·DXWDQW En revanche, remplacer les équipements
sanitaires existants est onéreux et n’est pas
En distribution publique, il n’est toutefois pas souvent nécessaire pour réaliser des économies
souvent possible de réduire cette pression d’eau ; de simples améliorations à l’aide de
élevée sur une zone importante : cela nuirait par GLVSRVLWLIV DGDSWDEOHV VXIÀVHQW HQ JpQpUDO
exemple à l’alimentation en eau d’un secteur à (excepté pour les équipements utilisés très
l’aval ou à la défense contre l’incendie. Il est fréquemment).
SDUDLOOHXUVGLIÀFLOHG·LVROHUGHSHWLWVVHFWHXUV
car en alimentation en eau potable, les réseaux Ces améliorations, qui permettent d’obtenir
sont « mailles » (tous joints entre eux) de façon des baisses de consommation d’eau de l’ordre
à assurer une circulation permanente de l’eau et de 25 à 50%, sont présentées dans les tableaux
éviter toute stagnation (qui nuirait à la qualité suivants. Il s’agit :
de l’eau). C’est donc à l’abonné de s’équiper
58
- d’installer des aérateurs économes sur les
becs des robinets (débit 6 l/min, ou 8 l/min 5HPDUTXH
en cas de chauffe eau instantané, au lieu de
plus de 12 l/min) ; &HJXLGHFRQFHUQHGHVLQVWDOODWLRQVH[LVWDQWHV
LOQHPHQWLRQQHGRQFSDVVSpFLÀTXHPHQWOHV
- de poser des sacs WC voire des plaquettes FKRL[ j IDLUH SRXU OHV pTXLSHPHQWV QHXIV ,OV
WC dans les réservoirs des WC (ils réduisent SHXYHQW DLVpPHQW VH GpGXLUH GHV FRQVHLOV GH
le volume de chasse de 2 litres environ, c’est UHPSODFHPHQWFLDSUqVHQVHEDVDQWVXUXQH
le principe de « la brique » dans le réservoir) ; IUpTXHQFHG·XWLOLVDWLRQQpFHVVDLUHSRXUFKRLVLU
HW UHQWDELOLVHU  O·pTXLSHPHQW SOXV IDLEOH DX
- et de remplacer les pommes de douches par GpSDUWSRXUXQpTXLSHPHQWQHXITXHSRXUXQ
des pommes de douches économes (débit 8 à pTXLSHPHQW j UHPSODFHU 2Q UHWLHQGUD DLQVL
10 l/min, au lieu de plus de 15) ; OHVFKRL[VXLYDQWV

- de remplacer, pour les seuls points de EDQQLUOHVPpODQJHXUVGDQVWRXVOHVFDVHW


puisage très utilisés (plus de 15 fois par FKRLVLUGHVPLWLJHXUVUpJXOpV
jour par point) ou régulièrement retrouvés ‡ j  OPLQ HQ JpQpUDO RX  OPLQ VL
ouverts, les robinets, douches ou chasses par FKDXIIHHDXLQVWDQWDQp 
des systèmes temporisés. ‡ RX j GRXEOH EXWpH SRXU OHV FXLVLQHV
LQGLYLGXHOOHV HWjGRXFKHWWHGHSUpODYDJH
Comme le montre le synoptique ci-joint, les SRXU OHV FXLVLQHV SURIHVVLRQQHOOHV VDXI
investissements correspondants sont en général SRXU OH SRVWH GH ODYDJH GHV PDLQV
rentabilisés en : WHPSRULVpjFRPPDQGHDXJHQRX 
‡WKHUPRVWDWLTXHVSRXUOHVGRXFKHV DYHF
- moins de 6 mois pour la pose de réducteur XQ UpJXODWHXU WKHUPRVWDWLTXH FRPPXQ
de pression, d’aérateurs économes sur les SRXUGHVGRXFKHVFROOHFWLYHV 
becs des robinets existants, pour l’installation
de sacs dans les réservoirs des WC et de  SUpYRLU GHV V\VWqPHV WHPSRULVpV HQ
douchettes économes… ; pTXLSHPHQWFROOHFWLI ODYDJHGHVPDLQV:&
HWGRXFKHV PrPHV·LOVVRQWUHODWLYHPHQW
- et en 1 à 3 ans si on réalise des travaux SHXXWLOLVpV
de plomberie (temporisation, douchette de
prélavage…) sur les robinets, douches ou WC
les plus utilisés (à prévoir uniquement sur les
équipements servant plus de 15 fois par jour /HV WDEOHDX[ VXLYDQWV SUpVHQWHQW OHV
ou laissés ouverts) ; GLIIpUHQWHV SRVVLELOLWpV G·DPpOLRUDWLRQV SDU
W\SHG·pTXLSHPHQWH[LVWDQW
- plus de 5 ans si on envisage le remplacement
systématique de tous les équipements par des 3RXU OD GHVFULSWLRQ GHV PDWpULHOV UHSRUWH]
équipements « idéalement hydroéconomes » YRXVjO·RXWLOG·DLGHTXLGpFULWOHVpTXLSHPHQWV
(remplacement de tous les mélangeurs par W\SHVHQSDUWLFXOLHUSRXUODURELQHWWHULH
des mitigeurs thermostatiques…). Ces derniers
travaux entrent en effet dans la catégorie des (W SRXU OHV LQYHVWLVVHPHQWV FRUUHVSRQGDQWV
« 80/20 » (80% des investissements UHSRUWH]YRXVjO·RXWLOG·DLGH©WDULILQGLFDWLIGHV
pour seulement 20% d’économie d’eau SULQFLSDX[pTXLSHPHQWVK\GURpFRQRPHVª
supplémentaires).
(QÀQ LO IDXW UHWHQLU TXH SRXU OH SRVWH GHV
L’intérêt des différents dispositifs est évalué FRQVRPPDWLRQVG·HDXVDQLWDLUHHQSDUWLFXOLHU
VRXVXQDVSHFWÀQDQFLHUPDLVLOHVWVLPLODLUHHQ LO HVW LPSpUDWLI GH SUpYRLU XQH PDLQWHQDQFH
terme environnemental : à budget constant, la GHV SHWLWV pTXLSHPHQWV SRXU SpUHQQLVHU OHV
première catégorie d’aménagements permet pFRQRPLHV G·HDX UpDOLVpHV YRLU SDUDJUDSKH
d’économiser immédiatement un volume 10 fois ©pFRQRPLHVDFWLYHVª 
plus important (au moins) que les derniers pour
préserver les nappes profondes.

$77(17,21(QFDVGHSUREOqPHVSUpH[LVWDQWV PDXYDLVpTXLOLEUDJHGHVSUHVVLRQVHDXFKDXGHHDX
IURLGHGRXFKHVpFRVVDLVHV« O·pTXLSHPHQWGHVLQVWDOODWLRQVVDQLWDLUHVHQPDWpULHOK\GURpFRQRPH
SRXUUDLWDPSOLÀHUOHVSUREOqPHV
3RXU OHV LQVWDOODWLRQV FRQFHUQpHV HQ SDUWLFXOLHU XQ DXGLW SUpDODEOH HVW QpFHVVDLUH DLQVL TXH
TXHOTXHVWUDYDX[FRQQH[HVGHPLVHHQFRQIRUPLWp
'DQVWRXVOHVFDVOHVDVSHFWVGHVpFXULWpVDQLWDLUHVSULPHQWVXUOHVpFRQRPLHVG·HDX DWWHQWLRQDX[
EU€OXUHVDX[UHWRXUVG·HDXjODVWDJQDWLRQ«

59
SYNOPTIQUE N°2 : QUELS ÉQUIPEMENTS HYDROÉCONOMES CHOISIR POUR
OPTIMISER LA CONSOMMATION D’EAU DES SANITAIRES EXISTANTS ?

$&! &

  &!  


 &  ' !(  '+(
 "!
 ##"$!%"##  5#
%"( #  
 "##"  #"!#$!
'!#$! "$!
!#%"##$ #!"" "$!3"#""#
'""$ $##" )$!""$! 0/$!#- "$
" $" 
  &

"$!"#$
"#
  %%  

 &!   ' !(  '+(


 & '+&! 
  
#"#$"$""'  5#'3'
! &!&!  
$&,&&!# +   $"##$3  #"!#$!
 +!  $"1#" "$!3"#""#
%"(  !$!"&$!"" 4#! #

!#"#!"'"& !'$!" "*
"!#"""$#"'"
 1+& 
$" ,"2
#$!"3"!" "$#'#
!'$#$!!"" #,&
"")2$#$%
##"' $#"

 !     ' !(  '+(


&! ! !  !'3###  $    5#'3'
)-+&!!  +   "##$3
!$*! &  !'3#
$& $"1$4 #"!#$!"$!
!""1#! 3"#""#1.

%"(  $!" "
#1$!"&$$#'&  1
,& ,"
"'1$!"
$$ "$#'##
#!"'" ,& ,"")2$#$%
##"' $#"

60
9,,(YLHUV/DYDERV

3URSRVLWLRQGH ,QWHUYHQWLRQ
5RELQHWWHULH &ULWqUHVMXVWLÀDQWOHFKRL[
UHPSODFHPHQW G·XQ *DLQHQ
HQSODFHVXU
)UpTXHQFH SURIHVVLRQQHO HDX
ODYDER SDUWLHO WRWDO &RPPHQWDLUHV
G·XWLOLVDWLRQ SORPELHU
Toute
Aérateur Permet de réduire
fréquence,
économe ou le débit en sortie de Non
surtout 35 à 50%
limiteur de robinet en conservant obligatoire
moyenne et
débit le matériel existant
Robinet simple faible
mécanique
(eau froide) A retenir aussi
Forte à
+ si fréquence
Robinet simple très forte
Brise-jet d’utilisation moindre Oui 50 à 70%
temporisé fréquence
Ou et robinet retrouvé
(> 15 fois/j)
Aérateur ouvert parfois
classique
Amélioration de
Très forte
Robinet simple l’hygiène par une
fréquence Oui 50 à 70%
électronique absence de contact
(> 30 fois/j)
matériel

Permet de réduire
Toute le débit en sortie
Aérateur de robinet à bouton
fréquence,
économe ou poussoir de première Non
surtout 35 à 50%
limiteur de génération, s’il est obligatoire
moyenne et
débit muni d’une bague
faible
UDUH
Robinet simple Toute
temporisé réglage fréquence,
Si le bec du robinet
temporisation surtout Souhaitable 10 à 30%
n’a pas de bague
< 10s moyenne et
faible
Amélioration de
Très forte
Robinet simple l’hygiène par une
fréquence Oui 20% à 50%
électronique absence de contact
(> 30 fois/j)
matériel
Toute
Aérateur Permet de réduire
fréquence,
économe ou le débit en sortie de Non
surtout 35 à 50%
limiteur de robinet en conservant obligatoire
moyenne et
débit le matériel existant
faible
Mélangeur
mécanique A retenir aussi
Forte à
+ si fréquence
Mitigeur très forte
Brise-jet d’utilisation moindre Oui 50 à 70%
temporisé fréquence
ou et robinet retrouvé
(> 15 fois/j)
Aérateur ouvert parfois
classique
Amélioration de
Très forte
Mitigeur l’hygiène par une
fréquence Oui 50 à 70%
électronique absence de contact
(> 30 fois/j)
matériel

Toute
Aérateur Permet de réduire
fréquence,
économe ou le débit en sortie de Non
surtout 35 à 50%
limiteur de robinet en conservant obligatoire
moyenne et
débit le matériel existant
faible
Mitigeur
mécanique A retenir aussi
+ Très forte si fréquence
Brise-jet Mitigeur
fréquence d’utilisation moindre Oui 50 à 70%
ou temporisé
(> 15 fois/j) et robinet retrouvé
Aérateur ouvert parfois
classique
Amélioration de
Très forte
Mitigeur l’hygiène par une
fréquence Oui 50 à 70%
électronique absence de contact
(> 30 fois/j)
matériel

61
3URSRVLWLRQGH ,QWHUYHQWLRQ
5RELQHWWHULH &ULWqUHVMXVWLÀDQWOHFKRL[
UHPSODFHPHQW G·XQ *DLQHQ
HQSODFHVXU
)UpTXHQFH SURIHVVLRQQHO HDX
pYLHU SDUWLHO WRWDO &RPPHQWDLUHV
G·XWLOLVDWLRQ SORPELHU

En cuisine, préférable à
un mitigeur régulé à
Mitigeur 6 l/min simple. Celui-ci
Mitigeur à
mécanique Forte à fournit ce débit réduit,
« double
+ très forte mais il est débrayable
butée » ou Oui 20 à 40%
Brise-jet fréquence et permet d’avoir
« manette
ou aérateur (> 15 fois/j) ponctuellement un
clic-clac »
classique débit important pour le
remplissage des grands
récipients

Mélangeur
ou mitigeur Quantité de vaisselle
Forte à
mécanique Mitigeur avec importante, mais
très forte
+ douchette de LQVXIÀVDQWHSRXU Oui 20 à 40%
fréquence
Brise-jet prélavage rentabiliser l’achat d’un
(> 15 fois/j)
ou aérateur lave ustensiles
classique

Robinet Si hygiène accrue


mécanique Toute nécessaire (cuisine…).
+ Aérateur Commande au fréquence de La facilité de
Oui 20 à 30%
Brise-jet économe genou lavage des manipulation
ou aérateur mains réduit le temps de
classique fonctionnement

Tableau N°5 :
Guide de choix pour l’amélioration ou le remplacement de la robinetterie existante

Choix du débit pour les lavabos et éviers :

- concerne l’aérateur économe ou le robinet


temporisé ou électronique directement
régulé,

- le débit standard à prévoir est de 6 l/min,

- peut varier de 3 l/min pour le lavage des


mains des enfants à 8 l/min maxi (pour un
minimum de 12l/min au départ à 3 bars, et Astuce !
plus en cas de pression plus importante).
Le remplacement des robinets est
3UpYRLU DX PLQLPXP  OPLQ HQ FDV GH plus simple si on utilise des raccords
FKDXIIH HDX LQVWDQWDQp SRXU SHUPHWWUH VRQ rapides à compression (« tectite ») ; ils
GpFOHQFKHPHQW ne nécessitent en effet pas de
soudure.
Choix du type de jet pour les robinets ou lavabos :

- les jets aérés obtenus à l’aide des aérateurs


économes classiques permettent d’obtenir
une sensation de confort identique aux jets
classiques pour un débit 2 fois plus faible,

- les jets aérés sont proscrits en milieu médical


et à éviter pour les établissements recevant
des personnes sensibles. Dans ce cas, il faut
retenir des jets laminés ou à aiguille.

62
9,,&KDVVHVG·HDXHWXULQRLUV

3URSRVLWLRQGH ,QWHUYHQWLRQ
&ULWqUHVMXVWLÀDQWOHFKRL[
0pFDQLVPH UHPSODFHPHQW G·XQ *DLQHQ
(QSODFH )UpTXHQFH SURIHVVLRQQHO HDX
SDUWLHO WRWDO &RPPHQWDLUHV SORPELHU
G·XWLOLVDWLRQ

1 sac à positionner dans le


réservoir des WC, permet
de conserver le bloc
sanitaire existant.. Très
Toute facile à mettre en place. Non
Sac WC 25%
fréquence Peu onéreux (5!/U, prix obligatoire
public). A privilégier par
rapport aux plaquettes.
Pas besoin de
sensibilisation de l’usager

2 plaquettes à positionner
dans le fond du réservoir
des WC, permet de
conserver le bloc sanitaire
existant et de conserver
un effet de chasse
important. Un peu délicat
Toute Non
Plaquette WC à mettre en place. Parfois 20 à 35%
fréquence obligatoire
une plaquette seulement
peut être installée (elles
sont vendues par 2 pour
environ 25!/2, prix
public).
WC mécanisme Pas besoin de
simple sensibilisation de l’usager.
commande non
interrompable Possible, mais l’effet de
avec réservoir chasse sera plus faible,
ancien de 9 à Réglage bas
Toute contrairement aux 2 Non
12 litres du niveau du 10 à 25%
fréquence équipements précédents, obligatoire
ÁRWWHXU
qui limitent le volume en
bas de réservoir

mécanisme Permet de réduire le débit


simple Faible à tout en conservant le bloc
Souhaitable 40%
commande moyenne WC. Sensibilisation de
interrompable l’usager recommandée

Le nouveau mécanisme
permet de réduire le débit
Mécanisme tout en conservant le bloc
double Faible à WC. Exige cependant une 35% en
Souhaitable
commande moyenne sensibilisation de l’usager. moyenne
3/6 litres Mécanisme assez fragile,
non adapté à un usage
intensif

Nécessite la suppression
du réservoir et le
Forte (> 15
WC à chasse remplacement de la
fois/j) à très Oui 70%
temporisée cuvette.
forte
Temporisation de
référence : 7 secondes

5HPDUTXHDXFXQpTXLSHPHQWVXSSOpPHQWDLUH  :&  j FRPSUHVVLRQ G·DLU © 7URPEH ª 


Q·HVWSURSRVpSRXUFHUWDLQVpTXLSHPHQWVGpMj XWLOLVDQW  j  OLWUHV SDU FKDVVH QRQ
RSWLPLVpVFRPPHOHV UHFRPPDQGpHQXVDJHWUqVLQWHQVLIGXIDLW
GXWHPSVGHUHPSOLVVDJHORQJ 
 :& j PpFDQLVPH VLPSOH FRPPDQGH QRQ
LQWHUURPSDEOH DYHF UpVHUYRLU UpFHQW GH  :&jUpVHUYRLUVXVSHQGXGHjOLWUHV
OLWUHV

63
&ULWqUHVMXVWLÀDQWOHFKRL[ ,QWHUYHQWLRQ
8ULQRLU 3URSRVLWLRQGH G·XQ *DLQHQ
(QSODFH UHPSODFHPHQWWRWDO )UpTXHQFH SURIHVVLRQQHO HDX
&RPPHQWDLUHV
G·XWLOLVDWLRQ SORPELHU
Urinoir électronique
(infrarouge)
permet d’accroître
très forte
l’hygiène (déclenchement Oui 10 à 30%
(> 30 fois/j)
automatique sans contact)
Urinoir
Crédit photo : Sider
temporisé
(bouton N’utilise pas d’eau pour
poussoir) Urinoir sans eau (à huile)
évacuer l’urine ; piège
aussi les odeurs.
très forte
Oui 100%
(> 30 fois/j)
1pFHVVLWHXQ
UHPSODFHPHQWDVVH]
Crédit photo : Sanitec
IUpTXHQWGHVFDUWRXFKHV

Tableau N°6 :
Guide de choix pour l’amélioration ou le remplacement des WC ou urinoirs existants

9,,'RXFKHV
3URSRVLWLRQGH ,QWHUYHQWLRQ
&ULWqUHVMXVWLÀDQWOHFKRL[
'RXFKHVHQ UHPSODFHPHQW G·XQ *DLQHQ
SODFH )UpTXHQFH SURIHVVLRQQHO HDX
SDUWLHO WRWDO &RPPHQWDLUHV SORPELHU
G·XWLOLVDWLRQ
Réduit le débit en sortie de
douchette (de 15 à 20 l/
min au départ et 6 à 10
litres/min ensuite ; 8 à 10
litres/minute sont un
bon compromis entre
Douchette
l’économie d’eau et le 35 à 50
économique Faible et
confort). La réduction Non obligatoire %, 40% en
HWÁH[LEOH moyenne
de débit augmente la moyenne
renforcé
pression, d’où la nécessité
Douche GHUHPSODFHUOHÁH[LEOH
« téléphone » SDUXQÁH[LEOHUHQIRUFp
(douchette+ (soit 10 !, en plus des 25
ÁH[LEOH !environ prix public, pour
la douchette).
Réduit le débit en sortie
de douchette (de 15/20 à 35 à 50 %,
7/10 litres/min). 30% en
Réducteur de Le confort est moindre moyenne
Faible Non obligatoire
débit qu’avec le système pour limiter
précédent ; mais le coût la perte de
aussi (12 ! environ, prix confort
public).
Non obligatoire
Réduit le débit en sortie
pour la
de douchette (de 15 à
pose, mais
Adaptation 20 l/min au départ et 7
recommandée 35 à 50 %,
d’une pomme Toute à 10 litres/min une fois
pour préciser 40% en
de douche fréquence réduit). Pomme économe
si adaptation moyenne
économe adaptable sur certains
possible en
modèles seulement. Existe
fonction des
'RXFKHÀ[H en version anti-vol
marques
murale standard
'RXFKHÀ[H
Les douches murales
murale avec
sont conçues avec un
robinet
Forte réducteur de débit intégré 35 à 50 %,
temporisé ou
fréquence permettant de diminuer la Oui 40% en
bouton poussoir
(> 15 fois/j) consommation en eau. moyenne
rotatif et
Temporisation de référence :
réducteur de
20 secondes
débit intégré
Tableau N°7 :
Guide de choix pour l’amélioration ou le remplacement des douches existantes

/HV VWRS GRXFKHV SHUPHWWHQW HIIHFWLYHPHQW De manière plus générale, pour le choix de
GH UpGXLUH OH YROXPH FRQVRPPp PDLV VRQW matériel hydroéconome, veiller au respect
j SURVFULUH LPSpUDWLYHPHQW FDU LOV SHXYHQW d’autres critères que la faible consommation
RFFDVLRQQHU GHV EU€OXUHV HW GHV SROOXWLRQV d’eau : le respect de la sécurité sanitaire, le
UHWRXUV SRVVLEOHV G·HDX FKDXGH GDQV OHV maintien du confort d’utilisation et la durabilité
FDQDOLVDWLRQVG·HDXIURLGH  des aménagements.
64
9,, 3URGXFWLRQ HW WUDQVSRUW GH O·HDX De la même façon que pour les chaudières,
FKDXGHVDQLWDLUH l’économie d’eau générée par un mitigeur à la
place d’un mélangeur (ou d’un mitigeur par un
Une partie du gaspillage de l’eau chaude PLWLJHXUWKHUPRVWDWLTXH Q·HVWSDVVXIÀVDQWHHQ
provient du temps d’attente pour obtenir de HOOHPrPH SRXU MXVWLÀHU OH UHPSODFHPHQW GH
l’eau à bonne température. Ce délai peut être tous ces équipements (sauf en cas d’utilisation
réduit avec des systèmes plus performants de très intensive). Ils sont en revanche à prévoir
production, de transport ou de régulation de impérativement dans les bâtiments neufs.
l’eau chaude sanitaire (ECS), dont les principaux
sont décrits ci-après. 9,, (FRQRPLHV G·pQHUJLH JpQpUpHV
SDUOHVpFRQRPLHVG·HDXFKDXGHVDQLWDLUH
3DUDLOOHXUVGHIDoRQJpQpUDOHO·pFRQRPLHG·HDX
FKDXGH VDQLWDLUH JpQqUH DXWRPDWLTXHPHQW 9,,&DVJpQpUDO
GHVpFRQRPLHVG·pQHUJLHQRQQpJOLJHDEOHV/H Les économies d’énergie liées à la diminution de
GHUQLHUSDUDJUDSKHGHFHWWHSDUWLHFRQVDFUpH OD SURGXFWLRQ G·HDX FKDXGH VRQW VLJQLÀFDWLYHV
jO·(&6GRQQHGHVpOpPHQWVSRXUOHVpYDOXHU GDQV OH ELODQ ÀQDQFLHU G·XQH RSpUDWLRQ
d’économie d’eau. En effet, de façon générale,
9,,&KDXGLqUHj PLFUR DFFXPXODWLRQ on peut retenir que le coût du chauffage de
O·HDX HVW VLJQLÀFDWLI SDU UDSSRUW DX SUL[ GX P3
La production d’eau chaude ne se fait en général d’eau potable.
pas immédiatement à la température souhaitée :
mis à part les « ballons d’eau chaude électriques », ([HPSOH1ƒFR€WVGXFKDXIIDJHGHO·HDX
les chaudières à gaz ou au fuel mettent un certain
temps à produire l’eau chaude à la température - chauffage de l’eau chaude sanitaire d’une
requise. C’est pourquoi les chaudières récentes maison individuelle : environ 1 à 3! TTC/m3
de bonne qualité comportent une réserve d’eau selon le mode de chauffage;
chaude maintenue en permanence à température
souhaitée (>55°C). - chauffage de l’eau du bassin (élévation de
température de 15°C en moyenne) d’une
Pour des équipements neufs (ou une rénovation piscine municipale : de 1 à 1,5 !TTC/m3 ;
lourde),il est donc conseillé de retenir un
modèle de chaudière à (micro-)accumulation. En - chauffage de l’eau des douches (élévation
revanche, l’économie d’eau générée est assez de température de l’eau de 30°C en moyenne)
IDLEOHHWQHVXIÀWSDVHQHOOHPrPHjMXVWLÀHUOH dans une piscine ou un équipement sportif
remplacement d’une chaudière ancienne. important : de 3 à 4,5 !TTC/m3.
9,, &DORULIXJHDJH GHV FDQDOLVDWLRQV 9,, &DV G·XQ ORJHPHQW
G·HDX FKDXGH HW RSWLPLVDWLRQ GH LQGLYLGXHO
O·HPSODFHPHQWGHODFKDXGLqUH
(QÀQVXUODEDVHG·XQHDQDO\VHGX&67%VXUOHV
L’eau chaude produite refroidit rapidement dans économies d’énergie induites par les économies
des canalisations de faible diamètre. On la laisse d’eau sur une douche (tableau 2 du « Guide
en général couler le temps d’obtenir une eau pour les économies d’eau » publié par le CSTB
chaude à la température souhaitée. Pour limiter en septembre 2001), le SMEGREG a évalué
le phénomène et réaliser des économies d’eau les économies d‘énergie moyennes réalisées
et d’énergie, il est nécessaire de calorifuger les automatiquement par un ménage qui s’équipe
canalisations d’eau chaude, d’autant plus quand en matériel hydroéconome.
elles correspondent à un linéaire important.
Pour les installations neuves, l’optimisation &H FDV GH ÀJXUH GX ORJHPHQW LQGLYLGXHO HVW
de l’emplacement de la chaudière à proximité présenté car c’est le seul pour lequel nous avions
des principaux postes de consommation d’eau des données complètes pour illustrer à quel
chaude est aussi à prévoir. point les économies d’eau (en partie eau chaude
sanitaire) génèrent des économies d’énergie.
9,, 5RELQHWV WKHUPRVWDWLTXHV HW
PLWLJHXUV
+\SRWKqVHV
Après la production et le transport, les points
de délivrance de l’eau chaude peuvent aussi - famille de 2,33 personnes (moyenne
être choisis de manière à fournir rapidement de girondine),
l’eau à la température souhaitée, sans que le
réglage doive être refait à chaque manipulation - consommation d’eau annuelle : 120 m3,
(pour économiser l’eau qu’on laisse l’eau couler
pendant ce réglage). C’est pour cette raison - consommation moyenne d’énergie d’un
qu’on conseille la pose de mitigeurs et l’abandon ménage : 20 000 kwh/an dont environ 10%
des mélangeurs pour les lavabos et éviers, et de pour l’eau chaude sanitaire,
mitigeurs thermostatiques pour les douches.
65
- coût de l’électricité : 0,1074 !/kWh (donnée
issue du site www.particuliers.edf.fr),

- coût du gaz : 0,06 !/kWh (pour usage


cuisine et eau chaude, donnée issue du site
www.gazdefrance.fr),

- énergie nécessaire pour échauffer 1 m3


d’eau à 60°C : 0,058 kW/h,

- économies d’eau générées par les


équipements hydroéconomes (2 aérateurs
(6 l/min) sur le lavabo et l’évier, 1 sac WC
(2l), 1 douchette économe (9 l/min)) : 40%,

- prix de l’eau potable assainie : 3,2 !/m3,

- répartition des consommations d’eau d’une Illustration N°18 :


Répartition moyenne des consommations d’eau par poste dans un
famille par poste issue d’une étude sur le ménage (étude sur le Pays Cœur Entre Deux Mers)
Pays Cœur Entre Deux Mers :

&RQVRPPDWLRQVLQLWLDOHVGHODIDPLOOH HDXHWpQHUJLHSRXUHDXFKDXGHVDQLWDLUH
Volume Consommation
Part d’eau Volume Consommation
d’eau Consommation énergétique en euro
consommée d’eau en énergétique en
chaude en d’eau en euro
en % m3/an kwh/an Gaz Electricité
m3/an
Divers 0,3 0,4 1,2
Boisson 0,6 1 2
Voiture/
0,6 8 25
jardin
Linge 8,4 10 32
Vaisselle 8,9 11 6 34 345 21 35
Cuisine 12,2 15 2 47 115 7 12
Sanitaire 16,5 20 63
bain/douche 46,6 56 32 179 1837 110 197
7RWDO 100 120 40 384 2297 138 247
Tableau N°8 :
Consommations d’eau et d’énergie moyenne d’un ménage

&RQVRPPDWLRQVGHODIDPLOOH HDXHWpQHUJLHSRXUHDXFKDXGHVDQLWDLUH 
DSUqVPLVHHQ±XYUHGXPDWpULHOK\GURpFRQRPH
Volume Consommation
Part d’eau Volume Consommation
d’eau Consommation énergétique en euro
consommée d’eau en énergétique en
chaude en d’eau en euro
en % m3/an kwh/an Gaz Electricité
m3/an
Divers 0,3 0,2 1
Boisson 0,6 0 1
Voiture/
6,6 5 15
jardin
Linge 8,4 6 19
Vaisselle 8,9 6 3,6 21 207 12 22
Cuisine 12,2 9 1,2 28 69 4 7
Sanitaire 16,5 12 38
bain/douche 46,6 34 19 107 1102 66 118
7RWDO 100 72 24 231 1378 83 78
Tableau N°9 :
Consommations d’eau et d’énergie moyenne d’un ménage après équipement en matériel hydroéconome

66
Part en % des
économies dues à
Consommation Consommation Volume Gain en chaque poste de
Baisse en consommation sur
avant la pose avec le économisé euro/an
% de la le montant total des
matériel hydro matériel hydro (m3 ou grâce au
consommation économies
économe économe kwh/an) vol éco
Eau +
Eau +gaz
électricité
Eau en m3/
120 72 48 40 154 74 61
an
Gaz en kwh/ 55 26
an
2297 1378 919 18
Électricité 99 39
en kwh/an
Tableau N°10 :
Bilan des économies d’énergie induites par les économies d’eau, et en particulier d’eau chaude sanitaire

(QFRQFOXVLRQXQPpQDJHTXLLQYHVWLWHQYLURQ de renouvellement et de qualité d’eau) pour


½ SUL[ SXEOLF  HQ PDWpULHO K\GURpFRQRPH toutes les piscines recevant du public : piscine
SHUIRUPDQW DGDSWDEOH VXU VHV VDQLWDLUHV municipale, de camping, d’hôtel, de centre de
UpDOLVH XQH pFRQRPLH G·HDX GH  FH TXL soins, de centre sportif, de gîte …
JpQqUH DXWRPDWLTXHPHQW XQH pFRQRPLH
G·pQHUJLHG·HQYLURQVXUODFRQVRPPDWLRQ Pour les piscines récentes, l’arrêté du 7 avril
G·pQHUJLH SRXU OH FKDXIIDJH GH O·HDX FKDXGH 1981 (complété par les arrêtés du 28 septembre
VDQLWDLUHHWHQYLURQVXUODIDFWXUHJOREDOH 1989 et du 18 janvier 2002) exige au minimum
G·pQHUJLHG·XQORJHPHQWLQGLYLGXHO deux vidanges annuelles complètes du bassin et
un apport d’au moins 30 litres/jour/baigneur.
6XU OD EDVH G·XQH FRQVRPPDWLRQ PR\HQQH
En pratique, les gestionnaires de piscines vont
GH  P3DQ OHV pFRQRPLHV G·HDX
rarement au-delà des deux vidanges annuelles.
FRUUHVSRQGDQWHV VRQW G·HQYLURQ PDQ HW
En revanche, les apports d’eau journaliers sont
½DQ   HOOHV VRQW UHQWDELOLVpHV HQ PRLQV
en général de 70 à 120 l/j/baigneur et peuvent
GH  PRLV GX VHXO SRLQW GH YXH © HDX ª /HV
aller jusqu’à 200 l/j/baigneur. Il faut noter que
pFRQRPLHVG·pQHUJLHLQGXLWHVOLpHVjODEDLVVH
les récentes expériences d’économies d’eau
GHFRQVRPPDWLRQG·HDXFKDXGHVDQLWDLUHVRQW
montrent que des consommations optimisées
G·HQYLURQNZKDQ VRLWj½DQVHORQ
au maximum ne vont pas en deçà de 45 à 60
OHPRGHGHFKDXIIDJHGHO·HDX FHTXLUDPqQH
l/j/baigneur (avec la fourchette basse pour les
OHWHPSVGHUHWRXUVXULQYHVWLVVHPHQWjPRLQV
grands bassins et la fourchette haute pour les
GHPRLV
grands).
&HV pFRQRPLHV G·HDX FKDXGH VDQLWDLUH
FRQVWLWXHQW OD SOXV HIÀFDFH GHV WHFKQLTXHV De plus, les mêmes textes ont aussi des exigences
G·pFRQRPLHVG·pQHUJLHG·XQSRLQWGHYXHGH en matière de qualité, dont les principales sont
OHXUFR€W jWLWUHGHFRPSDUDLVRQXQFKDXIIH les suivantes :
HDX VRODLUH SHUPHW G·pFRQRPLVHU  j 
- le pH est compris entre 6.9 et 7.7 ;
GH O·pQHUJLH GH FKDXIIDJH GH O·HDX SRXU XQ
LQYHVWLVVHPHQW G·HQYLURQ  ½ /·LGpDO HVW - en l’absence de stabilisant, le taux de
G·DVVRFLHUOHV (QÀQFHVWHFKQLTXHVVLPSOHV chlore libre actif est compris entre 0.4 et 1.4
VRQWDFFHVVLEOHVDXVVLDX[SHUVRQQHVSHUVRQQHV mg/l ;
ORJpHVHQDSSDUWHPHQWHWDX[ORFDWDLUHV
- en présence de stabilisant (dont la teneur
doit être inférieure à 75 mg/l), le taux de
VII.1.3. PISCINES RECEVANT DU PUBLIC chlore libre actif doit être au moins de 2 mg/l
(la teneur recommandée est d’environ 2 à
Ce paragraphe est consacré aux moyens de 3 mg/l ; on observe souvent des variations
limiter le renouvellement de l’eau des piscines jusqu’à 5 mg/l en particulier sur les plus
ouvertes au public, quand il peut l’être. Ces petites piscines ; il ne faut pas dépasser
établissements comportent également des ponctuellement environ 10 mg/l) ;
sanitaires, en particulier des douches, qu’il
convient aussi d’optimiser (voir le paragraphe - le taux de chlore combiné (chloramines)
« sanitaires »). ne dépasse pas 0.6 mg/l (dans l’eau). Il
n’existe en effet pas de normes pour les
9,,5pJOHPHQWDWLRQ teneurs maximales en chloramines de l’air
des piscines. De telles normes existent
9,, 7DX[ GH UHQRXYHOOHPHQW HW seulement pour l’industrie chimique mais
TXDOLWpGHO·HDXGHVEDVVLQV elles sont élevées car elles correspondent à
un temps d’exposition court (accidentel). De
Il est important de savoir que la réglementation même, la norme de confort dans l’air (APAVE)
est la même (et en particulier les exigences est élevée.
67
Il subsiste des piscines d’ancienne génération 9,, 3LVFLQHV GH JUDQGHV GLPHQVLRQV
qui, du fait de leur conception (en général, SLVFLQH PXQLFLSDOH RX SDUF GH ORLVLUV
volume recirculé par écrémage latéral de surface SULYp
LQVXIÀVDQW HW LQIpULHXU j   GRLYHQW HQFRUH
vidanger leurs bassins à une fréquence annuelle La réduction des consommations d’eau d’une
de 4 fois par an et journalière d’1/20ème de piscine peut être réalisée :
leur volume (correspondant aux exigences de
l’arrêté du 13 juin 1969). Dans la mesure où les - en réduisant les taux de renouvellement de
exigences de qualité de l’eau sont respectées, l’eau (en gardant toujours comme objectif
ces piscines (de type Caneton, Tournesol, Plein prioritaire le respect des normes sanitaires),
Ciel…) ne sont pas tenues de se mettre aux
normes de 1981 ; certaines l’ont fait ; d’autres - en récupérant l’eau de renouvellement.
pas. Maintenant que ces anciens équipements
ont globalement beaucoup vieilli, cette mise 1%,OHVWpJDOHPHQWHQYLVDJHDEOHG·XWLOLVHUXQH
aux normes représente en effet des travaux DXWUHUHVVRXUFHTXHOHUpVHDXG·DOLPHQWDWLRQ
très importants (qui vont souvent au-delà de la HQ HDX SRWDEOH FI SDUDJUDSKH VXEVWLWXWLRQ
reprise du seul système de recirculation), dont GH UHVVRXUFH  (Q *LURQGH  SLVFLQHV VRQW
le coût de revient dépasse parfois le coût d’une DOLPHQWpHVSDUGHVIRUDJHVVSpFLÀTXHV
piscine neuve.

9,,5pFXSpUDWLRQGHO·HDX ™ Si le taux de renouvellement de l’eau d’un


bassin est élevé, il faut d’abord en rechercher
Une autre voie à explorer pour réaliser des la raison avant d’envisager des travaux pour le
économies d’eau sur des piscines concerne la réduire. Le motif est souvent une combinaison
réutilisation de l’eau. Pour cela, il faut distinguer de facteurs. Les points suivants, au moins,
O·HDXGHODYDJHGHVÀOWUHVHWO·HDXVXUYHUVpHDX doivent être examinés ; et il est conseillé de
niveau des bassins. faire appel à un spécialiste et de se rapprocher
de la DDASS :
/·HDX GH ODYDJH GHV ÀOWUHV HVW WUqV FKDUJpH
HOOH HVW FRQVLGpUpH FRPPH XQH HDX XVpH HW - les normes auxquelles est soumise la piscine
GRLW LPSpUDWLYHPHQW rWUH UHMHWpH DX UpVHDX (1981 ou 1969) et de façon plus générale la
G·DVVDLQLVVHPHQW L’eau de débordement en performance des équipements :
revanche est chlorée, mais peut être réutilisée La mise aux normes d’une piscine apporte en
pour certains usages (arrosage, nettoyage général une amélioration des consommations
extérieur, …), après accord de la DDASS ou d’eau. Vu le coût des travaux (en général
dérogation préfectorale (chasses d’eau des WC). plusieurs centaines de milliers d’euros pour
En fonction de la conception de la piscine, de sa une 25 m), la réduction des consommations
WDLOOHHWGHODFDSDFLWpGXV\VWqPHGHÀOWUDWLRQ d’eau n’est pas le seul objectif. Pour
(absence de goulotte de débordement, système améliorer la part de reprise de surface
GH ÀOWUDWLRQ VRXV GLPHQVLRQQp RX WUqV IRUWH (par goulotte pour les piscines > 200 m2),
fréquentation…), il est possible que la part d’eau on doit généralement revoir tout le circuit
GHQHWWR\DJHGHVÀOWUHVFRUUHVSRQGHjODTXDVL hydraulique et casser les plages, d’où le
totalité de l’eau apportée quotidiennement, coût important des travaux. Ce qui réduit
auquel cas on ne peut envisager aucune la consommation correspond à la reprise
récupération d’eau. des canalisations (parfois fuyardes), et à
O·DPpOLRUDWLRQGXV\VWqPHGHÀOWUDWLRQ8QH
9,, 0R\HQV SRWHQWLHOV GH UpGXLUH OD régulation automatique du pH est également
FRQVRPPDWLRQG·HDXGHVSLVFLQHV souvent intéressante pour mieux gérer le
système (elle peut être envisagée seule).
Si la réglementation est la même pour tous, les
économies d’eau potentielles pour les différents 1%  OHV DQFLHQQHV SLVFLQHV QRQ PLVHV DX[
établissements équipés d’une piscine ne sont en QRUPHVGHTXLGHYUDLHQWWKpRULTXHPHQW
général pas du tout les mêmes : DYRLUGHVWDX[GHUHQRXYHOOHPHQWDQQXHOVHW
MRXUQDOLHUV SOXV pOHYpV QH VRQW SDV WRXMRXUV
- elles peuvent être très importantes sur les FHOOHV TXL FRQVRPPHQW OH SOXV G·HDX &HOD
piscines municipales ou ludiques de grandes WLHQWSDUIRLVjOHXUIDLEOHIUpTXHQWDWLRQPDLV
dimensions (mais elles peuvent aussi être DXVVL j OHXU PRGH GH WUDLWHPHQW GH O·HDX HW
très limitées) ; j OHXU H[SORLWDWLRQ RSWLPLVpH 2Q REVHUYH
DLQVL SOXVLHXUV SLVFLQHV GH  P HQ *LURQGH
- en revanche elles sont généralement GpVLQIHFWpHVjO·HDXGHMDYHOQRQFRQIRUPHV
restreintes et associées à la seule récupération j OD UpJOHPHQWDWLRQ GH  PDLV DYHF XQH
d’eau de renouvellement pour les autres HDX GH ERQQH TXDOLWp HW GHV DSSRUWV G·HDX
piscines (pour l‘arrosage, le nettoyage MRXUQDOLHUVG·HQYLURQP3M
ou l’alimentation de chasse d’eau ; cette
récupération étant également faisable pour
les piscines publiques précédentes).
68
$ORUV TXH SDU DLOOHXUV G·DXWUHV SLVFLQHV GH beaucoup de chloramines ; ils ne sont en
 P DX[ QRUPHV UpFHQWHV HW GpVLQIHFWpHV général pas utiles sur les grands bassins ; et
DX FKORUH VWDELOLVp QpFHVVLWHQW GHV DSSRUWV ne concernent pas les bassins extérieurs.
MRXUQDOLHUVGHjP3M Le coût pour l’équipement d’une piscine
varie de 20 000 ! (prix d’un appareil seul)
à 70 000 ! en moyenne, en fonction du
- les produits de désinfection, et en nombre de bassins et du nombre de circuits
particulier l’emploi de chlore stabilisé. En GHÀOWUDWLRQ
effet, au fur et à mesure qu’on apporte du
chlore, il y a accumulation progressive dans $WWHQWLRQ  LO IDXW V·DVVXUHU TXH OH
l’eau d’acide isocyanurique. Celui-ci, à un V\VWqPH GH GpFKORUDPLQDWLRQ SURSRVp
certain niveau de concentration bloque la SDU OH IRXUQLVVHXU HVW DJUpH HQ )UDQFH
dissociation du chlore libre actif et rend la SRXU SRXYRLU O·LQVWDOOHU FH Q·HVW SDV
désinfection inopérante. Il devient alors OH FDV GH WRXV OHV IRXUQLVVHXUV OHV
nécessaire d’ajouter de l’eau pour diminuer UpJOHPHQWDWLRQV HXURSpHQQHV QH VRQW
la concentration en stabilisant. SDVKDUPRQLVpHVSRXUOHVSLVFLQHV 
Il faut donc retenir que la facilité d’emploi
et le confort d’utilisation (pour les yeux et Sur la base des quelques exemples
l’odeur) du chlore stabilisé ont aussi des girondins équipés de déchloraminateurs
contreparties en terme de consommations (Bègles, Le Bouscat, Pessac, Bordeaux),
d’eau plus élevées. Pour autant, l’utilisation en association à l’équipement hydro
d’un autre désinfectant (eau de javel, avec économe des sanitaires, ils permettent
éventuel ajout de stabilisant) doit être de réduire la consommation d’eau globale
analysée avant une éventuelle mise en oeuvre d’environ 25%, et d’atteindre des taux de
(le réglage des doses est délicat et nécessite renouvellement de 45 l/j/baigneur (grands
GXSHUVRQQHOTXDOLÀpHWGHVORFDX[DGDSWpV  bassins) à 60 ou 70 litres/jour/baigneur
Parmi les critères de choix, il est intéressant (petits bassins).
de noter que le surcoût de main d’œuvre est
plus que compensé par le plus faible coût des $WWHQWLRQ OHV GpFKORUDPLQDWHXUV
réactifs (l’eau de javel est peu onéreuse). JpQqUHQW GHV VRXVSURGXLWV 7+0 &27
HW FKORUXUHV  /·DXJPHQWDWLRQ GH OD
- le taux de chloramines : au contact de FRQFHQWUDWLRQ GH FHV VRXVSURGXLWV
composés organiques (ammoniac, urée…), le QpFHVVLWH SDUIRLV XQ UpDMXVWHPHQW j OD
chlore se combine et forme des sous-produits KDXVVHGXWDX[GHUHQRXYHOOHPHQWOHV
tels que les chloramines responsables de WDX[ GH FKORUXUHV VRQW JpQpUDOHPHQW
diverses irritations (yeux rouges, irritations de PHVXUpV OHV WDX[ &27 HW 7+0 OH VRQW
la peau et des bronches….). Celles-ci ont été SOXV UDUHPHQW PHVXUHV RQpUHXVHV  HW
reconnues comme maladies professionnelles VRQWjSUpYRLU
pour le personnel des piscines (entre autres),
et gênent les nageurs. On cherche donc à NB : un traitement à l’ozone peut avoir des
limiter les chloramines. Pour cela, il existe effets similaires aux déchloraminateurs.
plusieurs possibilités : Aucun exemple n’existe en Gironde.

‡ UHYRLU OH V\VWqPH GH YHQWLODWLRQ HQ 1%FHUWDLQVIRXUQLVVHXUVSURSRVHQWGHV


particulier au niveau du bac tampon (qui SURGXLWV TXL HPSrFKHQW OD IRUPDWLRQ
sert au mélange des adjuvants, qui ne sont GHV FKORUDPLQHV ,OV SHXYHQW SDUDvWUH
pas directement ajoutés dans l’eau de la DWWUD\DQWV FDU LO VHPEOH HIIHFWLYHPHQW
piscine mais dans le bac au préalable) ; SUpIpUDEOH G·HPSrFKHU OD IRUPDWLRQ
G·XQ SURGXLW SOXW{W TXH GH FKHUFKHU
‡ LQVWDOOHU XQ GpFKORUDPLQDWHXU ,O V·DJLW j OH GpWUXLUH FH TXL JpQqUH GHV VRXV
d’une lampe UV, basse ou moyenne pression, SURGXLWV  7RXWHIRLV j FH MRXU OHV
intégrée dans un cylindre métallique SURGXLWV VXU OH PDUFKp VRLW Q·RQW SDV
d’environ 1 m de hauteur, installée en GRQQpVDWLVIDFWLRQjPR\HQWHUPHHWRQW
GpULYDWLRQVXUOHFLUFXLWGHÀOWUDWLRQ(OOH pWpDEDQGRQQpV SURGXLWW\SH©5(9$&</
détruit les micro-organismes (bactéries, ª  VRLW QH VRQW SDV DJUppV HQ )UDQFH
virus, champignons) et les molécules de SRXUXQXVDJHGDQVOHVSLVFLQHV SURGXLW
chloramines (en les fractionnant), et jEDVHGHELR[\GHGHFKORUH 
améliore la qualité de l’eau et le confort
d’utilisation.

Cette désinfection est temporaire ;


elle n’a pas d’effet rémanent et doit
être complétée par une désinfection au
chlore.
Les déchloraminateurs sont bien adaptés
aux petits bassins couverts qui génèrent
69
š La seconde possibilité pour économiser l’eau   OHXU HQWUHWLHQ  LO HVW UDUHPHQW FRQÀp j
consiste à récupérer l’eau de surverse des SHUVRQQHO TXDOLÀp PDLV DX VXUYHLOODQW GH
bassins. Il s’agit en fait d’une substitution de baignade, qui ne dispose par ailleurs pas
ressource pour d’autres usages, comme : de moyen précis de contrôle et de suivi des
concentrations. L’emploi de chlore stabilisé
- l’alimentation des chasses d’eau des WC est quasi systématique (et adapté à ces
de la piscine (voire d’équipements sportifs moyens d’entretien).
ou de bureaux voisins), après dérogation
préfectorale. Cet aménagement est conseillé Dans ce contexte, on distinguera deux cas :
pour les piscines neuves. Il a un coût de
revient élevé s’il s’agit d’aménager les - les piscines d’hôtel, de résidence ou de
piscines existantes ; gîte, à très faible fréquentation,

- l’arrosage d’un parc entourant la piscine - les piscines de camping ou de centre sportif
RX GH ÁHXULVVHPHQWV j SUR[LPLWp YLD OH ou de soins, à très forte fréquentation.
remplissage de tonnes) ;
Les premières sont très peu fréquentées et
- le nettoyage de chaussée (remplissage des utilisent peu d’eau de renouvellement ou de
balayeuses), de véhicules ou de matériel ; il ODYDJH GHV ÀOWUHV 3RXU JDUDQWLU XQH WHQHXU HQ
est également nécessaire de se rapprocher FKORUH OLEUH VXIÀVDQWH GX FKORUH VWDELOLVp HVW
de la DDASS pour cela. ajouté ponctuellement. Quand les concentrations
en stabilisant sont trop importantes, des apports
3RXU FKDFXQ GH FHV FDV LO IDXGUD TXDQWLÀHU OH d’eau sont réalisés et une partie de l’eau est
besoin et déterminer le meilleur compromis surversée. On peut donc seulement envisager
pour dimensionner le stockage (plus le stockage des récupérations d’eau très ponctuelles et peu
est important plus on économise d’eau mais plus intéressantes.
l’investissement correspondant est important) ;
généralement le compromis retenu se situe entre Pour les secondes, en revanche, les apports
le besoin journalier et le besoin hebdomadaire. d’eau sont quotidiens, et beaucoup plus
importants. La DDASS constate même la plupart
(QÀQ LO IDXW QRWHU TXH O·HDX GH GpERUGHPHQW GXWHPSVTX·LOVQHVRQWSDVVXIÀVDQWV,OQHIDXW
ne peut pas être utilisée telle quelle pour donc pas les restreindre pour économiser l’eau.
l’arrosage du fait de sa concentration en chlore. En revanche, une partie peut être récupérée :
A titre de comparaison, la concentration en VLOHV\VWqPHGHÀOWUDWLRQQ·HVWSDVWURSDQFLHQ
chlore libre dans l’eau potable est de l’ordre de RXMXVWHVXIÀVDQWWRXWHO·HDXDSSRUWpHQHVHUW
0,2 mg/l ; elle est d’au moins 2 mg/l dans l’eau SDVDXUHWURODYDJHGHVÀOWUHVHWXQHSDUWLHGH
des piscines stabilisées. Le temps et l’aération l’eau de la piscine est vidée chaque jour. Cette
font assez rapidement baisser la concentration eau peut être utilisée pour les chasses d’eau
en chlore libre. Pour cela un stockage de l’eau des WC ou l’arrosage, moyennant l’installation
est nécessaire, ainsi que des aménagements d’un système de récupération et d’un stockage
particuliers (permettant une aération et un intermédiaire (avec les mêmes remarques que
WHPSV GH VpMRXU VXIÀVDQW RX WUDLWHPHQW SDU précédemment : dérogation préfectorale pour
les plantes : phytoremédiation…). Et ces l’utilisation dans les chasses d’eau et élimination
aménagements sont tout à fait réalisables sur d’une partie du chlore pour l’arrosage). Le
des piscines existantes (voir le cas de la piscine volume récupéré reste cependant assez faible
de Bègles en Gironde qui a mis en œuvre un (l’eau apportée compense aussi l’évaporation et
bassin de phytoremédiation). les débordements par éclaboussure, et on vide
très peu la piscine).
9,, 3LVFLQHV   P2 K{WHO
FDPSLQJUpVLGHQFHJvWHFHQWUHVSRUWLI« VII.1.4. RESTAURATION
Les exigences réglementaires sont identiques La consommation en eau pour l’usage restauration
pour toutes les piscines recevant du public, est ventilée de la manière suivante :
néanmoins les moyens différent, en particulier
pour la reprise de surface : elle peut être assurée - préparation des repas,
par des écumeurs de surface (« skimmer ») pour - eau de boisson,
OHVSLVFLQHVGHVXSHUÀFLHLQIpULHXUHjP2. Par - vaisselle.
ailleurs on rencontre peu de piscines construites
avant 1981 dans les hôtels, campings, gîtes, Il est envisageable d’optimiser les consommations
résidences ou centres sportifs. en eau pour le poste de lavage de la vaisselle.
Les consommations en eau pour la préparation
La consommation d’eau sur ce type de piscine des repas ainsi que celle destinée à la boisson
dépend donc peu de leur conception, mais plutôt VRQWGLIÀFLOHPHQWFRPSUHVVLEOHV
de :
- leur fréquentation,
70
Le lavage de la vaisselle peut être réalisé de La teneur en produits lessiviels peut être contrôlée
deux manières : par sonde. Ces appareils sont particulièrement
adaptés pour le lavage d’un grand nombre de
- manuellement : dans ce cas une inspection verres ou de plateaux (vaisselle peu sale).
des points de puisage devra permettre
de savoir s’il est envisageable ou non de 'qVORUVTX·LOHVWMXVWLÀpXQDSSDUHLOGHJUDQGH
positionner des réducteurs de débit en sortie capacité consomme moins que plusieurs appareils
ou des douchettes haute pression ; de capacités plus faible.

- avec appareillage (lave vaisselle, lave Pour les cuisines de plus petites tailles, ne
verres, laveuse à avancement, lave plateaux MXVWLÀDQWSDVGHWHOVpTXLSHPHQWVO·LQVWDOODWLRQ
lave ustensiles…). sur l’évier dédié à la vaisselle d’une douchette
de prélavage, couplée à un mitigeur double
butée, réduit la consommation d’eau de façon
VLJQLÀFDWLYH

VII.1.5 LAVAGE DU LINGE

Le premier axe d’amélioration réside dans le


bon choix de la capacité du lave-linge :

 GqV ORUV TX·LO HVW MXVWLÀp SRVVLELOLWp GH


Illustration N°19 : mélanger différentes sortes de linge et volume
Lave verres (Source : http://www.alicomenda.fr/)
GH OLQJH VXIÀVDQW  XQ DSSDUHLO GH JUDQGH
capacité consomme moins que plusieurs
appareils de capacités plus faible ;

- a contrario, l’utilisation en sous charge


des appareils est très consommatrice, il faut
mettre en place une utilisation favorisant les
pleines charges et bien choisir la capacité des
appareils.

1%  LO HVW UHFRPPDQGp GH SULYLOpJLHU OHV


Illustration N°20 : ODYHOLQJH GH FDWpJRULH pQHUJpWLTXH $ TXL
Laveuse à avancement (Source : http://www.alicomenda.fr/)
VRQW VRXYHQW DXVVL RSWLPLVpV SRXU OHXU
FRQVRPPDWLRQG·HDX

Le second axe d’amélioration consiste à


récupérer certaines eaux pour les réemployer :

- eau de rinçage pour le lavage,

- eau de refroidissement (des systèmes de


nettoyage à sec par exemple) pour le lavage
ou le rinçage.
Illustration N°21 :
Lave plateaux (Source : http://www.alicomenda.fr/) (QÀQ FRPPH OH IRQW GpMj FHUWDLQHV FKDvQHV
hôtelières par exemple, et hors contexte
médical, le lavage de certains linges peut
Les appareils de lavage sont moins gourmands en être fait sur demande seulement (et non pas
eau par rapport au lavage manuel. Une machine systématiquement).
professionnelle de petite capacité va par exemple
consommer 3 litres par cycle pour le lavage de VII.1.6 NETTOYAGE
36 verres ou 18 assiettes, alors qu’une vaisselle
manuelle consommera entre 20 et 40 litres, Ce poste de consommation est souvent perçu
et qu’un lave-vaisselle classique consommer comme gros consommateur. En réalité, des
environ 20 litres. La faible consommation en eau techniques récentes, mises en œuvre pour gagner
de ces appareils professionnels s’explique par du temps, ont souvent déjà permis d’optimiser
une réutilisation de l’eau (système de recyclage la consommation d’eau. Néanmoins certaines
HW ÀOWUDWLRQ  SRXU OH F\FOH GH ODYDJH VXLYDQW WHFKQLTXHV HW PRGLÀFDWLRQV GH FRPSRUWHPHQWV
Avec un réservoir interne pouvant aller jusqu’à permettent d’aller plus loin.
100 litres, 3 litres sont apportés (renouvellement
en eau du réservoir interne) à chaque cycle de
rinçage.

71
9,,1HWWR\DJHGHVVROV FHWWH SUDWLTXH LPSRVVLEOH  HQ SDUDOOqOH GH
O·LQVWDOODWLRQ GHV OLPLWHXUV GH GpELW j XQ
Le nettoyage des locaux (lavage des surfaces, GpELW SOXV LPSRUWDQW HQ JpQpUDO TXH FHOXL
pour l’essentiel le sol) peut s’effectuer de deux G·XQOLPLWHXUGHGpELWFODVVLTXHDVVRFLpjXQH
façons : KDXWHSUHVVLRQ 

- lavage manuel (serpillière, lave pont, …). 9,, 1HWWR\DJH GHV FKDXVVpHV RX
Technique adaptée pour des surfaces de SDUNLQJV
SHWLWHVWDLOOHVHWGLIÀFLOHPHQWDFFHVVLEOHV
Le nettoyage des chaussées ou parkings nécessite
- lavage mécanique (auto-laveuse), technique en moyenne environ 5 litres/m2. On peut limiter
adaptée pour des surfaces importantes. ce volume en faisant évoluer :
Consommation en eau variable (5 à 50 litres
/h), fonction de la puissance de l’appareil et - les mentalités : toutes les voiries
du programme utilisé. nécessitent-elles un nettoyage à l’eau aussi
régulier ? Toutes les parties de la chaussée
$ÀQ G·RSWLPLVHU  OD FRQVRPPDWLRQ HQ HDX GHV doivent-elles être lavées à l’eau ?
auto-laveuses, il est nécessaire de prendre en Par exemple, la mairie de Bordeaux a opté
compte les éléments suivants : récemment pour un nettoyage à l’eau (au jet
haute pression) des trottoirs et caniveaux,
- utiliser une machine adaptée à la surface à et pour un simple balayage mécanisé des
traiter ; chaussées, aussi souvent que possible.
L’ancienne pratique des balayages de
- respecter le carnet d’entretien de l’appareil FKDXVVpHVjO·HDXDpWpWUqVVLJQLÀFDWLYHPHQW
et procéder aux nettoyages réguliers des réduite. Cela a nécessité un changement
ÀOWUHV des pratiques du personnel (la tâche est
moins aisée sans eau, en particulier sous
- s’assurer du bon usage de l’appareil par les voitures en stationnement), ainsi qu’un
l’utilisateur. travail supplémentaire d’explication auprès
de la population.
Certaines techniques de nettoyage à base
de mousse sans rinçage sont également très - et/ou les techniques : les chasses d’eau dans
performantes et très peu consommatrices en les caniveaux étant bien entendu bannies,
eau. on peut aussi opter pour des techniques bas
débit et haute pression pour le nettoyage
des voieries. Pour ce point, le retour sur
expériences montre que les appareils très
EDV GpELW QH QHWWRLHQW SDV VXIÀVDPPHQW
bien : il vaut mieux alterner balayage simple
et nettoyage haute pression à l’eau, en
FRQVHUYDQW SRXU FHOXLFL XQ GpELW VXIÀVDQW
Illustration N°22 : et sensibiliser le personnel à un usage mesuré
Autolaveuse (Source : www.agroprocess.net)
du jet.

Après l’optimisation des consommations, la


recherche d’une ressource de substitution est
largement conseillée.

9,, 1HWWR\DJH GHV YpKLFXOHV RX


PDWpULHOV

Illustration N°23 : Ce poste, rarement cité en première analyse,


Autolaveuse (Source :www.fastandclean.biz) consomme souvent autant que le poste de
nettoyage des voiries, et peut généralement
être nettement réduit (contrairement au
$ QRWHU  3RXU OH QHWWR\DJH GHV VXUIDFHV GH
précédent).
SURGXFWLRQ SUpSDUDWLRQ GH UHSDV RX GH
GHQUpHV DOLPHQWDLUHV GpFRXSDJH SURFHVV« 
Là encore, les techniques de lavage bas débit et
RQUHQFRQWUHVRXYHQWGHVJDVSLOODJHVG·HDXSDU
haute pression permettent des économies d’eau
GHVXVDJHUVTXLpYDFXHQWjO·HDXGHVGpFKHWV
VLJQLÀFDWLYHVVXUWRXWSRXUOHVYpKLFXOHV3RXUOH
JURVVLHUV SOXW{W TXH GH EDOD\HU DX SUpDODEOH
matériel de tonte ou autre, la conservation d’un
HW G·DVSHUJHU OpJqUHPHQW DX MHW HQVXLWH ,O
débit assez élevé est parfois nécessaire.
IDXW SUHQGUH HQ FRPSWH FHV KDELWXGHV HW
FKHUFKHUjOHVPRGLÀHU RXPHWWUHHQSODFHGHV
JULOOHV G·pYDFXDWLRQ GHV HDX[ À[HV UHQGDQW

72
Le gain dans ce cas provient d’une sensibilisation système performant de régulation de l’appoint
accrue et d’une discipline imposée au personnel d’eau (pas de déconcentration continue,
(attention aux robinets laissés ouverts, nettoyage manuelle ou chrono-proportionnelle mais une
des matériels aussitôt après l’utilisation,…). régulation en fonction de la qualité d’eau).

(QÀQ DSUqV O·RSWLPLVDWLRQ GHV FRQVRPPDWLRQV VII.1.8 ARROSAGE


la recherche d’une ressource de substitution est
largement conseillée. $ O·KHXUH DFWXHOOH LO Q·HVW SOXV DFFHSWDEOH
G·XWLOLVHUO·HDXSRWDEOH RXXQIRUDJHGDQVXQH
VII.1.7. CLIMATISATION QDSSHGpÀFLWDLUHGX6$*( SRXUXQDUURVDJHHQ
JUDQGHTXDQWLWp6HXOHVFHUWDLQHVFRQÀJXUDWLRQV
9,,&OLPDWLVDWLRQjHDXSHUGXH particulières ou de très faibles besoins peuvent le
MXVWLÀHU URQGVSRLQWVDUURVDJHjODWRQQHG·XQ
Actuellement ce cas est exceptionnel. La petit nombre de plates-bandes ou jardinières,
réduction de consommation devra être totale, il période de plantation d’arbustes...). Pour
n’est en aucune manière admissible de refroidir l’usage « arrosage » , il faut donc rechercher
une installation de climatisation par de l’eau une ressource de substitution, mais auparavant,
du réseau d’eau potable. La solution est soit la quantité d’eau utilisée doit être optimisée (on
de remplacer le climatiseur à eau perdue par prélèvera d’autant moins dans cette nouvelle
un climatiseur à refroidissement par air, soit ressource et les investissements correspondants
de créer un réseau d’eau bouclé refroidi par un seront réduits). Il faut aussi savoir renoncer à
aérorefroidisseur. une ressource de substitution en cas de coût
prohibitif.
9,, &OLPDWLVDWLRQ j UHIURLGLVVHPHQW
SDUWRXUGHUHIURLGLVVHPHQW Ce paragraphe présente les différents facteurs
sur lesquels on peut agir pour optimiser la
Les tours aéroréfrigérantes sont des équipements consommation d’eau :
très consommateurs en eau (minimum de l’ordre
de 10 000 m3/an). Pour réduire la consommation ™des espèces végétales adaptées (résistantes
d’eau de ce système, on peut envisager le à la sécheresse),
remplacement de la tour de refroidissement
consommatrice d’eau par un aérorefroidisseur š une conception décorative qui limite les
sec, mais : espaces végétalisés arrosés (arbres, prairie
naturelle, minéraux colorés,…),
- la puissance nécessaire à la production de
froid ne sera éventuellement pas possible à › des aménagements qui limitent les pertes
atteindre par un refroidissement sec, en eau (paillage, haies...),

- le rendement énergétique de l’installation œ une fréquence d’arrosage strictement


sera grandement affecté : par exemple adaptée au besoin des plantes, au sol et à la
pour des systèmes de puissance équivalente saison,
à celle nécessaire à un hypermarché, un
aérorefroidisseur sec consomme environ 20%  des émetteurs d’arrosage adaptés aux
d’énergie supplémentaire par rapport à une plantations et limitant l’évaporation.
tour de refroidissement. L’énergie ayant
un coût très supérieur à l’eau, le coût de 'HV FRPSOpPHQWV XWLOHV VHURQW IRXUQLV SDU OH
fonctionnement global est un peu augmenté, ©JXLGHGHVERQQHVSUDWLTXHVGHO·DUURVDJHGHV
bien que l’on en consomme plus d’eau. HVSDFHVYHUWVHWGHVWHUUDLQVGHVSRUWªpGLWp
SDU OH 60(*5(* HW WpOpFKDUJHDEOH VXU OH VLWH
En revanche un système sec évite les risques ZZZMHFRQRPLVHOHDXRUJ
de légionellose et leur surveillance très
contraignante. 9,, (VSqFHV YpJpWDOHV SHX
FRQVRPPDWULFHVG·HDX
En conséquence, le remplacement éventuel des
installations de climatisation équipées d’une Le choix des espèces végétales a une grande
boucle de refroidissement refroidie par tour de importance sur la consommation d’eau : une
refroidissement par une installation « sèche » doit plante vivace consomme en moyenne 2 fois
au préalable faire l’objet d’une étude complète moins d’eau qu’une plante annuelle, et au bout
de substitution de technologie. de 3 ans un arbuste ne nécessite plus d’arrosage.
,OQHV·DJLWSDVGHVXSSULPHUOHVÁHXULVVHPHQWV
En ce qui concerne le fonctionnement de la ou zones végétalisées mais de bien de choisir.
tour de refroidissement si elle est conservée,
O·pFRQRPH GH ÁX[ GHYUD YpULÀHU TXH O·DSSRUW
en eau est réalisé de manière optimale avec un

73
Il est préconiser de remplacer : De même une tonte plus haute permet au sol
de moins se dessécher et au végétal de mieux
 OHV ÁHXUV DQQXHOOHV RX WDSLV GH ÁHXUV SDU résister à un manque d’eau.
GHV SODQWHV YLYDFHV RX GHV DUEXVWHV ÁHXULV
Ils demanderont aussi une main d’œuvre plus 9,,)UpTXHQFHGHVDUURVDJHVDGDSWpV
restreinte pour leur entretien (et permettront DX[SODQWHVDXVROHWjODVDLVRQ
l’installation de goutte à goutte, impossible
VXUPDVVLIVGHÁHXUV  Le végétal a besoin d’une certaine quantité d’eau
par jour pour assurer son bon développement.
([HPSOH1ƒSODQWHVjIDLEOHVEHVRLQVHQ Un apport supérieur aux besoins n’entraînera
HDX pas une croissance accrue du végétal. Par
contre les frais inhérents à l’arrosage seront
- arbres : mûrier, chêne vert, frêne à plus importants et l’enracinement du végétal et
ÁHXUV WDPDULV SODWDQH pUDEOH DFHU donc sa résistance à la sécheresse seront moins
opalus pseudoplatanus), micocoulier, frêne bons.
oxygearpa,…
9,,3URJUDPPDWLRQ
- arbustes : arbousier, olivier, romarin, buis,
cotinus, cotonaester rampant, eleagnus,… Il est donc indispensable d’avoir une régulation
optimisée de son arrosage et c’est l’amélioration
- DUEXVWHV ÁHXULV : cinéraire, sauge, la plus facile à apporter et la moins onéreuse.
hélichrysum, ricin, abélia, viburnum, Un programmateur (relié aux électrovannes) est
escallonia, caryoptéris, nérium oléander, nécessaire avec une programmation en fonction
buddleia, callistermon… des besoins saisonniers en volume (et non pas
en temps d'arrosage, source fréquente de doses
- ÁHXUV RX JUDPLQpHV GpFRUDWLYHV : fétuque excessives). Il doit être complété par l’un des
plamia, herbe de la pampa, lavande, tanaisie, appareils suivants :
NLSSLDPRGLÁRUDVpGXP«
- un pluviomètre (mesure des précipitations) : il
déclenche le système d’arrosage en cas de
- gazons : remplacer les espèces de graminées
GpÀFLW SOXYLRPpWULTXH HW O·DUUrWH TXDQG LO
des gazons (généralement ray grass anglais)
pleut. Il est toutefois peu adapté en cas de
par des espèces moins consommatrices
vandalisme possible ou d'implantation à l'abri
(mélange de fétuque élevée, de pâturin et de
(préférer dans ce cas un tensiomètre),
ray grass pour les terrains de sports et prairie
naturelle ou sédum pour les espaces de plein - si le végétal est sensible à la sécheresse,
air ou sous les arbres). et d’autant plus que l’on retient des doses
d’arrosage très strictes, un tensiomètre
9,, &RQFHSWLRQ QpFHVVLWDQW PRLQV (mesure du taux d’humidité dans le sol) : il
G·DUURVDJH adapte les doses d’arrosage en fonction de
la réserve utile réellement présente dans
Des aménagements paysagers faisant plus de le sol. Il a toutefois un rayon d'action plus
place aux décors minéraux ou métalliques (voire limité que le pluviomètre (la nature du sol
des éléments végétaux morts de type bambous peut être très variable),
ou troncs d’arbre) peuvent être une alternative
- le cas échéant, un anémomètre (mesure de
intéressante, tout comme la plantation d’espèces
la force du vent): il suspend les arrosages par
végétales peu gourmandes en eau associée à des
vent fort. Il est particulièrement recommandé
blocs de pierre. En effet le décor minéral fera
pour les systèmes à enrouleur,
DORUVRIÀFHGHEDUULqUHSURWHFWULFHOLPLWDQWDLQVL
l’action du vent et de l’évaporation et servira - un arrosage en 2 temps (5 minutes pour
GHVXSSRUW À[DWLRQ SRXUGHVYpJpWDX[DGDSWpV mouiller le sol, 1 arrêt, puis une reprise
à des conditions extrêmes. de l'arrosage qui pénètre en totalité)
permet d'économiser de l'eau, mais génère
9,,/LPLWDWLRQGHVSHUWHVHQHDX un vieillisement prématuré du matériel
d'arrosage.
Un paillage au pied des plantes (écorces, toile,
épandage de compost,…) ou l’épandage de  (QÀQ LO H[LVWH GHV YDQQHVVXSHUYLVHXUV
mulch permet de réduire les pertes en eau au de débit qui coupent l'eau quand le volume
niveau du sol. d'eau prévu a été délivré : elles sont très
interressantes pour limiter les volumes de
Une couverture végétale couvrante peut aussi fuites liés aux vandalismes (arrosage en
être intéressante en pied d’arbuste. continu du fait du matériel endommagé).
La mise en place de haies permet aussi de
diminuer les pertes en eau dues à l’évaporation
(par le vent).

74
SYNOPTIQUE N°3 : COMMENT PROCÉDER POUR OPTIMISER
LES CONSOMMATIONS D’EAU D’ARROSAGE ?

"$! $

   $!  !  % !&  %(&



 
$  
!   5  


$   


                          !   
     &1
0' . 
#
   
  
      !
"""
  ##  

!  ! $   % !&  %(&


!      5 "   
!

$ '  !  


! !   "  
(     !      +!  
% 
 ., *
(  )
 "  "          "    ) 
" 4 3

!  ! $   % !&  %(&


*!   !        5""
)!       
$ 

 2  " 
           !    
    /- 
  " " 
  "
   "  
& 2 
"2'
 ,-!*

75
9,,'LVVRFLDWLRQGHO
DUURVDJH - Turbines et tuyères escamotables

4XDQG OH WHUUDLQ j DUURVHU D XQH VXSHUÀFLH Ce matériel encastré dans le sol permet
importante, il est judicieux de prévoir une d’arroser des surfaces engazonnées importantes
dissociation de l’arrosage en différents secteurs, et des massifs. Ce système présente l’avantage
en fonction des besoins des plantes (par exemple de pouvoir assurer un réglage précis de la
les gestionnaires de golfs arrosent beaucoup les zone d’arrosage (rayon d’action, débit,…),
greens et les départs, tondus ras, et arrosent et de pouvoir fonctionner seul, en l’absence
moins, voiree pas du tout, le reste du parcours) de personnel, donc aux heures fraîches
et des sols (la même plante nécessitera des (contrairement au système précédent).
arrosages plus fréquents et un peu plus importants
sur un sol sableux que sur un sol argileux).
Cela nécessite toutefois des investissements
plus importants (programmateurs multivoies,
électrovannes, …).
Illustration N°25 :
Tuyère (Source : Les bonnes pratiques de l’arrosage
9,, *HVWLRQ WHFKQLTXH FHQWUDOLVpH des espaces verts et des terrains de sport)
*7&
Certains arroseurs avec des débits plus faibles
(QÀQ SRXU OHV JUDQGV HVSDFHV YHUWV RX OHV et des portées plus longues et/ou avec des
multiples espaces verts ou sportifs, un système régulateurs de pression intégrés permettent de
commandant les différents programmateurs peut mieux réguler les débits délivrés et de réaliser
être relié à une centrale de gestion informatisée, GHVpFRQRPLHVG
HDXVLJQLÀFDWLYHV
qui peut elle même être en relation avec une
station météo locale. En fonction du budget et - Microjets
du nombre de sites à gérer, il existe des systèmes
radio (programmation et relève des données lors Système bien adapté à l’arrosage des massifs
d'un simple passage de voiture à proximité des ÁRUDX[ O·DUURVDJH HVW SUpFLV HW FRQVWLWXp GH
boitiers autonomes) ou des systèmes en liaison petites gouttes. L’arrosage à même le sol
constante (GSM, …) plus onéreux. permet d’éviter une trop grande dispersion des
gouttelettes.
Ce type d’installation, appelée gestion technique
centralisée (GTC) permet d’optimiser les apports
en eau car :
Illustration N°26 :
- le système facilite la multiplication de tests Microjet (Source : Les bonnes pratiques de l’arrosage
qui permettent de déterminer au plus juste des espaces verts et des terrains de sport)
les doses d’arrosage optimum;
- il est aisé de programmer différemment - Goutte à goutte
les équipements en fonction des sols, des
nouvelles plantations et de réajuster les L’arrosage au goutte à goutte est optimal car
doses si les plantes souffrent. On hésite donc il limite au maximum l’évaporation et apporte
moins à prévoir des doses très justes; l’eau au pied des plantations. Ce matériel
est bien adapté dans le cas de l’arrosage de
- les doses peuvent être déterminées en haies, d’arbustes, de plantes vivaces, et de
tenant compte des prévisions climatiques jardinières. Il n’est pas envisageable sur des
locales (on n’arrose pas s’il va pleuvoir). gazons mais peut parfois l'être sur des massifs
GHÁHXUV DYHFGHVVHUSHQWLQVRXGHVVWUXFWXUHV
en quadrillage démontables). Pour être mis en
9,,(PHWWHXUVG·HDXDGDSWpV place cet arrosage optimum nécessite souvent
une optimisation des espèces végétales.
- L’enrouleur

Cet émetteur est surtout utilisé pour l’arrosage


de surfaces engazonnées importantes (stades
et espaces verts). Il est indispensable de tenir
compte de la présence ou non de vent lors de Illustration N°27 :
Goutte à goutte (Source : Les bonnes pratiques de
O·XWLOLVDWLRQGHFHV\VWqPHGXIDLWGHO·LQÁXHQFH l’arrosage des espaces verts et des terrains de sport)
de ce dernier sur la répartition de l’arrosage.
9,,*HVWLRQGLIIpUHQFLpHGHVHVSDFHV
YHUWV

Au delà de la gestion raisonnée de l’arrosage, un


Illustration N°24 : plan de gestion différenciée des espaces verts
Enrouleur (Source : Les bonnes pratiques de l’arrosage recherche des perspectives sur le long terme de
des espaces verts et des terrains de sport)
reconquête écologique, paysagère et sociale.
76
Il s’agit d’une démarche globale qui se met en OH JUDSKLTXH FLGHVVRXV VXLWH j OD PLVH
place progressivement. HQ SODFH GH FRPSWHXUV RQ D REVHUYp GHV
L’objectif premier est l’entretien des espaces EDLVVHV GH FRQVRPPDWLRQ GH  j  VXU
YHUWV HQ YLOOH VHORQ OHXU VSpFLÀFLWp SD\VDJqUH GX ORJHPHQW FROOHFWLI. En effet, le paiement
et leur fonction dans l’espace urbain. Depuis des m3 consommés (et non plus d’un forfait)
l’émergence du concept de « ville durable » responsabilise l’habitant consommateur.
(charte d’Aalborg en 1994) la gestion différenciée
est devenue un moyen de conserver ou même
d’augmenter la biodiversité ordinaire au sein
des espaces bâtis.

Concrètement, cette gestion des espaces verts


nécessite un décloisonnement des services
(avec la voirie pour les aspects propreté et
phytosanitaire, ou l’urbanisme pour pérenniser
la démarche), une organisation matérielle
Illustration N°28 :
différente (fauchage, temps de réaction plus Baisse des consommations d’eau dans les immeubles collectifs
long en cas de traitements naturels,…) et une liée à la mise en place de compteurs individuels
formation du personnel.
Pour des établissements tertiaires en revanche,
3RXU GH SOXV DPSOHV UHQVHLJQHPHQWV le personnel ou les usagers ne paient pas
YRXV SRXYH] FRQVXOWHU OH VLWH ZZZ directement la facture d’eau et ne peuvent pas
JHVWLRQGLIIHUHQFLHHRUJ être motivés de cette manière directe. Il faut :

- leur faire connaître l’information,


([HPSOH 1ƒ    9LOOHV D\DQW DGRSWp XQH régulièrement,
JHVWLRQGLIIpUHQFLpHGHOHXUHVSDFHVYHUWV
- et les impliquer, dans leurs gestes quotidiens,
Lille, Rennes, forêt de Mormal, parc Urbain pour atteindre le même type de résultats. Car
naturel de Lomme, Grande Synthe, Sailly sur la simple pose de compteurs divisionnaires
la lys, Faches Thumesnil, Bruxelles, Lausanne, sans relèves fréquentes, traitement et
Bordeaux, Bègles, Gradignan, Mérignac, Pessac, transmission de l’information ne sert à rien.
Libourne.
C’est pourquoi, la pose et le suivi de compteurs
sont considérés, dans les établissements
VII.2. ECONOMIES ACTIVES tertiaires, comme une économie active.

/HV pFRQRPLHV © DFWLYHV ª UHOqYHQW GH A long terme, on considère que la sensibilisation
FKDQJHPHQWV GH FRPSRUWHPHQW GHV XVDJHUV du personnel et des usagers peut donner le
&HVDFWLRQVSRXUrWUHHIÀFDFHVGRLYHQWrWUH même type de résultats sur des établissements
PHQpHV VXU GHV SpULRGHV ORQJXHV (W HOOHV tertiaires que sur de l’habitat (25%, voir
SRUWHQW OHXUV IUXLWV j ORQJ WHUPH (OOHV VRQW paragraphe suivant). Une part de ce pourcentage
XQ FRPSOpPHQW IRQGDPHQWDO DX[ pFRQRPLHV peut être obtenue à court terme à travers le suivi
SDVVLYHVGpFULWHVSUpFHGHPPHQW régulier des consommations et la recherche de
fuites. Elle est évaluée à environ 5 % du volume
Les principales actions générant des économies total consommé, sur la base du résultat mesuré
d’eau actives sont décrites dans les paragraphes depuis 4 ans par la ville de Mérignac, pour un
suivants ; il s’agit de : parc d’environ 400 compteurs.
- comptage et suivi des volumes d’eau
consommés, avec le cas échéant recherche 3UpFLVLRQGXFRPSWDJH
de fuites,
- information et sensibilisation du personnel Pour qu’un dispositif de comptage soit pertinent
et des usagers, pour la détection et surtout la localisation de
fuite, il est nécessaire que le périmètre, ou
- maintenance des équipements. les usages associés à chaque compteur soient
limités. Il faut donc généralement prévoir la
VII.2.1. COMPTAGES ET SUIVI DES VOLUMES pose de sous-compteurs privés (ou compteurs
CONSOMMÉS divisionnaires), en complément des compteurs
d’abonnement à l’eau potable.
7\SHHWSRXUFHQWDJHG·pFRQRPLHG·HDXLQGXLWV
Outre une détection de fuite facilitée, ils
Dans l’habitat, la simple mise en place de permettent aussi de d’établir un bilan de la
compteurs individuels est un facteur d’économie situation initiale (avant travaux de réduction des
(passive) important. $LQVL FRPPH O·LOOXVWUH FRQVRPPDWLRQV HWGHTXDQWLÀHUOHVpFRQRPLHV
d’eau réalisées.
77
([HPSOH1ƒ,PSODQWDWLRQVGHFRPSWHXUV - il est plus économique, si c’est réalisable,
GLYLVLRQQDLUHV d’utiliser une installation de gestion technique
centralisée existante sur le site (pour l’énergie
- pour un site public regroupant la mairie,
ou le suivi de la production) et d’y raccorder
l’école et un stade, prévoir un compteur
un système dédié aux compteurs d’eau. De
pour chacun des postes suivants : arrosage
la même façon, si aucune gestion technique
(du stade et éventuellement du parterre
centralisée n’existe, il est intéressant de
ÁHXULGHYDQWODPDLULH YHVWLDLUHVEkWLPHQW
prévoir la possibilité de gérer conjointement
administratif, et école ;
WRXWHV OHV FRQVRPPDWLRQV HQ ÁXLGH HDX
- pour une clinique, prévoir un compteur pour gaz, électricité) ;
chacun des bâtiments, pour la laverie, ainsi - il existe des reports d’index simples
que pour l’arrosage. TXL SHUPHWWHQW G·DIÀFKHU j XQ HQGURLW
accessible et visible l’index d’un compteur
peu accessible.
(TXLSHPHQWSRXUOHUHOHYpGHVFRPSWHXUV Deux types d’appareils existent : des reports
de l’index réel du compteur (environ 220!/U)
L’équipement à prévoir varie quant à lui en et des reports plus basiques (pour un coût
fonction du budget disponible et du nombre et PRLQGUH HQYLURQ ½8 LOV Q·DIÀFKHQW SDV
de la dispersion des compteurs : le même index que le compteur mais partent
de 0 au moment de leur installation ; cela
- pour les sites tertiaires simples, un simple peut être source d’erreur).
relevé mensuel des index des différents
compteurs d’abonnements à l’eau potable
VXIÀW 8QH IRLV VDLVLHV GDQV XQ WDEOHXU 3URFpGXUH GH VXLYL GHV FRQVRPPDWLRQV j
informatique (graphique conseillé), il permet de PHWWUHHQ±XYUH
détecter rapidement les éventuelles fuites ;
Quelle que soit l’étendue du patrimoine, un plan
- pour des sites plus complexes ou aux GHFRPSWDJHHWGHVXLYLHIÀFDFHFRPSRUWH
FRPSWHXUV GLIÀFLOHV G·DFFqV OHV UHOHYpV
- un plan schématisé clair du site avec repérage
peuvent être facilités (report d’index par
des compteurs et des sous compteurs ;
radio, avec un rayon d’action de 100 à 700m
selon les fournisseurs) ou réalisés à distance, - un relevé régulier des compteurs. Il est
automatiquement (télé relève radio) ou lors conseillé de relever les compteurs au minimum
d’un simple passage d’un appareil de relève tous les mois, autant que possible le même
à proximité (relève radio par un appareil jour. Pour les établissements ou patrimoines
embarqué dans un véhicule). importants, une relève automatisée (radio,
GSM…) est recommandée ;
Un des systèmes les plus performants correspond
- un traitement informatique des données
à la télé relève radio, qui permet une
(cela peut être simplement réalisé sous
gestion technique centralisée YRLU OH FDKLHU
Excel) fera au minimum apparaître les
WHFKQLTXH 1ƒ © /H FRPSWDJH ª UpDOLVp SDU
consommations par compteur en valeurs
O·2IÀFH LQWHUQDWLRQDO GH O·HDX GLVSRQLEOH DX
journalières, mensuelles et cumulées sur
60(*5(* . Pour tous ces cas, le compteur devra
l’année.
pouvoir être équipé d’une tête émettrice YRLU
Au bout d’une année environ, on pourra
SDUDJUDSKH©PHVXUHGHGpELWSRQFWXHOOHª .
déterminer le seuil d’alerte ou éventuellement
les seuils d’alerte en fonction des éventuelles
D’autres équipements que les compteurs
périodes d’activité ou de fréquentation. D’où
classiques peuvent être également utilisés,
l’intérêt de mettre en place la procédure de
il s’agit des appareils décrits au paragraphe
suivi des compteurs (ainsi que les compteurs
« mesure de débit ponctuelle », qui sont installés
divisionnaires le cas échéant) largement
GHPDQLqUHÀ[H,OVVRQWDVVH]RQpUHX[HWVRQW
avant le début du programme de réduction
donc réservés aux consommations importantes
des consommations ;
(et aux gros diamètres de canalisation). Pour les
petits diamètres de canalisation, les compteurs - d’autant plus que le site est complexe, une
et les équipements précités restent les mieux indication des grandeurs caractéristiques et
adaptés. dates utiles à l’analyse des consommations :
fréquentation de la restauration, date de mise
Remarques : en route de l’arrosage, nombre de salariés
- pour les sites isolés à faible consommation présents sur le site, quantités produites… ;
d’eau, qui peuvent présenter une fuite,
- une synthèse annuelle.
mais qui ne sera pas détectée rapidement,
il faudra comparer le coût d’un éventuel
équipement de report d’index à celui d’une
vanne de coupure d’eau automatique en cas
de fuite (380! pièce) ;
78
([HPSOH 1ƒ   5HOqYH PHQVXHOOH GHV Ø14 à Ø32 : 200 à 2 000 litres/heure, soit
FRPSWHXUVGHÁXLGH environ 1 800 à 17 500 m3/an,

Tous les établissements Mac Donald’s procèdent - fente sur canalisation PVC de diamètre
à un relevé mensuel de leurs compteurs d’eau,de inférieur à Ø60 sous 3 bars de pression :
gaz et d’électricité. environ 300 litres/heure, soit environ 2 600
m3/an,
- fuite sur canalisation de diamètre supérieur
VII.2.2. RECHERCHE DE FUITES
à Ø80 : en moyenne 10 m3/h, soit 90 000 m3/
an.
4XDQWLÀFDWLRQGHODIXLWH
Elles ne sont pas toujours visibles (terrain
La première étape de recherche de fuite consiste SHUPpDEOH RX ÀVVXUp HW FDQDOLVDWLRQ HQWHUUpH
j TXDQWLÀHU OD IXLWH (OOH VHUD SOXV IDFLOH j profondément, proximité d’un drainage….). Les
localiser si on a une idée de l’importance de la exploitants d’eau potable considèrent en effet
fuite à rechercher. Par ailleurs, il peut y en avoir qu’une fuite sur branchement (sous chaussée,
plusieurs, surtout si on recherche des fuites trottoir ou terrain compacté), inférieure à 500
anciennes. Il faut donc être sûr de les avoir litres/heure (soit 4 400 m3DQ HVWGLIÀFLOHPHQW
toutes trouvées. GpWHFWDEOHVDQVpTXLSHPHQWVSpFLÀTXH

3RXUFHODGHX[FDVGHÀJXUHVHSUpVHQWHQW ([HPSOH1ƒ)XLWH

- s’il s’agit d’une fuite ancienne, ou assez L’établissement CITRAM à Bordeaux (gare
IDLEOHIDLUHXQUHOHYpOHVRLUHQÀQG·DFWLYLWp routière autobus de Bordeaux pour le
et le matin avant la reprise de l’activité. S’il département de la Gironde) a vu en 2006 ses
HVWSRVLWLIOHFRQÀUPHUSDUXQVHFRQG efforts d’optimisation des consommations d’eau
- s’il s’agit d’une fuite importante, il y a nettement réduits (l’entreprise récupère de
XUJHQFHjODORFDOLVHU,OVXIÀWGDQVFHFDVGH O·HDX GH SOXLH SRXU OH QHWWR\DJH G·XQH ÁRWWH
SURFpGHU j XQH TXDQWLÀFDWLRQ VRPPDLUH SDU d’environ 300 cars) par une fuite au pied d’un
différence entre : robinet très peu utilisé à l’extrémité de son
parking. Cette surconsommation de 8 000 m3, n’a
‡ OD PR\HQQH MRXUQDOLqUH KDELWXHOOH été détectée que lors de la relève du compteur
(consommation des 3 dernières années / par l’exploitant du réseau d’eau potable.
365 * 3),
‡ HW XQ GRXEOH UHOHYp GX FRPSWHXU j  /RFDOLVDWLRQGHODIXLWH
minutes d’intervalle, que l’on multiplie
par 288 (il y a 288 fois 5 minutes dans 24 Les fuites peuvent se produire sur le réseau
heures). interne, sur les accessoires de ce réseau
(purges, vannes, ventouses), sur les dérivations
Si la localisation de la fuite prend du temps, secondaires vers les bâtiments (assimilables
noter à deux reprises au moins l’index du à des branchements) ou sur les équipements
compteur et l’heure précise. de fourniture d’eau. Ils se produisent le plus
souvent sur les 3 derniers postes énumérés.
([HPSOH1ƒ9ROXPHVGHIXLWH
Les fuites peuvent avoir plusieurs causes :
Les valeurs de débit suivantes témoignent
qu’une fuite apparemment anodine représente - la vétusté des conduites et leurs conditions
un volume souvent important en cumulé sur de pose,
l’année : - la nature du terrain, et la circulation
- robinet ouvert à fond : environ 700 litres/ d’engins ou de véhicules lourds,
heure, soit environ 6 000 m3/an, - la qualité de l’eau (un pH acide – inférieur
ÀOHWG·HDX URELQHWPDOIHUPp OLWUHV à 7 – peut accélérer le processus de corrosion)
heure, soit environ 130 m3/an, et les conditions hydrauliques (par exemple
trop de pression ou de fortes variations de
- chasse d’eau fuyarde : de 15 à 150 litres/ pression) peuvent entraîner une fatigue
heure soit environ 130 à 1 300 m3/an, accélérée des joints,
- joint défectueux sur robinet : 3 litres/heure, - la densité des points de puisage : plus
soit environ 25 m3/an. nombreux sont les raccords, les soudures …,
plus grands sont les risques de fuites,
D’autres valeurs de fuite sont plus
impressionnantes : - les conditions climatiques (gel).

- défaut d’étanchéité sur raccord voire


désolidarisation d’un coude sur canalisation

79
Pour localiser une fuite, plusieurs méthodes plus long terme (gain estimé à 20% environ,
peuvent être mises en œuvre : voir introduction du paragraphe). En effet,
changer les comportements nécessite du temps,
- visualiser le réseau et son fonctionnement
mais c’est un élément fondamental dans un
(plans, volumes consommés au cours des
programme de maîtrise des consommations.
3 à 5 dernières années, parc de compteurs
divisionnaires et relevés), et évaluer le
7\SHVG·DFWLRQVGHVHQVLELOLVDWLRQ
volume de fuite recherché ;
 YpULÀHU OHV H[XWRLUHV GHV UpVHDX[ SOXYLDX[ Cette sensibilisation peut prendre plusieurs
ou drainages de parking ou de terrain de formes :
sport : ces conduites pluviales peuvent être
- information aux salariés et aux usagers
des exutoires idéaux pour rendre les fuites
(plaquette, messages via l’Intranet…) ;
importantes invisibles. Dans ce cas, rechercher
la fuite à proximité de ces réseaux ; - organisation de séance d’information
ou mieux de démonstration (matériel
- procéder si possible (si on peut couper
hydroéconome…), si possible sur la base
l’eau et s’il existe des robinets vanne) à une
d’exemples d’économies d’eau présentés par
sectorisation du réseau d’eau potable : isoler
les personnes qui les ont réalisées ;
OHVGLIIpUHQWVEkWLPHQWVRXXVDJHVHQYpULÀDQW
un à un qu’ils ne sont pas responsables de - mise en place d’un interlocuteur pour
la fuite (il faut être deux, et équipés de la signalisation de dysfonctionnement de
téléphones portables, l’un près du compteur l’installation ou de fuites… ;
général et l’autre qui se déplace de robinet
©DIÀFKDJHªGHVFRQVRPPDWLRQVSDUVHUYLFH
vanne en robinet vanne),
et surtout des bons résultats (il ne s’agit pas
YpULÀHUODIHUPHWXUHGHVpYHQWXHOOHVYDQQHV de blâmer les mauvais élèves mais de faire
de vidange ou de décharge (piscine, bassin prendre conscience des volumes consommés,
décoratif…), ainsi que la fermeture des il est conseillé de toujours relativiser les
robinets de puisage ; mauvais résultats apparents et de donner des
résultats globaux);
- rechercher des traces d’eau à la surface (les
plantes sont plus vertes ou le sol est détrempé - mise en place d’une boite à idées ;
en permanence …),
- intégration systématique d’une
- réaliser des mesures de pression au niveau sensibilisation rapide au problème dans les
de différents robinets ou points de puisage formations internes et mise en place de
en l’absence d’activité : en l’absence de formations dédiées ; …
puisage, la pression statique devrait être
relativement homogène sur le site. Dès qu’un Il est aussi important de répercuter (ou au moins
puisage important a lieu, la pression chute. GH SUHQGUH HQ FRPSWH  OH JDLQ ÀQDQFLHU GH
Donc à proximité d’une fuite importante, la fonctionnement sur le service qui a effectué des
pression statique est plus faible, économies d’eau importantes. Cela permettrait
par exemple d’éviter qu’un service public
- en faisant intervenir un prestataire
des sports n’investisse pas dans un forage de
extérieur spécialisé dans la recherche de
substitution pour l’arrosage d’un stade (ou un
fuites (distributeur de compteurs d’eau,
service technique privé pour l’arrosage d’un
bureau d’études ou exploitant des réseaux
espace vert) car son budget d’investissement
d’eau potable).
(restant) ne lui permet pas de le faire ; les
factures d’eau étant gérées au niveau du service
Des informations complémentaires sont
FRPSWDEOHJpQpUDO HWOXLQHEpQpÀFLDQWSDVGH
disponibles GDQV OH FDKLHU 7HFKQLTXH Qƒ
l’impact).
© 5HFKHUFKH GH IXLWHV ª pGLWp SDU O·2IÀFH
International de l’Eau, ou dans l’ouvrage
© connaissance et maîtrise des pertes dans les
0RGHGHFRPPXQLFDWLRQORUVG·LQVWDOODWLRQGH
réseaux d’eau potable » édité par l’Agence de
PDWpULHOVK\GURpFRQRPHV
l’eau Adour-Garonne.
- Pour l’équipement hydroéconome des
sanitaires ou des cuisines : l’expérience
VII.2.3 INFORMATION ET SENSIBILISATION DES a montré qu’il était préférable lors du
changement de matériel de communiquer
UTILISATEURS ET PERSONNELS D’ENTRETIEN
peu en amont :
*DLQSRWHQWLHO …. Installer le matériel sur une partie
des points de puisage (ou certains
L’information des utilisateurs et du personnel bâtiments) sans informer les usagers
chargé de l’entretien de l’installation en détail. Procéder alors à des mesures
(gestes économes, signalisation des GH FRQVRPPDWLRQ G·HDX DÀQ G·pYDOXHU
dysfonctionnements…) est une source O·HIÀFDFLWp GHV pTXLSHPHQWV OHV
d’économie potentielle en tant que telle à volumes économisés). Si les résultats
80
VRQW SUREDQWV DIÀFKHU OHV UpVXOWDWV GH ‡SRXUOHVXVDJHUVRQUHQFRQWUHGHX[FDV
façon groupée et le cas échéant féliciter GHÀJXUH
les utilisateurs (employés et usagers), ils - économie d’eau et arrosage réduit :
peuvent ainsi être encouragés à faire des OHVSULQFLSDOHVGLIÀFXOWpVVHUHQFRQWUHQW
gestes économes. pour les terrains de sport, que certains
†. Généraliser les équipements n’acceptent pas de voir un peu
hydroéconomes à la totalité du site, en jaunir ponctuellement : procéder aux
impliquant les utilisateurs : en les associant PRGLÀFDWLRQV PLQHXUHV UHPSODFHPHQW
au programme (gains environnementaux du gazon en place par une variété moins
HWÀQDQFLHUV« HQWHQDQWFRPSWHGHOHXUV gourmande en eau, arrosage moins
suggestions sur le choix du matériel. fréquent) en informant les utilisateurs des
résultats après coup. En cas de plaintes,
Procéder dans cet ordre évite des plaintes l’idéal est de provoquer une discussion
LQMXVWLÀpHV GHV XWLOLVDWHXUV QRWDPPHQW HQ sur site, de façon à ce que les utilisateurs
terme de confort ou de temps de travail convaincus du bien fondé du changement
augmenté pour effectuer une même tâche puissent convaincre les plus réticents (il
(certaines ont été enregistrées sur des s’agit presque de « ringardiser » les plus
pTXLSHPHQWVQRQPRGLÀpV  réticents, sur le même principe que ce
qui a été fait pour la conduite à vitesse
Pour les sanitaires, les retours sur expériences excessive ou en état d’ivresse ) ;
montrent qu’il vaut mieux privilégier des - substitution de ressource : il faut
équipements offrant un confort d’utilisation impérativement communiquer largement
similaire à des équipements classiques. sur l’origine de l’eau d’arrosage. En
Cela dit, une sensibilisation à long terme effet, l’effet négatif induit par ce qui
peut permettre d’aller plus loin et de faire peut être perçu comme un gaspillage est
accepter des baisses de confort. déplorable (et plus important en valeur
absolu que l’effet positif généré par un
- Pour l‘arrosage, l’information se fait très bon exemple).
différemment, autant auprès des employés que
des usagers. VII.2.4 ENTRETIEN DES ÉQUIPEMENTS, MAINTENANCE

‡ SRXU OH SHUVRQQHO G·HQWUHWLHQ LO 7RXW FRPPH OH VXLYL GHV FRQVRPPDWLRQV OD
faut savoir que c’est dans ce domaine PDLQWHQDQFHGHVLQVWDOODWLRQVHVWIRQGDPHQWDOH
d’activité (gestion des espaces verts) que SRXUSpUHQQLVHUOHVpFRQRPLHV, en particulier
l’on rencontre le plus fréquemment des pour les équipements hydroéconomes des
anciennes pratiques très consommatrices sanitaires.
(en eau mais aussi en engrais et pesticides)
mais aussi les plus fortes motivations ([HPSOH 1ƒ   %DLVVH UDSLGH GHV
pour des pratiques durables et plus SHUIRUPDQFHV K\GURpFRQRPHV IDXWH GH
respectueuses de l’environnement. Il est PDLQWHQDQFH
important de ne pas faire se heurter les
différentes sensibilités d’une équipe. Dès Sur le village N°1 du CROUS de Talence, des
le départ, il faut impliquer le personnel économies d’eau de 35 % ont été réalisées suite
concerné dans la démarche et proposer à l’équipement hydroéconomes des robinets,
des actions concertées, et en cas de GRXFKHV HW :&$X ERXW GH  DQV OH EpQpÀFH
réticences proposer des changements sur de cet aménagement s’est largement réduit,
des zones tests. Il faut surtout positiver faute d’entretien (et surtout de remplacement
et impulser la démarche (penser aux à l’identique du matériel de douche).
DVSHFWVpFRQRPLHÀQDQFLqUHRXREOLJDWLRQ
légale ou projet d’équipe, au-delà de Cet entretien peut être réalisé en interne (il est
l’aspect environnemental) et éviter de conseillé de le formaliser dans une procédure)
trop blâmer les anciennes pratiques (et les ou délégué en l’intégrant à un « contrat de
plus anciens). Bien présenter les objectifs maintenance robinetterie ».
(préserver les nappes profondes pour
les générations futures, donner le "bon Des contrôles visuels fréquents des équipements
exemple" et surtout éviter les mauvais en place (fermeture des robinets, étanchéité des
exemples aux habitants qui sont très chasses WC…) seront effectués : il faut s’assurer
sensibles aux pratiques des gestionnaires que de nouvelles fuites n’apparaissent pas. Le
d'espaces verts) est important pour que les cas échéant, on pourra prévoir dans le même
nouvelles pratiques soient bien acceptées cadre la relève mensuelle des compteurs.
(reconnaître les compétences du personnel
HW PRQWUHU VD FRQÀDQFH GDQV VD FDSDFLWp Par ailleurs, une maintenance de base régulière
à changer, proposer des formations, du matériel sera prévue (détartrage des
rechercher l’adhésion au challenge avant DpUDWHXUV YpULÀFDWLRQ GX ERQ SRVLWLRQQHPHQW
celle au principe) ;
81
des sacs et plaquettes WC, remplacement des
joints, réglage des temporisations : 7 sec pour
wc/urinoir, 10 à 15 sec pour lavabo…), en cas de
dysfonctionnement l’équipement incriminé sera
remplacé dans les plus brefs délais.

Et surtout, il faut exiger un remplacement à


l’identique (matériel hydroéconome) et non pas
standard des équipements.

(QÀQ SRXU FKDTXH VLWH LO HVW VRXKDLWDEOH


G·DIÀFKHU OHV FRRUGRQQpHV GX UHVSRQVDEOH HQ
FKDUJH GH OD PDLQWHQDQFH © HDX ª DÀQ TXH
les fuites ou dysfonctionnement puissent lui
être rapidement signalés. En cas de contrat
externalisé, il est utile de prévoir un délai
maximum de réparation.

82
VIII. Solutions de substitution

En préambule, il est rappelé qu’avant d’envisager $GpIDXWGHGpÀQLWLRQSUpFLVHO·(WDWFRQVLGqUH


une substitution de l’eau potable par une autre actuellement que seule l’eau potable peut être
ressource, il est nécessaire d’optimiser la utilisée pour les usages domestiques suivants :
consommation d’eau. Le volume de substitution,
- les usages alimentaires : boisson, préparation
et les investissements correspondants, n’en
des aliments, lavage de la vaisselle,
seront que moins importants.
- les usages liés à l’hygiène corporelle :
Par ailleurs, les ressources de substitution ont lavabo, douche, bain, lavage du linge,
été hiérarchisées en fonction de leur intérêt dans
- les autres usages à l’intérieur des bâtiments
XQ FRQWH[WH VSpFLÀTXHPHQW JLURQGLQ '·DXWUHV
d’habitation individuelle ou collective : WC,
contextes hydrogéologiques peuvent engendrer
lavage des sols,….
une hiérarchisation différente.
3RXUG·DXWUHVRFFXSDWLRQVGHVEkWLPHQWVTXH
(QÀQSRXUWRXWHVOHVUHVVRXUFHVGHVXEVWLWXWLRQ
O·KDELWDW LQGLYLGXHO RX FROOHFWLI H[HPSOH 
l’aspect réglementaire doit être pris en compte,
FROOqJHV O\FpHV EkWLPHQWV GH WUDYDLO«  XQH
que ce soit pour obtenir l’autorisation de prélever
GpURJDWLRQ SUpIHFWRUDOH GRLW rWUH GHPDQGpH
GDQVODQRXYHOOHUHVVRXUFH QDSSHVXSHUÀFLHOOH
SRXUO·XWLOLVDWLRQG·XQHDXWUHHDXTXHFHOOHGX
rivière,…..) ou pour l’utiliser (eau de pluie pour
UpVHDX GH GLVWULEXWLRQ SXEOLTXH j O·LQWpULHXU
des usages autres que l’arrosage,…).
GHV EkWLPHQWV. Elle peut être octroyée sous
certaines conditions, comme par exemple (voir
Les synoptiques ci-après résument les principaux
la DDASS) :
critères de choix pour s’orienter vers l’une
ou l’autre des ressources de substitution (si - pas de réception ou d'hébergement de
plusieurs existent), en fonction de l’usage de personnes sensibles (jeunes enfants, personnes
l’eau. agées ou malades) ;
- toutes les voies de recherche d’économie
d’eau ont été préalablement mises en œuvre ;
VIII.1. QUALITÉ D’EAU REQUISE PAR USAGE
- présence d’un double réseau sans aucune
VIII.1.1. PRINCIPES GÉNÉRAUX – USAGES interconnexion possible ;
DOMESTIQUES - pour un usage autre qu’alimentaire ou
d’hygiène corporelle ;
Conformément au code de santé publique (art - pour des bâtiments dans lesquels seul un
19), « quiconque offre au public, de l’eau en vue VHUYLFH WHFKQLTXH FHUWLÀp VHUDLW DPHQp j
de l’alimentation humaine, à titre onéreux ou effectuer des opérations sur les réseaux
gratuit, est tenu de s’assurer que cette eau est d’eau …
propre à la consommation ».

Par ailleurs, d’après l’article 641 du code civil, VIII.1.2. REMARQUE : CRÉDIT D’IMPÔT POUR LES
« tout propriétaire a le droit d’user et de disposer LOGEMENTS PRIVÉS
des eaux pluviales qui tombent sur son fonds ».
La loi sur l’eau et les milieux aquatiques parue
En conséquence, un propriétaire peut recueillir DX-RXUQDORIÀFLHOGXGpFHPEUHLQVWLWXH
les eaux de pluies pour les utiliser pour différents un crédit d’impôt sur le revenu pour l’acquisition
usages sous réserve de ne pas causer préjudice à d’un système de récupération d’eau de pluie.
autrui et de respecter les exigences relatives à
chacun des usages. Ce crédit d’impôt s’élève à 25% des dépenses
effectuées et s’applique au coût des équipements
On distinguera donc les usages qui nécessitent de récupération et de traitement des eaux
une qualité d’eau « potable » et les autres : pluviales :
les articles R-1321-1 et suivants du Code de la - payés entre le 1er janvier 2007 et le 31
Santé Publique indiquent que l’eau de qualité décembre 2009 dans le cadre de travaux
dite « potable » (cf décret 2001-1220, du 20 réalisés dans un logement achevé ;
décembre 2001) est requise pour tous les usages
domestiques, compte tenu des risques sanitaires - intégrés à un logement acquis neuf entre le
pouvant exister pour la population exposée. La 1er janvier 2007 et le 31 décembre 2009 ;
GLIÀFXOWpHVWTXHODQRWLRQG·XVDJHGRPHVWLTXH
Q·HVWSDVSUpFLVpPHQWGpÀQLHSDUOH&RGH
83
- intégrés à un logement acquis en l’état $UURVDJHVGHVHVSDFHVYHUWVRXDXWUHVXVDJHV
futur d’achèvement ou que le contribuable H[WpULHXUV
fait construire, achevé entre le 1er janvier
2007 et le 31 décembre 2009. Le code de la santé publique ne prévoit pas
de disposition particulière en ce qui concerne
Pour une même résidence, le montant des les eaux d’arrosage. A défaut, on ne peut que
dépenses ouvrant droit au crédit d’impôt ne peut s’inspirer de recommandations pour l’utilisation
excéder, pour la période du 1er janvier 2005 au d’eaux usées après traitement formulées par
31 décembre 2009, la somme de 8.000 euros pour le Conseil Supérieur d’Hygiène Publique de
une personne célibataire, veuve ou divorcée et France ou par l’Organisation mondiale de la
de 16 000 euros pour un couple marié soumis à santé ; recommandations portant sur la qualité
imposition commune. Cette somme est majorée microbiologique des eaux et les conditions
de 400 euros par personne à charge. La somme techniques d’arrosage.
de 400 euros est divisée par deux lorsqu’il s’agit
d’un enfant réputé à charge égale de l’un et Sur ce dernier point, il est recommandé de
l’autre de ses parents. Le crédit d’impôt est limiter les risques liés aux aérosols en adaptant
accordé sur présentation de l’attestation fournie les techniques d’arrosage (goutte à goutte ou
par le vendeur ou le constructeur du logement apport souterrain plutôt qu’aspersion) et les
ou des factures. heures de fonctionnement (en dehors des heures
d’ouverture au public).
$WWHQWLRQ
 GHV GLVSRVLWLRQV UpJOHPHQWDLUHV À[HQW Faute de réglementation plus précise, c’est
OD OLVWH GHV pTXLSHPHQWV GH UpFXSpUDWLRQ donc le bon sens qui prévaut et les conditions de
HW GH WUDLWHPHQW GHV HDX[ SOXYLDOHV TXL récupération, de stockage et d’utilisation des
RXYUHQWGURLWDXFUpGLWG·LPS{W DUUrWpGX eaux doivent permettre de garantir la meilleure
PDL  qualité possible des eaux et de limiter les risques
sanitaires.
 O·XVDJH LQWpULHXU IHUD O·REMHW G·XQ
DXWUH DUUrWp TXL GHYUDLW rWUH SXEOLp
/DYDJHVGHVH[WpULHXUVHWYpKLFXOHV
XOWpULHXUHPHQW,OGHYUDLWDFFHSWHUO·XVDJH
GHVHDX[GHSOXLHGDQVOHVFKDVVHVG·HDXGHV
Il n’existe pas de règle sur l’origine de l’eau qui
WRLOHWWHV H[FHSWp SRXU OHV pWDEOLVVHPHQWV
peut parfaitement être différente du réseau
UHFHYDQW GHV SHUVRQQHV VHQVLEOHV MHXQHV
d’adduction publique.
HQIDQWVRXSHUVRQQHVPDODGHV HWÀ[HUOHV
PRGDOLWpVGHGpFODUDWLRQHWGHFRQWU{OHDLQVL
Là aussi, certaines précautions peuvent être
TXH OD OLVWH GHV pTXLSHPHQWV QpFHVVDLUHV
utiles :
3RXU FHWWH TXHVWLRQ LO HVW LPSpUDWLI GH
FRQVXOWHUOD''$66
- attention à la légionellose, et de façon plus
SDUFRQVpTXHQWDFWXHOOHPHQW ÀQ  générale à la température de stockage de
SRXU GH O·KDELWDW LQGLYLGXHO RX FROOHFWLI l’eau (elle doit rester fraîche),
O·HDX GH SOXLH UpFXSpUpH QH SHXW rWUH
XWLOLVpH TX·j O·H[WpULHXU GHV EkWLPHQWV - autant que possible, éviter le contact avec
$XFXQH FRQQH[LRQ DYHF OH UpVHDX G·HDX la peau des personnes qui manipulent cette
SRWDEOH 7RXV OHV SRLQWV G·HDX VLWXpV j eau,
O·LQWpULHXU G·XQ ORJHPHQW GRLYHQW rWUH
DOLPHQWpVHQHDXSRWDEOH - et éviter la brumisation (nettoyage sous
pression) avec de l’eau non potable.
VIII.1.3. USAGES NON DOMESTIQUES
'pIHQVHFRQWUHO·LQFHQGLH
Pour les usages non domestiques (tels que le
lavage de véhicules, l’arrosage d’espaces verts ; Il n’existe pas de règle sur l’origine de l’eau (qui
l’alimentation en eau de fontaine ou bassin peut parfaitement être différente du réseau
décoratif, la défense contre l’incendie…), il d’adduction publique), mais des règles sur le
est envisageable et même recommandé de volume, le débit et la pression de délivrance de
remplacer l’eau potable par une ressource de l’eau.
substitution en s’étant au préalable rapproché Pour les réseaux qui subissent des dommages
de la Mission Interservices de l’Eau (MISE, à la lors de la mise en service des poteaux incendie
''$) HQ *LURQGH  DÀQ GH UHVSHFWHU OD RX OHV (phénomène d’eaux rouges, surpression, coup
procédures, et en particulier de la DDASS pour de bélier…), il est recommandé d’abandonner
les éventuelles précautions à prendre. ce mode de défense contre l’incendie et de
privilégier la mise en œuvre de bâche de
Les principaux usages non domestiques sont stockage de 120 m3. Cela concerne autant les
énumérés ci-dessous, avec les recommandations réseaux publics, en particulier en zone rurale,
les plus fréquemment faites : que certains réseaux privés desservant des sites
étendus ou recevant du public.

84
En effet, le volume d’eau gaspillé ne correspond fonction du lieu et du volume) en application du
pas tant au volume de défense contre l’incendie code de l’environnement. Et une redevance peut
proprement dit (les essais des poteaux et les être exigée pour tout prélèvement dépassant un
incendies eux-mêmes sont très limités) qu’aux certain volume.
désordres qu’ils provoquent et qui nécessitent
parfois de longues purges du réseau. Ce sont ces VIII.2.1 EAUX DE FORAGES SUPERFICIELS (HORS
purges que l’on cherche à limiter.
NAPPES DU SAGE)

9,,,(OpPHQWVUqJOHPHQWDLUHV
VIII.2. IDENTIFICATION DES SOURCES D’EAU DE
SUBSTITUTION DISPONIBLES La réalisation d’un forage et le prélèvement
d’eau souterraine relèvent de différentes
Plusieurs alternatives à l’utilisation de l’eau réglementations : Code minier, Code de
potable existent, et par rapport à leur coût de l’Environnement, voire Code de la Santé
revient et à leurs contraintes de mise en œuvre, publique.
elles doivent être recherchées dans l’ordre
suivant : Selon les cas, la réalisation d’un forage peut
être :
…QDSSHVXSHUÀFLHOOH SXLWVRXIRUDJHGDQV
une nappe hors SAGE), dès lors que le besoin - interdite (dans ce cas le terrain est frappé
atteint 1000 m3/an environ, et qu’il en existe d’une servitude) ;
une au niveau du site. Il faut aussi penser
à préciser dès le départ le besoin horaire : - soumise à déclaration ;
c’est lui qui conditionnera la nécessité ou non
GpIDYRUDEOH ÀQDQFLqUHPHQW  GH SUpYRLU XQ - soumise à autorisation.
stockage associé ;
Quant au prélèvement d’eau souterraine, il peut
†. eau de surface (étang, source, récupération être :
de drainage, rivière…) : cette solution est
parfois moins onéreuse que la précédente - dispensé de toute démarche ;
mais elle ne peut parfois constituer qu’un
apport partiel ; - soumis à déclaration ;

‡ HDX GH SOXLH OD GLIÀFXOWp UpVLGDQW GDQV - soumis à autorisation.
la nécessité d’un stockage important car la
période de disponibilité de la ressource est Ces réglementations sont complexes et il n’est
différente de la période d’usage, pas facile de les présenter succinctement.
Pour vous renseigner, vous pouvez télécharger
ˆ. dans des cas particuliers et à des une série de plaquettes informatives sur les
conditions très strictes (voir la DDASS), eau sites www.aquitaine.ecologie.gouv.fr ou www.
usée traitée (et généralement désinfectée de smegreg.org. Mais nous vous recommandons
surcroît) provenant d’une station d’épuration de toujours prendre contact avec les services
: il existe ainsi plusieurs golfs en France qui de l’Etat en charge de la Police de l’eau. En
sont arrosés à partir de cette ressource. Gironde, la DDAF assure un « guichet unique »
pour les différentes procédures.
'DQV WRXV OHV FDV LO HVW QpFHVVDLUH SRXU
OHV SURMHWV GH VXEVWLWXWLRQ GH UHVVRXUFH 9,,, (OpPHQWV WHFKQLTXHV HW
JpQpUDOHPHQW RQpUHX[ GH IDLUH XQH pWXGH pFRQRPLTXHV
WHFKQLFRpFRQRPLTXH GX FR€W GH UHYLHQW GX
P3pFRQRPLVp Un prélèvement de substitution dans une nappe
VXSHUÀFLHOOH SXLWV RX IRUDJH GDQV XQH QDSSH
Et il faut garder à l’esprit que les substitutions VXSHUÀFLHOOHKRUV6$*( SHXWV·HQYLVDJHU
de ressource pour la production d’eau potable à
l’échelle départementale ont un coût de revient - à proximité immédiate de la zone d’utilisation
moyen d’environ 5!/m3. Les micro-substitutions (c’est un avantage indéniable par rapport
locales qui auraient un coût de revient nettement aux autres ressources de substitution) ; en
plus important ont donc peu d’intérêt. effet seuls quelques m2 sont nécessaires à
l’implantation d’un forage. Il faut toutefois
Il faut noter également que tout prélèvement prévoir l’amenée de l’électricité, la proximité
en milieu naturel (excepté l’eau de pluie) doit d’un bâtiment est donc souhaitable ;
être déclaré à l’Etat au titre de la loi sur l’eau
ainsi qu’à l’Agence de l’Eau Adour-Garonne (voir - en sachant que la teneur en fer de l’eau
les paragraphes : « éléments réglementaires » sera potentiellement importante (possibilité
suivants). Un prélèvement supérieur à 1000 m3 / de coloration brune des éléments minéraux
an sera soumis à autorisation ou déclaration (en
85
(béton) ou du mobilier urbain arrosés, mais ‡ D P H Q p H  G H  O · p O H F W U L F L W p  H W
aucun danger pour les plantes) ; branchement,
‡DXWUH«
- dans certains secteurs géographiques
seulement : il n’existe parfois pas de nappe
Estimer ensuite votre consommation d’eau
à faible profondeur (ou celle-ci n’a pas les
annuelle, et comparer.
capacités requises pour satisfaire le besoin),
A titre d’exemple, un forage à moins de
ou la nappe accessible est une nappe du SAGE
20m a été récemment réalisé à l’ouest de
(certaines nappes du SAGE sont, dans certains
l’agglomération, il correspondait à un cas «
secteurs, très peu profondes).
idéal » (faible profondeur, débit important, pas
de « surprise » lors du chantier,…) et son coût
En Gironde, une ressource de substitution
de revient a été d’environ 8 700 !HT. Un forage
ne devra pas solliciter des aquifères du
plus profond (30 m) coûtera plus cher, pourra
6$*(GpÀFLWDLUHVRXjO·pTXLOLEUH (RFqQHHW
nécessiter un stockage correspondant au besoin
Crétacé en zone centre ; Oligocène en zone
MRXUQDOLHUVLOHGpELWQ·HVWSDVVXIÀVDQW
centre ou Crétacé en zone médoc, comme le
montre le croquis ci-après).
Il faut en effet penser à préciser dès le départ
Le SMEGREG peut vous donner des indications
le besoin en débit horaire (m3/h) : c’est lui qui
générales. Des hydrogéologues (voir par
conditionnera la nécessité ou non (défavorable
exemple les coordonnées de plusieurs bureaux
ÀQDQFLqUHPHQW GHSUpYRLUXQVWRFNDJHDVVRFLp
d’études sur le site www.jeconomiseleau.
En effet, certains forages peuvent fournir
org à la rubrique documentation, contacts
seulement quelques m3/h. Cela n’est pas
professionnels), sont les plus à même de
VXIÀVDQW SRXU DOLPHQWHU FHUWDLQV GLVSRVLWLIV
préciser le contexte hydrogéologique local
d’arrosage importants. Il faut donc prévoir de
et de vous accompagner pendant les travaux (cet
stocker le volume correspondant environ au
accompagnement est vivement recommandé ;
besoin journalier de pointe ou (et c’est la solution
certaines entreprises de forage proposent
j SULYLOpJLHU VL HOOH VXIÀW  DGDSWHU OH V\VWqPH
des travaux inadaptés et très onéreux) ;
d’arrosage de façon à diminuer le besoin horaire
HQ PRGLÀDQW OH V\VWqPH GH SURJUDPPDWLRQ HW
en intercalant des électrovannes de façon à
arroser les fractions d’espaces verts les unes
après les autres, et non plus simultanément).

Le stockage se fera dans une retenue d’eau


extérieure à ciel ouvert (moins onéreuse, mais
attention à garantir la sécurité et l’interdiction
d’accès ; une clôture est donc souvent à prévoir)
ou un stockage fermé (cuve enterrée ou bâche
souple, plus adaptée en cas de faible stockage
< 200m3 environ) . Ces travaux complémentaires
de stockage et d’aménagement génèrent des
surcoûts importants, qui restent néanmoins
souvent très raisonnables, comparativement au
stockage d’un besoin de 3 semaines environ,
nécessaire dans le cas de la récupération de
l’eau de pluie.

VIII.2.2. EAUX DE SURFACE

9,,,(OpPHQWVUqJOHPHQWDLUHV
Illustration N°29 :
Etat des unités de gestion du SAGE nappes profondes de Gironde
Le terme « eau de surface » regroupe toutes les
IRUPHVG·HDX[VXSHUÀFLHOOHVYLVLEOHVF·HVWjGLUH
- économiquement, à partir d’un besoin OHVODFVOHVÁHXYHVOHVULYLqUHVOHVVRXUFHVOHV
annuel d’environ 1 000 à 1 500 m3/an selon glaciers et le manteau neigeux. En Gironde, le
les cas. SUpOqYHPHQW GDQV OD *DURQQH HVW GLIÀFLOHPHQW
envisageable (du fait du marnage important lié à
Pour évaluer l’intérêt économique, calculer la marée et au bouchon vaseux) ; ainsi que dans
vos dépenses : les rivières (du fait du débit souvent limité).
‡FR€WGHODSURFpGXUHUpJOHPHQWDLUH
‡UpDOLVDWLRQGHIRUDJH En Gironde, le terme « eau de surface » désigne
donc plutôt les sources, étangs, lacs, ou
‡DFKDWHWPLVHHQSODFHGXSRPSDJH récupération de drainage, mais aussi quelques
Jalles.

86
GH V·HQJDJHU SHQVHU DX ÀOWUH j O·pYHQWXHO
Remarque : Attention au vocabulaire, l’Agence stockage, au pompage intermédiaire de reprise
de l’eau Adour-Garonne, par exemple, inclut les éventuel…).
QDSSHVSKUpDWLTXHVGDQVOHVHDX[VXSHUÀFLHOOHV
VIII.2.3. EAU DE PLUIE

Un certain nombre de critères (débit de 9,,,(OpPHQWVUqJOHPHQWDLUHV


prélèvement par rapport au débit de la
ressource…) détermine si l’opération envisagée Il est rappelé YRLU OH SDUDJUDSKH SUpFpGHQW
est soumise à déclaration, à autorisation, ou si © TXDOLWp G·HDX UHTXLVH SDU XVDJH ª que
elle peut se faire sous le régime de la liberté l’utilisation de l’eau de pluie pour l’arrosage
(décrets n°93-742 et n° 93-743 du 29 mars peut se faire sans démarche règlementaire
 HW PRGLÀFDWLIV SULV HQ DSSOLFDWLRQ GH OD particulière. (Q UHYDQFKH XQ XVDJH GH O·HDX
loi sur l’eau de 1992). Nous vous conseillons de GH SOXLH GDQV OHV FKDVVHV G·HDX GHV :& RX
vous rapprocher de la Mission Interservices de WRXW DXWUH XVDJH j O·LQWpULHXU G·XQ EkWLPHQW
l’Eau (MISE), basée en Gironde à la Direction HVWVRXPLVjGpURJDWLRQSUpIHFWRUDOH. Pour les
Départementale de l’agriculture et de la forêt autres usages extérieurs, dans des lieux recevant
''$)  DÀQ GH FRQQDvWUH SUpFLVpPHQW OHV du public, il faut également consulter la DDASS.
procédures à respecter (déclaration et
autorisation). 9,,, (OpPHQWV WHFKQLTXHV HW
pFRQRPLTXHVJpQpUDX[
Sur certains territoires sensibles du point de vue
de la gestion globale de l’eau et de conciliation ,QWpUrW GH OD UpFXSpUDWLRQ GH O·HDX GH SOXLH
des différents usages, il existe des Zones de SpULRGHG·XVDJH 
Répartition des Eaux (ZRE). Tout ou partie des
La récupération de l’eau de pluie semble
bassins versants de l’Adour, de la Dordogne,
très attrayante au premier abord : l’eau est
de la Garonne, de L’isle, de la Dronne et de la
JUDWXLWHHWWRPEHGXFLHO/DGLIÀFXOWpUpVLGH
Charente sont classés en ZRE. Dans ces zones
dans la disponibilité de la ressource, parfois
WRXVOHVSUpOqYHPHQWVVXSHUÀFLHOVRXVRXWHUUDLQV
complètement différente de la période d’usage,
sont concernés.
et donc dans la nécessité d’un stockage important
et onéreux.
9,,, (OpPHQWV WHFKQLTXHV HW
pFRQRPLTXHV
,OH[LVWHGRQFGHX[FDVGHÀJXUH
L’utilisation d’une eau de surface (étang, lac,
- le besoin d’eau de substitution existe
source, récupération de drainage, rivière…)
toute l’année (nettoyage de véhicules ou
est parfois moins onéreuse que la solution
de matériel, chasses d’eau des WC pour une
précédente mais elle ne peut souvent constituer
activité non uniquement saisonnière,…).
qu’un apport partiel. Par exemple, la source
Dans ce cas on constate que l’eau de pluie
Q·D SDV VRXYHQW XQ GpELW VXIÀVDQW RX O·pWDQJ
est souvent la ressource de substitution la
à certaines périodes, offre de l’eau de qualité
plus intéressante (à condition que la toiture ne
moindre, non utilisable. Il est néanmoins souvent
présente pas une multitude de descentes qu’il
intéressant de la réaliser, surtout si la ressource
faut regrouper, et soit proche du besoin) ;
est située directement à proximité du besoin.
- l’eau de pluie récupérée est destinée à
L’utilisation d’une ressource de surface nécessite
l’arrosage. Un rapide calcul montre ainsi que
également parfois un stockage intermédiaire
le besoin est réparti sur les 4 mois d’été,
(correspondant en général à une journée de
l’ordre de grandeur du stockage nécessaire
besoin) pour accumuler progressivement l’eau de
(soit 3 semaines environ de période la plus
source, ou la récupération des eaux de drainage
sèche) correspond à environ un quart du besoin
(dans ce cas on récupère environ 35% du volume
annuel. Ce stockage important (de l’ordre de
d’arrosage). Ce stockage n’est pas nécessaire
1 000 m3/an pour un stade) a généralement
pour des prélèvements en étang ou rivière.
un coût prohibitif : aucun projet inférieur à
65 000 !HT n’a été recensé dans la région.
Par ailleurs, l’eau de surface, en particulier quand
elle est stagnante ne présente pas souvent une
,OHVWQpFHVVDLUHGDQVFHW\SHGHSURMHWGHIDLUH
TXDOLWpVXIÀVDQWHSRXUSRXYRLUrWUHXWLOLVpHWHOOH
XQHpWXGHWHFKQLFRpFRQRPLTXHSUpDODEOH
TXHOOHGDQVOHVJRXWWHVjJRXWWHVXQHÀOWUDWLRQ
DVVH]ÀQHHVWQpFHVVDLUH
- au-delà d’un temps de retour sur
investissement de 15 ans, le projet ne devrait
Etant donnée la grande variété de solutions
pas être réalisé. En effet, avec le même
techniques envisageables, il n’est pas possible
budget, on pourrait réaliser des travaux
de donner dans ce guide d’ordre de coût moyen
EHDXFRXS SOXV HIÀFDFHV YROXPH pFRQRPLVp
pour ce type de solution. Il est recommandé de
plus important), qui permettraient de mieux
réaliser une étude complète de la solution avant
préserver les nappes profondes.
87
Et une substitution à l’échelle départementale On retient en général (couverture en tuiles,
de l’eau potable aurait un coût de revient DUGRLVHVEpWRQ« XQFRHIÀFLHQWGHHQWUHOH
nettement plus réduit (environ 5 !/m3) ; volume d’eau de pluie potentiel (pluviométrie)
HWOHYROXPHUpHOOHPHQWUpFXSpUp&HFRHIÀFLHQW
- ces projets de récupération d’eau de pluie WLHQW pJDOHPHQW FRPSWH GX SUHPLHU ÁRW QRQ
présentent néanmoins l’avantage d’être très récupéré et des petites pluies (< 2mm, qui
visibles et potentiellement très pédagogiques : mouillent la toiture mais ne ruissellent pas).
on peut espérer que quelqu’un qui fait l’effort
d’utiliser ce type d’eau sera prêt à faire 'LPHQVLRQQHPHQWGHODFXYH
d’autres efforts. Pour des projets à temps Il faudra tenir compte des besoins nécessaires
de retour sur investissement intermédiaires en eau de substitution pour le(s) usage(s)
(5 à 10 ans ; c’est le cas par exemple pour concerné(s). Ce dimensionnement se conduit en
l’arrosage des serres, qui sont cultivées une trois étapes :
plus grande partie de l’année que les espaces
verts extérieurs), cet aspect sera pris en - Calcul de la quantité maximale d’eau
compte. captée :
La quantité d’eau captée est le produit
2ULJLQHGHO·HDXGHSOXLH VXUIDFHGHFDSWDWLRQ  de la surface de captation (projection
- elle peut être captée au niveau des toitures: horizontale de la surface de toiture en m2)
HOOH GHYUD rWUH ÀOWUpH SRXU pYLWHU OD FROOHFWH par la pluviométrie annuelle en litres/an x
des feuilles, déjections d’oiseaux ; gravillons…. P SDU XQ FRHIÀFLHQW GH WRLWXUH UHQGDQW
L’idéal (mais c’est coûteux et réservé aux compte du rapport entre l’eau reçue et l’eau
SURMHWV LPSRUWDQWV  HVW GH FKRLVLU XQ ÀOWUH effectivement récupérée (0,8 en général,
qui permette de ne pas retenir le premier moins pour les toitures végétalisées) :
ÁRWFDULOHVWFKDUJpHQSROOXDQWVHWSROOHQV 9FDSWp  6WRLWXUHHQP 3OXLHDQQXHOOH
OHVVLYDJHGXWRLW 'DQVWRXVOHVFDVXQÀOWUH mm eau/an/m2 .
simple doit être mis en place ; un trop-plein
doit être prévu (débordement vers le lieu de - Calcul des besoins annuels à substituer :
destination originel de l’eau) ; Cette valeur sera issue du tableau des entrées
et sorties établi au § IV.3, c’est la valeur de
1%O·HDXGHSOXLHQH SHXWSDVrWUH LVVXH ODTXDQWLWpG·HDXLGHQWLÀpHSRXUO·XVDJHSRXU
G·XQHWHUUDVVHGHVWLQpHjXQHXWLOLVDWLRQRX lequel on réalise l’étude de substitution. Il
XQHFLUFXODWLRQKXPDLQHVLRQHQYLVDJHXQH est rappelé que celui-ci doit d’abord être
XWLOLVDWLRQGDQVOHVFKDVVHVG·HDXGHV:& optimisé.
A ce stade, on compare les deux valeurs qui
- elle peut être issue du ruissellement sur doivent être proches (+/- 30%), sinon cela
les sols. &HWWHVROXWLRQHVWjpYLWHUVLO·HDX VLJQLÀHTXHODUHVVRXUFHHWOHEHVRLQQHVRQW
SURYLHQW GH VXUIDFHV LPSHUPpDELOLVpHV pas compatibles.
URXWH WURWWRLU HW SDUNLQJ HW SUpVHQFH
pYHQWXHOOH G·K\GURFDUEXUHV RX - Estimation du volume de la cuve :
G·KHUELFLGHV HQ DEVHQFH GH VpSDUDWHXU j Le stockage est souvent le poste le plus
K\GURFDUEXUHVGpERXUEHXU. onéreux du projet (attention cependant aux
travaux nécessaires pour centraliser toutes
4XDQWLWpG·HDXUpFXSpUpH les descentes d’eau vers la cuve, qui peuvent
Elle dépendra des paramètres suivants : aussi s’avérer coûteux). Le choix du volume à
stocker conditionne donc beaucoup le coût du
- la pluviométrie sur le site (les données projet, et doit être choisi judicieusement.
peuvent être transmises par Météo-France ou
sur le site Internet de l’association infoclimat Le volume de stockage est fonction de l’usage
: www.infoclimat.fr) : sur le département de de l’eau :
la Gironde elle est de 700 à 800 mm sur la côte
et de 1 000 mm dans les zones du nord Médoc - pour les chasses d’eau des WC ou le nettoyage
et du sud du département ; la moyenne sur le de véhicules, de chaussées ou de matériels,
département étant de 850 mm ; le stockage correspondant à environ 15 jours
GHEHVRLQHVWVXIÀVDQW RQSHXWVHOLPLWHUj
- la surface de récupération (toiture, surface une dizaine de jours de stockage si les locaux
drainée …) de l’eau ; ou véhicules ou matériels ne servent pas ou
peu l’été : c’est le cas des écoles, ou de la
- la nature de la surface (lisse, texturée, plupart des entreprises et services publics
engazonnée). La quantité d’eau récupérée sera qui ont une activité réduite l’été). En cas
différente entre une toiture « végétalisée » et de doute entre 2 tailles de cuve, on peut
une toiture lisse présentant peu de rugosité. opter pour la plus importante. En effet, pour
$WWHQWLRQ DX[ WRLWXUHV HQ W{OHV JpQpUDQW cet usage, l’investissement est assez vite
SRWHQWLHOOHPHQW OD UpFXSpUDWLRQ GH rentabilisé et mieux vaut prévoir l’avenir
SDUWLFXOHVG·DPLDQWH
88
(éventuelle augmentation du besoin ; climat - pour garantir un approvisionnement en eau
plus sec…) ; en cas de période sèche exceptionnelle, un
raccordement de la cuve au réseau d’eau
- pour l’arrosage au contraire, il est potable (ressource de secours) peut être
recommandé de choisir le volume prévu. Dans ce cas il ne doit y avoir aucun
correspondant à la fourchette basse, en contact possible entre l’eau de pluie et le
prévoyant la possibilité d’un complément réseau d’eau potable (remplissage de la
limité d’eau potable pour les périodes les cuve par-dessus, respect de la norme AFNOR
plus sèches. Le réservoir sera calculé pour NF 1717). Il est aussi utile de prévoir un «
stocker une quantité correspondant à environ gestionnaire de remplissage » pour éviter,
3 semaines de besoin moyen journalier. lorsque la cuve est pleine, de la remplir en
Cette durée de 3 semaines correspond à une totalité par de l’eau potable : un remplissage
période maximale de 21 jours consécutifs SDUWLHOVXIÀWHQDWWHQGDQWODSURFKDLQHSOXLH
sans pluie dans la région de l’étude, elle peut ;
être modulée suivant la région (diminuée
dans les régions pluvieuses, augmentée dans - il est recommandé de prévoir un local
les régions plus sèches). Comme il s’agit aussi technique pour abriter la pompe ;
des 3 semaines les plus chaudes, en première
approximation, on peut retenir un besoin - pour permettre le remplissage de camions,
correspondant au quart du besoin annuel. un chemin d’accès stabilisé dera être prévu
jusqu’au point de remplissage.

9,,,7\SHVGHVWRFNDJH
Astuce ! &XYH3(+' 3RO\pWK\OqQH+DXWH'HQVLWp 
Pour un stockage d’eau L’enfouissement d’une cuve en PEHD permet
dimensionné pour de l’arrosage, il est de stocker jusqu’à 120 m3 d’un seul tenant,
recommandé de prévoir une prise d’eau avec une possibilité de jumelage (les cuves
pour permettre d’autres usages (nettoyage sont transportées en une seule pièce jusqu’à
de matériels, de voiries ou remplissage environ 50m3 ; au-delà les différents éléments
d’une tonne…), de façon à pouvoir utiliser sont soudés sur place). Le matériau présente
aussi cette ressource en hiver. Pour cela, la l’avantage d’être facilement transportable, par
prise d’eau doit pouvoir fournir un débit contre certaines précautions sont à prendre lors
important (de façon à avoir un temps de de la mise en place :
remplissage court), et être accessible à
- réalisation d’un socle (lit de graviers ou
des petits camions.
chape béton),
Dans certaines régions, les
pompiers peuvent aussi exiger - et éventuel ancrage (en cas de nappe
un accès et une prise VXSHUÀFLHOOH  DÀQ TXH FHWWH GHUQLqUH QH
d’eau. remonte pas sous l’effet de la poussée
d’Archimède.

- Equipements complémentaires à prévoir :

XQV\VWqPHGHÀOWUDWLRQjO·HQWUpHGHODFXYH
ÀOWUHPpFDQLTXH HVWIRUWHPHQWFRQVHLOOpDÀQ
d’éviter tout colmatage ; pour les stockages
à ciel ouvert ou de grande dimension il est
SOXW{WUHFRPPDQGpGHSUpYRLUXQHÀOWUDWLRQ
en sortie après stockage, voire un éventuel Illustration N°30 :
Cuve PEHD enterrée (Source GRAF)
traitement de l’eau plus poussé ;

- la mise en place d’une cuve nécessite &XYHEpWRQ


d’équiper cette dernière d’un trop-plein
permettant le cas échéant l’évacuation des L’utilisation d’une cuve en béton permet de
eaux à pleine charge. A noter que pour les couvrir les mêmes besoins qu’une cuve en
stockages de petite capacité (300 à 500 l), les PEHD enterrée, avec les mêmes précautions de
ÀOWUHVPpFDQLTXHVLQWHUFHSWHXUVHQGHVFHQWH mises en place (socle et éventuel ancrage). La
de gouttière assurent cette fonction ; différence réside dans le fait que la cuve béton,
à volume comparable, présente une masse
supérieure qu’il faut prendre en compte lors de
la mise en place et du transport.

89
On se limite donc en général à une capacité de 6WRFNDJHjFLHORXYHUW :
stockage d’un seul tenant de 20 à 30 m3. Au-
delà, des jumelages de cuves ou la réalisation Une excavation dans le sol (généralement 2m de
sur site d’une citerne sont possibles. profondeur) permet de stocker l’eau. Elle est
L’avantage du béton par rapport au PEHD est pWDQFKpLÀpHSDUXQHJpRPHPEUDQHVLOHVROHVW
qu’il neutralise l’eau de pluie, acide. perméable, et compactée s’il est imperméable
(argileux).
C’est la technique a priori la moins onéreuse
pour stocker les volumes importants.
Néanmoins, le coût total du dispositif est élevé
HW HVW ÀQDOHPHQW SHX OLp j OD UpDOLVDWLRQ GX
stockage lui-même (terrassement et éventuelle
étanchéité). La clôture (indispensable pour
éviter les risques de noyade) et les éventuels
pompages intermédiaires (le bassin de grand
volume ne peut pas souvent être implanté ni à
Illustration N°31 :
Cuves béton (source www.idéesmaison.com et Kipopluie) proximité de la toiture où est collectée l’eau de
pluie, ni à proximité du besoin) représentent un
investissement souvent supérieur.
&XYHDFLHU :
0XUYpJpWDOLVpGRXEOHIDFHDYHFUpWHQWLRQ
Les cuves acier présentent des caractéristiques G·HDX :
proches des cuves en PEHD, autant du point
de vue de la mise en œuvre que du volume à Cette technique permet de récupérer de l’eau
stocker. dans un stockage (généralement une bâche
suspendue) qui se trouve au sein d’un mur en
U, végétalisé. L’eau stockée sert en partie à
l’arrosage des végétaux des alvéoles du mur
(par goutte à goutte intégré) ; la majeure partie
de l’eau peut avoir un autre usage.

Le volume stocké est d’environ 1m3 par m de


mur de 1,5 à 2m de haut. Cette technique est
donc destinée au stockage de volumes faibles
Illustration N°32 : à moyens (quelques m3 à quelques dizaines de
Cuves acier (source Kipopluie) m3). Elle a un coût de revient proche de celui
de la mise en place d’une citerne enterrée,
et présente les énormes avantages de ne pas
&LWHUQHVRXSOH : nécessiter de terrassement et d’être décorative
et modulable.
Les citernes en matériau souple peuvent contenir
jusqu’à 400 m3 d’eau d’un seul tenant. Leur
durabilité a été démontrée pour le stockage
d’eau pour l’incendie ou de boues d’épuration.
Ces bâches souples peuvent être posées à même
le sol, sans importants travaux de terrassement
préalables. Elles sont facilement transportables,
et peuvent éventuellement être réutilisées sur
un autre site. Elles nécessitent cependant une
clôture, pour se prémunir des dégradations et
tailladages. Elles sont aussi à éviter en cas de Illustration N°34 :
présence de ragondins. 0XUYpJpWDOLVpDYHFVWRFNDJHG·HDX VRXUFH3KRQLÁHXU

Illustration N°33 :
Bâche souple de stockage d’eau (source Kipopluie)

90
IX. Elaboration du plan d’actions

IX.1. HIÉRARCHISATION ET COMPARATIF DES SOLUTIONS Et outre des économies liées à la mise en œuvre
D’ÉCONOMIES ET DE SUBSTITUTION de nouvelles techniques (économies passives
par mise en œuvre de matériel hydroéconome
Le risque dans un programme d’actions est de et substitution de ressource) ; un plan d’actions
se focaliser trop rapidement sur un poste de de maîtrise des consommations doit comporter
consommation et/ou un seul type d’action pour des actions de sensibilisation qui généreront
réduire les volumes d’eau consommés ou les à plus long terme des économies actives
substituer par une autre ressource en eau. complémentaires (changement de comportement
des utilisateurs).
([HPSOH1ƒ5LVTXHGHIRFDOLVDWLRQVXU
XQW\SHG·DFWLRQSRXUO·pWDEOLVVHPHQWG·XQ IX.1.1 BILAN SYNTHÉTIQUE DES DIFFÉRENTS
SURJUDPPHG·pFRQRPLHG·HDX SCÉNARIOS

- La ville de Mérignac a privilégié les La comparaison des différents scénarios doit


DFWLRQV G·RSWLPLVDWLRQ OHV SOXV HIÀFDFHV être à la fois technique et surtout économique.
(suivi mensuel des compteurs, équipement Pour que la comparaison soit objective et
hydroéconome des sanitaires, optimisation synthétique, il est recommandé de procéder en
des doses d’arrosage sur les équipements deux temps :
sportifs et les espaces verts…), elle a ainsi
pu réalisée environ 20% d’économies d’eau ™. dresser un bilan synthétique pour chaque
en 3 ans (soit plus de 180 000 m3 cumulés et équipement proposé (par exemple pour les
420 000 !HT) pour un investissement très différentes séries de WC, lavabos, douches
limité de 47 000 !HT. Ce très bon résultat est existants) :
aussi lié à la réussite de la mission transversale
‡ GHVFULSWLI VRPPDLUH GH O·pTXLSHPHQW j
d’un agent auprès des différents services.
installer ;
‡FR€WXQLWDLUH YRLUERUGHUHDXGHSUL[HQ
- D’autres communes ont décidé de cibler
annexe),
leur poste le plus consommateur : l’arrosage
‡QRPEUH
de stade. Et elles ont choisi d’emblée de
‡FR€WWRWDOHQGLVWLQJXDQW
substituer l’eau potable par la récupération
‡OHPDWpULHO
d’eau de pluie. Ces opérations ont eu des
‡ HW OD SRVH HW SRXU FHWWH GHUQLqUH HQ
coûts de revient de 65 000 à 110 000 !, pour
précisant le temps de pose, et si elle est
un volume annuel substitué de 3 500 à 5 500
réalisable par un employé non spécialisé, les
m3/an.
modalités d’accès (ouverture au public) ;
‡ HIÀFDFLWp  G·pFRQRPLH VXU
- Cela ne veut pas dire que la récupération
l’équipement).
de l’eau de pluie ne puisse pas être intéressante ;
mais elle l’est dans certains cas seulement : quand
l’eau de pluie est utilisée toute l’année
š. faire une synthèse par poste de consommation
(par exemple en regroupant les 3 points précédents
(nettoyage de véhicules ou de matériels, voire
dans une rubrique « usages sanitaires »). Elle
arrosage de serres). Ainsi l’entreprise CITRAM
permettra de faire un comparatif des différentes
(transport par autocars) l’a mise en œuvre
actions possibles (économies et différentes
pour son plus gros poste de consommation,
substitutions), pour chaque usage et entre usages
le lavage de ses autocars. Et cette opération
(sanitaires, restauration, arrosage, nettoyage…).
a un temps de retour sur investissement
Cette synthèse mentionnera les points suivants
raisonnable.
(sous forme de différentes colonnes d’un tableau
par exemple) :
Pour éviter cet écueil, il est important:
‡GHVFULSWLIJOREDO
- d’étudier les différentes améliorations
envisageables (économies puis substitution) ‡pYHQWXHOOHVFRQWUDLQWHVHWGpODLGHPLVH
pour les différents postes de consommation en œuvre ;
d’eau, et en particulier les plus gros ‡LQYHVWLVVHPHQWWRWDO IRXUQLWXUHHWSRVH 
consommateurs, ‡pYHQWXHOFR€WGHIRQFWLRQQHPHQW V·LOHVW
différent de celui d’origine, pour d’autres
- HWGHOHVFRPSDUHUHQWUHHOOHVSRXUpWDEOLU facteurs que la consommation d’eau)
OHSODQG·DFWLRQV
‡YROXPHG·HDXDVVRFLpjO·XVDJH

91
‡ pFRQRPLH G·HDX HQ P3 et en ! (le cas G·HDX SRWDEOH VHXOH HQ PR\HQQH ½
échéant ajouter dans la colonne « ! » les HQ *LURQGH  RX G·HDX SRWDEOH DVVDLQLH
économies d’énergie pour l’eau chaude) ; HQ PR\HQQH  ½ HQ *LURQGH  RX
‡ FR€W GX P3 économisé et/ou temps de G·HDX LVVXH G·XQ IRUDJH FR€W GH O·HDX
retour sur investissement (TRI) :  UHGHYDQFH SUpOqYHPHQW  pQHUJLH 
coût du m3pFRQRPLVp LQYHVWLVVHPHQWV pYHQWXHOWUDLWHPHQW 
m3 économisés ; Il faut aussi intégrer les économies
75, HDX  ,QYHVWLVVHPHQW SRXU OH SURMHW d’énergie, via les économies d’eau chaude
/ coût des m3 d’eau économisés chaque sanitaire ;
année. ‡YLVLELOLWpSRWHQWLHOG·LPLWDWLRQHWRXGH
$WWHQWLRQDXSUL[GHO·HDXSRXUOHFDOFXO communication de l’action.
GX75,LOHVWGLIIpUHQWVHORQTX·LOV·DJLW

([HPSOH1ƒFDOFXOVGHWHPSVGHUHWRXUVXULQYHVWLVVHPHQWSRXUTXHOTXHVpTXLSHPHQWVHQ
IRQFWLRQGHOHXUIUpTXHQFHG·XWLOLVDWLRQ

3ODQWHVYLYDFHV
ÁHXULHV )RUDJHjP 5pFXSpUDWLRQ
5RELQHW
SURJUDPPDWHXU GDQVOH3OLR G·HDXGH
7\SH WHPSRULVp
$pUDWHXUVXUURELQHW SOXYLRPqWUH TXDWHUQDLUH SOXLHSRXU
G·pTXLSHPHQW IRXUQLWXUHHW
WHQVLRPqWUH SRXUDUURVHU O·DUURVDJH
SRVH UpJOpjV
JRXWWHjJRXWWH XQVWDGH G·XQVWDGH
VXUXQURQGSRLQW

Sert 3 Sert 20
fois par fois par 150 m2, espèces Stockage de
Remplace un
jour (250 jour (250 végétales et 1 200 m3 à
Descriptif du robinet simple, débit 15 m /h
3
j/an), j/an), arrosage optimisés, ciel ouvert,
fonctionnement utilisé 20 fois par (cas idéal)
pendant pendant en remplacement clôture
jour pendant 30s
30 s, à 12 30s, à 12 GHWDSLVGHÁHXUV
l/min l/min
Volume d’eau
initialement 4 800
4,5 30 30 200
consommé (m3/ (terrain d’honneur, sableux)
an)
Volume d’eau
après travaux 2,25 15 10 60 3 800
(m3/an)
Investissement
7 200 450 10 000 78 000
(!HT)
196 (aep seul)
Economies ou 448 (assain.)
7,2 48 64 6700
d’eau (!HT/an) + 450 suppression
WDSLVGHÁHXUV
0,8 (aep seul)
TRI (an) 1 < 0,2 3 1,5 11,7
0,5 (assain.)

92
IX.1.2. HIÉRARCHISATION DES TRAVAUX - d’abandonner les scénarios correspondant à
un TRI supérieur à 10 ans (15 ans au plus) ;
3RXUUHOHYHUOHGpÀJLURQGLQGHSUpVHUYDWLRQGHV  GH KLpUDUFKLVHU OHV WUDYDX[ j HIÀFDFLWp
nappes profondes, il est nécessaire de réaliser environnementale (volume) et économique
des économies d’eau importantes (15 millions (coût du m3 économisé) intermédiaire, en
de m3 au moins), à court terme (d’ici 2013). gardant à l’esprit ces premiers critères
'·DXWUHVFRQWH[WHVMXVWLÀHQWDXVVLODUHFKHUFKH G·HIÀFDFLWp VHORQ GHV FULWqUHV TXL VHURQW
GHODSOXVJUDQGHHIÀFDFLWpSRVVLEOH propres à chaque maître d’ouvrage, comme
par exemple :
3DU DLOOHXUV OHV pFRQRPLHV G·HDX FRQVWLWXHQW ‡ OD IDFLOLWp HW OD UDSLGLWp GH PLVH HQ
XQH GHV UDUHV DFWLRQV HQ PDWLqUH GH œuvre,
GpYHORSSHPHQWGXUDEOHTXLSHXWrWUHDVVRFLpH ‡la durabilité de l’aménagement,
j GHV pFRQRPLHV ÀQDQFLqUHV LPPpGLDWHV HW
VLJQLÀFDWLYHV ‡ la visibilité ou le potentiel de
communication, avec plusieurs aspects :
(Q PDWLqUH G·pFRQRPLH G·HDX XQ ERQ SODQ - l’image de marque du maître
G·DFWLRQV FRPSRUWH XQH PDMRULWp GH SHWLWV d’ouvrage,
pTXLSHPHQWVDGDSWDEOHVHWGHJHVWHVVLPSOHV - le potentiel d’imitation par les usagers
ou employés chez eux,
Par conséquent, parmi les différents scénarios, ‡le confort d’utilisation,
il est recommandé : ‡ la simultanéité avec d’autres travaux
sur le même site….
- de retenir les travaux ou aménagements
OHVSOXVHIÀFDFHV YROXPHpFRQRPLVpLPSRUWDQW Certaines actions complémentaires, dont
et coût du m3 économisé raisonnable) : O·HIÀFDFLWpHVWSOXVGLIÀFLOHPHQWTXDQWLÀDEOHRX
les opérations à temps de retour sur à plus long terme, doivent aussi être intégrées
investissement (TRI) inférieur à 2 ans sont (sensibilisation des utilisateurs, comptage et
toutes réalisées ; suivi, maintenance…). Elles sont précisées dans
le paragraphe suivant.

([HPSOH1ƒ&RPSDUDWLIGHVGLIIpUHQWV
VFpQDULRVGHO·pWXGHGHFDVGHO·DpURSRUWGH
%RUGHDX[0pULJQDF

'LIIpUHQWVWUDYDX[G·pFRQRPLHVG·HDX

7HPSVGH
9ROXPH (FRQRPLH UHWRXUVXU 3ULRULWp
'HVFULSWLIGH ,QYHVWLVVHPHQW &R€WGXP 3
pFRQRPLVp UpDOLVpH LQYHVWLVVHPHQW WUDYDX[
O·DFWLRQ ½+7 pFRQRPLVp ½
P3  ½+7 PRLV UHWHQXV

Plan des
réseaux 'LIÀFLOHj
6 000 - - - 2
d’eau potable estimer
internes
Mise en place
de compteurs 8 200 Env. 2 500 - - 33 mois 1, en partie
divisionnaires
Mise en place
de mousseurs 3 500 4 100 4 900 0,9 !/ m3 9 mois 1
économiques
Pose de
5 500 1 800 2 200 3 !/ m3 30 mois 2
plaquettes WC
Pose de
mitigeurs 19 400 2 900 3 400 6,8 !/ m3 68 mois 3, en partie
temporisés

&RPPHQWDLUH  OH QRPEUH GH FRPSWHXUV


GLYLVLRQQDLUHVLQLWLDOHPHQWSURSRVpDpWpUpGXLW
SRXUQHUHWHQLUTXHOHVSOXVSHUWLQHQWVHWOD
SRVHGHURELQHWVWHPSRULVpVVHUDUpGXLWHDX[
ODYDERVOHVSOXVXWLOLVpVDSUqVHQTXrWHDXSUqV
GXSHUVRQQHOXWLOLVDWHXUHWG·HQWUHWLHQ

93
'HX[ VFpQDULRV GH VXEVWLWXWLRQ GH UHVVRXUFH
SRXUO·DUURVDJH

7HPSVGH
9ROXPH (FRQRPLH UHWRXUVXU 3ULRULWp
'HVFULSWLIGH ,QYHVWLVVHPHQW &R€WGXP 3
pFRQRPLVp UpDOLVpH LQYHVWLVVHPHQW WUDYDX[
O·DFWLRQ ½+7 pFRQRPLVp ½
P3  ½+7 PRLV UHWHQXV

Forage au 6 500
Plio- (+ 15 000 si 7 000 3 500 0,93 !/ m3 22 mois 2
quaternaire déferrisation)
Citerne
souple de 400
m3 pour la 21 000 7 000 3 500 3 !/ m3 72 mois Non retenu
récupération
d’eau de pluie
* : sur la base de l’estimation par le CREAQ du prix de l’eau pour le nouveau forage

&RPPHQWDLUHOHVVXUIDFHVDUURVpHVVRQWWUqVUpGXLWHVVXUO·DpURSRUWHWHOOHVVRQWVRXYHQWSURFKHV
GHEkWLPHQWVRXGHYRLULHV&·HVWSRXUTXRLODGpIHUULVDWLRQGHO·HDXGX3OLRTXDWHUQDLUHDGDQVXQ
SUHPLHUWHPSVpWpHQYLVDJpH$XYXGXFR€WGHO·RSpUDWLRQOHVJHVWLRQQDLUHVGHO·DpURSRUWYRQW
HQFRUHUpGXLUHOHYROXPHG·DUURVDJH LODGpMjpWpUpGXLWGHPRLWLp YRLUHUHQRQFHUWRWDOHPHQWj
O·DUURVDJHGHFHUWDLQVHVSDFHVYHUWV

IX.1.3. RAPPEL DES AUTRES ACTIONS À PRÉVOIR

Le programme de travaux précédent doit être - ensuite, toutes les dérives potentielles (fuites,
complété par des actions dont l’impact est anomalies…) sont rapidement corrigées,
SDUIRLV SOXV GLIÀFLOH j TXDQWLÀHU RX GRQW OHV
résultats seront observés à plus long terme. Ces - et l’impact des travaux peut être évalué.
actions, rappelées ci-après ne doivent pas être
négligées et constituent souvent des économies ,;0DLQWHQDQFHGHVpTXLSHPHQWVPLV
actives ; certaines d’entre elles doivent même HQSODFH
être réalisées avant toute autre action (suivi
des consommations et pose de compteurs La maintenance des équipements, en particulier
divisionnaires). les équipements sanitaires hydroéconomes est
fondamentale pour pérenniser l’économie d’eau
En ce qui concerne le budget à allouer à ces obtenue.
actions, il peut être intéressant de l’associer au
gain potentiel (en pourcentage d’économie sur ,;6HQVLELOLVDWLRQIRUPDWLRQ
la consommation d’eau totale de départ) :
La sensibilisation du personnel et des utilisateurs,
- 5% pour le suivi des consommations et la voire la formation de certains employés sont
recherche de fuites, nécessaires pour la réussite à court terme du
programme d’actions. A long terme, elles
- 20% pour les économies actives, permettront surtout d’en accroître sensiblement
les résultats.
- la pérennisation d’un gain d’au moins 25%
sur un poste « sanitaire » qui représente 30 IX.2. CHOIX DU PLAN D’ACTIONS
à 70% en moyenne de la consommation d’un
établissement tertiaire. (QÀQ SRXU DUUrWHU GpÀQLWLYHPHQW OH SODQ
d’actions, il faut tenir compte de :
,; 6XLYL GHV FRQVRPPDWLRQV
pYDOXDWLRQGHVUpVXOWDWV - la position du décideur que vous devez
éventuellement convaincre (il peut aussi avoir
La pose de compteurs divisionnaires, le suivi formulé la commande de ce plan d’actions),
(mensuel au minimum) des consommations
d’eau, et l’évaluation régulière (annuelle) des - du délai dans lequel on vous demande ou
résultats obtenus doivent impérativement faire vous souhaitez avoir des résultats,
partie de tout plan d’actions :
- du budget.
- réalisées en amont, ces actions permettent
de disposer d’un état initial clair,

94
Nous décrivons ci-après les grandes lignes des - réduction de pression (si nécessaire, si P >
SODQVG·DFWLRQVW\SHVSRXUOHVWURLVFDVGHÀJXUH 4bars) ;
que nous avons le plus souvent rencontré :
- équipement hydroéconome des sanitaires
- mise en place d’une phase « test » sur une (aérateurs économes sur les becs des lavabos,
SDUWLHGXVLWHDÀQGHFRQYDLQFUHXQGpFLGHXU sacs WC, douches économes) : vu l’importance
d’étendre ensuite le programme d’économie du poste de consommation, permet en général
d’eau à l’ensemble du patrimoine ; d’obtenir une baisse de la consommation
totale de 20 à 30%, rentabilisée en moins
- mise en place d’actions rapidement d’un an, moins de 6 mois si on intègre les
réalisables sur la totalité du site et des postes économies d’énergies;
de consommation, avec un budget assez
restreint ; - programmation au plus juste des systèmes
d’arrosage (système existant ou à prévoir)
- mise en place des actions d’économie en association avec un pluviomètre et un
d’eau sur la totalité du site, avec un budget tensiomètre ;
raisonnable et une vision à long terme,
ambitieuse. - réensemencement des pelouses avec un
Et nous mentionnons surtout les écueils à mélange de fétuque élevée / pâturin des
pYLWHUGDQVFHVWURLVFDVGHÀJXUH près / ray grass (plutôt que ray grass seul), et
ajustement des doses d’arrosage en fonction
'DQVWRXVOHVFDVJDUGHUjO·HVSULWTX·XQERQ de la saison, de la pluviométrie, du sol (argile
SODQ G·DFWLRQV HQ PDWLqUH G·pFRQRPLHV G·HDX < sable) et de l’utilisation (entraînement <
DVVRFLH WRXMRXUV GHV pFRQRPLHV SDVVLYHV honneur pour les stades ; entrée > situation
REWHQXHV HQ LQVWDOODQW GX PDWpULHO  HW GHV latérale pour l’embellissement…).
pFRQRPLHV SDVVLYHV REWHQXHV HQ FKDQJHDQW
OHVFRPSRUWHPHQWV HWFRPSRUWHXQHPDMRULWp $WWHQWLRQVHGRQQHUOHVPR\HQVGHPHVXUHU
GHSHWLWVpTXLSHPHQWVDGDSWDEOHVHWGHJHVWHV OHVUpVXOWDWV
VLPSOHV 5HOqYHPHQVXHOOHGHVFRPSWHXUVDYHFOHFDV
pFKpDQW SRVH GH FRPSWHXUV GLYLVLRQQDLUHV
A noter, quelques idées reçues contre lesquelles FLEODQWOHEkWLPHQWpTXLSp HWOXLVHXO
vous devez vous apprêter à lutter : O·LGpDO HVW G¶DYRLU XQH DQQpH GH UHOqYH
PHQVXHOOH DYDQW OHV WUDYDX[ SRXU SRXYRLU
- l’eau est abondante dans notre région, FRPSDUHU
l’action est motivée par la solidarité avec
les pays en voie de développement, mais en ,;3URJUDPPHG·DFWLRQVUDSLGHPHQW
réalité nous ne sommes pas très concernés ;
UpDOLVDEOHVUHQWDELOLVpHVHQPRLQVGH
- les systèmes hydroéconomes adaptables DQV DXSOXVDQV
sur la robinetterie existante, c’est « de la
quincaillerie », on veut des vraies solutions En plus des éléments précédents :
techniques (imposantes et visibles), telles
que la récupération d’eau de pluie ; - remplacement des robinets les plus utilisés
(> 15 fois/jour), ou souvent retrouvés ouverts
- certains équipements hydroéconomes par des robinets temporisés (y compris
ont déjà été essayés et n’ont pas donné les systèmes de douches complets, déjà
satisfaction (entartrage…) ; il faut convaincre temporisés mais non économes, et où un
que les systèmes récents (et de bonne qualité) simple adaptateur n’a pas pu être installé
n’ont plus cet inconvénient ; dans le programme d’actions précédent);

- ici il n’y a que des bureaux, ce n’est  VXSSUHVVLRQ GHV PDVVLIV GH ÁHXUV DUURVpHV
certainement pas nous qui consommons le par aspersion et remplacement par des
plus…. SODQWHVYLYDFHVÁHXULHVDUURVpHVDXJRXWWHj
goutte ;
,; 3URJUDPPH G·DFWLRQV j EXGJHW
 IRUDJH HQ QDSSH VXSHUÀFLHOOH KRUV 6$*(
UpGXLWSRXUFRQYDLQFUHG·DOOHUSOXVORLQ pour l’arrosage des grandes surfaces (besoin
supérieur à 1000m3/an) ;
3RXU GpPRQWUHU O·HIÀFDFLWp GH OD GpPDUFKH LO
est conseillé de retenir des actions parmi les - récupération d’eau de pluie pour du
VXLYDQWHVHIÀFDFHVjFRXSV€U nettoyage de véhicules, de matériels, voire
de voieries.
- relève mensuelle de tous les compteurs et
analyse régulière des consommations ; $WWHQWLRQ  QH SDV RPHWWUH OHV DFWLRQV GH
VHQVLELOLVDWLRQQLODPDLQWHQDQFH

95
,;3URJUDPPHG·DFWLRQVDPELWLHX[ Certaines entreprises proposent aussi des
services intéressants tels que :
3RXUOHFRQVWUXLUHO·pFRQRPHGHÁX[FRPSOqWHUD
à l’aide du présent guide, les programmes - le suivi du fonctionnement,
SUpFLWpV SDU GHV pOpPHQWV VSpFLÀTXHV j VRQ
patrimoine ou par des actions plus ambitieuses. - une certaine maintenance ou des garanties de
Il pourra s’agir par exemple de : remplacement en cas de dysfonctionnement
ou de mauvais choix d’équipement.
- recyclage d’eau de refroidissement ou de
rinçage ; (QÀQ SRXU OD FRQVXOWDWLRQ GHV HQWUHSULVHV OD
GLIÀFXOWp UpVLGH SDUIRLV GDQV O·pWDEOLVVHPHQW
- nouvel aménagement des espaces verts, d’un cahier des charges détaillé, où l’on décrit
limitant les surfaces arrosées et privilégiant en détail chaque point d’eau et son équipement
les espèces moins consommatrices ; actuel et/ou l’équipement souhaité.

- gestion technique centralisée de Pour les établissements importants, il est


l’arrosage,… recommandé de faire intervenir un bureau
d’études. Pour des établissements de plus
$WWHQWLRQ petite taille ou pour un test pour démontrer
 QH SDV RXEOLHU G·LQWpJUHU WRXWHV OHV DFWLRQV l’intérêt de la démarche, on peut demander à
WUqV HIÀFDFHV FLWpHV GDQV OH SUHPLHU des entreprises spécialisées des devis pour une
SDUDJUDSKH optimisation de tel ou tel poste de consommation
 j O·HIIHW ©  ª VHORQ OHTXHO DYHF ou bâtiment, sans préciser exactement le
 G·LQYHVWLVVHPHQW RQ REWLHQW  GHV matériel souhaité. La comparaison des différents
UpVXOWDWV SRXU OHTXHO RQ ULVTXH GH GHYRLU devis permet souvent de préciser l’équipement
LQYHVWLU EHDXFRXS HQ ÀQ GH SURJUDPPH SRXU le plus approprié. Et pour les collectivités, on
pFRQRPLVHU SHX G·HDX 1RXV FRQVHLOORQV GH reste bien souvent en deça des seuils qui ne
SUpYRLU GqV OH GpEXW GHV SKDVHV GH WUDYDX[ permettent pas de consulter sur devis.
TXLPrOHQWGHVDFWLRQVjWUqVFRXUWHHWjSOXV
ORQJXH UHQWDELOLWp HQ WHUPH ÀQDQFLHU PDLV
DXVVLHQYROXPHpFRQRPLVp 

,;&RQVXOWDWLRQGHVHQWUHSULVHV

Les prix (en particulier des matériels


hydroéconomes pour les sanitaires, mais aussi
de certains équipements de récupération d’eau)
sont très variables d’un fournisseur à l’autre.
&HODVHMXVWLÀHSDUIRLVSDUODTXDOLWpGHVSURGXLWV
et leur mode de production. Dans tous les cas il
est recommandé d'établir plusieurs devis.

/H VLWH ZZZMHFRQRPLVHOHDXRUJ UXEULTXH


©GRFXPHQWDWLRQHWOLHQVªSXLV©IRXUQLVVHXUVª
SURSRVH XQH OLVWH GH GLIIpUHQWV IRXUQLVVHXUV
SDUW\SHGHPDWpULHO

Lors de la consultation, il peut être utile de


prévoir des clauses sociales dans la consultation
des fournisseurs ou entreprises, comme par
exemple :

- l’origine des produits proposés et surtout


leur mode de fabrication (voir ISO 14001),

- la politique environnementale de
l’entreprise,

- les références d’équipements de bâtiments


similaires,

 OHV FHUWLÀFDWLRQV RX QRUPHV REWHQXHV SDU


les produits…

96
X. Conclusion

En matière d’économies d’eau, établir un 6XUODEDVHGHVVFpQDULRVGHFRQVRPPDWLRQV


programme d’actions pertinent nécessite RSWLPLVpHV GHV pYHQWXHOOHV VXEVWLWXWLRQV
d’pWXGLHUOHVGLIIpUHQWVSRVWHVGHFRQVRPPDWLRQ GHUHVVRXUFHjO·HDXSRWDEOHSHXYHQWDORUV
G·HDX (sanitaires, restauration, nettoyage, rWUH HQYLVDJpHV OH FR€W GH OD VXEVWLWXWLRQ
arrosage, refroidissement ….), sans focaliser a Q·HQ VHUD TXH PRLQGUH  SRXU OHV XVDJHV
priori sur un usage, fût-il (apparemment) le plus TXL OH SHUPHWWHQW DUURVDJH QHWWR\DJH GH
consommateur. YpKLFXOHVRXGHPDWpULHOO·XWLOLVDWLRQG·HDX
Il est également recommandé d’pWXGLHU QRQSRWDEOHGDQVOHVFKDVVHVG·HDXGHV:&
O·HQVHPEOH GX SDWULPRLQH. Cela permet QpFHVVLWHXQHGpURJDWLRQSUpIHFWRUDOH 
des comparaisons en phase d’analyse, puis
des économies d’échelle en phase travaux ,O HVW HQVXLWH LQGLVSHQVDEOH G·pWDEOLU XQ
(commandes groupées moins onéreuses, et FRPSDUDWLI GHV GLIIpUHQWV VFpQDULRV VXU
regroupement d’usages pour les ressources OHXUVDVSHFWV :
substituées).
- WHFKQLTXHV (volume économisé, facilité
8Q GLDJQRVWLF LQLWLDO GH TXDOLWp UHSRVH HQ de mise en œuvre, visibilité ou potentiel
JUDQGHSDUWLHVXU de communication, durabilité des
équipements,…).
- XQH pYDOXDWLRQ ÀDEOH GHV YROXPHV G·HDX
FRQVRPPpV SDU FKDFXQ GHV SRVWHV GH - PDLV VXUWRXW pFRQRPLTXHV FR€W HQ ½
FRQVRPPDWLRQ (basée sur des temps de P3 pFRQRPLVp RX WHPSV GH UHWRXU VXU
fonctionnement, des débits unitaires, plutôt LQYHVWLVVHPHQW 75, . En effet, pour
que sur des appréciations ou des ratios). préserver les nappes profondes, il nous faut
rWUHWUqVHIÀFDFHV DJLUYLWHG·LFLVXU
- XQH DSSUpFLDWLRQ MXVWH GH OD IUpTXHQFH des volumes importants, au moins 15 millions
HW GHV FRQWUDLQWHV G·XWLOLVDWLRQ GHV de m3). 3DU DLOOHXUV OHV pFRQRPLHV G·HDX
pTXLSHPHQWV. VRQWXQGHVUDUHVGRPDLQHVHQPDWLqUHGH
GpYHORSSHPHQWGXUDEOHRO·RQSHXWUpDOLVHU
Pour y parvenir, il ne faut pas hésiter à réaliser GHV pFRQRPLHV ÀQDQFLqUHV facilement
des mesures ponctuelles (de débit / volume) ou (en tout cas, pour les premiers 20 à 30%
à installer des compteurs divisionnaires. Outre d’eau économisés). C’est aussi la technique
la découverte de fuites, parfois anciennes et G·pFRQRPLHG·pQHUJLHODSOXVHIÀFDFHYLDOHV
importantes, un suivi régulier (idéalement tous économies d’eau chaude sanitaire.
les mois) des compteurs permettra aussi de
détecter plus rapidement d’éventuelles fuites 3RXU DQDO\VHU O·LQWpUrW ÀQDQFLHU G·XQ SURMHW
ultérieures et surtout de disposer d’un bilan local de substitution de ressource, on peut aussi
LQLWLDOHWGHTXDQWLÀHUOHVUpVXOWDWVREWHQXVDSUqV retenir le coût de revient moyen des substitutions
travaux. Ce suivi des consommations permet de ressource pour la production d’eau potable à
de réaliser des économies d’eau de 10 à 20% la l’échelle départementale : 5 !/m3.
première année, et de 5% en routine.
&·HVWSRXUTXRLHQFRQFOXVLRQXQSURJUDPPH
5HPDUTXHVLGHVSUREOqPHVGHIRQFWLRQQHPHQW G·DFWLRQVFRPSRUWHREOLJDWRLUHPHQW
RXGHTXDOLWpSUpH[LVWHQWGDQVOHVEkWLPHQWV
GRXFKHV pFRVVDLVHV UHWRXUV G·HDX - GHV pFRQRPLHV DFWLYHV (encouragements
VWDJQDWLRQV«  OH GLDJQRVWLF LQLWLDO GHYUD OHV aux changements de comportements, qui
DQDO\VHUFDUOHVpTXLSHPHQWVK\GURpFRQRPHV génèrent un gain à plus long terme);
ULVTXHQWGHOHVDPSOLÀHU
- HW GHV pFRQRPLHV SDVVLYHV (équipements
&RQQDvWUH OHV FRQVRPPDWLRQV HQ HDX GH hydro économes, qui génèrent un gain à court
FKDTXH SRVWH SHUPHW HQVXLWH G·HQYLVDJHU terme).
SOXV MXGLFLHXVHPHQW GHV pTXLSHPHQWV
pFRQRPHV HQ HDX DGDSWpV. 3RXU FHOD LO ,OGRLWVXUWRXWLQWpJUHU :
IDXWSULYLOpJLHUOHVpTXLSHPHQWVVLPSOHVHW
DGDSWDEOHV HW OHV VLWHV RX SRVWHV OHV SOXV - ODSDUW DXPRLQV G·pFRQRPLHVSDVVLYHV
FRQVRPPDWHXUV. IDFLOHPHQWPLVHVHQRHXYUHUHQWDELOLVpHVHQ
PRLQVG·XQDQHWHIÀFDFHVLPPpGLDWHPHQW

97
EDVpHV VXU GHV DPpQDJHPHQWV VLPSOHV HW ÀQGHYLHjO·LGHQWLTXHHQH[FOXDQWOHPDWpULHO
DGDSWDEOHV (équipement hydroéconome des standard…), fondamentale pour pérenniser
sanitaires, aérateurs sur les robinets existants, les économies,
sacs ou plaquettes dans les réservoirs des
WC, douchettes économiques, réglage des - une VHQVLELOLVDWLRQ des usagers en parallèle
temporisations…), réduction de pression, (numéro de téléphone pour signalement de
programmation ajustée de l’arrosage fuite, incitation aux petits gestes économes
actuel avec pluviomètre et tensiomètre, SDU SODTXHWWHV ,QWUDQHW DIÀFKDJH
remplacement du ray grass par de la fétuque, intégration de la problématiques « eau »
paillage ou mulch …. (et « énergie ») dans toutes les formations
- un suivi (au moins mensuel des techniques (boite à idées, …), qui permettra
consommations), pour limiter les fuites, à plus long terme de faire évoluer les
avant d’être plus ambitieux. comportements, et de réaliser des économies
Or ce sont parfois les programmes les plus passives supplémentaires (20% au moins),
volontaristes qui méconnaissent ces actions. liées à ces changements.

,O YLVH DX PLQLPXP  G·pFRQRPLH G·HDX


HW SHXW DWWHLQGUH DX PRLQV  GH JDLQ VL
HQ SOXV GX VXLYL GHV FRQVRPPDWLRQV HW GHV
DPpQDJHPHQWV UHQWDELOLVpV HQ PRLQV G·XQ
DQ FLWpV SUpFHGHPPHQW RSWLPLVDWLRQ GHV
pTXLSHPHQWV VDQLWDLUHV HW G·DUURVDJH  , il
prévoit :

- OH UHPSODFHPHQW GHV pTXLSHPHQWV


WUqV XWLOLVpV HW LQDGDSWpV (temporisation
des robinets et des chasses d’eau les plus
fréquemment utilisés, soit plus de 15 fois par
jour), OHUHPSODFHPHQWGHVÁHXUVDQQXHOOHV
HWGHOHXUV\VWqPHG·DUURVDJHSDUDVSHUVLRQ
SDU GHV SODQWHV YLYDFHV HW GHV JRXWWHV j
JRXWWHV,….
Ces nouveaux équipements ou aménagements
sont généralement rentabilisés en moins de 3
à 5 ans,

- le recyclage des eaux de refroidissement ou


de piscine, une gestion technique centralisée
de l’arrosage, une gestion différenciée des
espaces verts,… &HV DPpQDJHPHQWV VRQW
UHQWDELOLVpVjSOXVORQJWHUPH jDQV 
FHUWDLQVG·HQWUHHX[HQSDUWLFXOLHUSRXUOHV
HVSDFHV YHUWV FRUUHVSRQGHQW DXVVL j XQH
QRXYHOOH IDoRQ GH WUDYDLOOHU TXL GHPDQGH
GXWHPSVHWXQHLPSOLFDWLRQUHQRXYHOpHGX
SHUVRQQHO,

- OD VXEVWLWXWLRQ GH O·HDX SRWDEOH RX


GX IRUDJH HQ QDSSH SURIRQGH SDU XQH
UHVVRXUFH QRQ GpÀFLWDLUH. Pour l’arrosage,
il faut penser à un forage peu profond, à un
étang ou à une source avant d’envisager la
récupération d’eau de pluie qui nécessite
un important stockage et est rarement
rentabilisée en moins de 15 ans. Elle n’est
pas recommandée pour l’arrosage ; elle est
mieux adaptée au nettoyage de véhicules ou
matériels voire à l’alimentation des chasses
d’eau des WC des bâtiments neufs (après
dérogation préfectorale),

- une PDLQWHQDQFH des dispositifs installés


(réparation des fuites, remplacement des
joints, réglage des temporisations, et surtout
remplacement du matériel hydroéconome en

98
Annexes du guide
X.1. Fiche étape 1 : identification du (ou des) site(s) étudié(s)

3HUVRQQHUpIpUHQWH 8VDJHV
$FWLYLWp
'pVLJQDWLRQ $GUHVVH 1RPIRQFWLRQ /LVWHFRPSOqWHGHV
SULQFLSDOH
FRRUGRQQpHV  XVDJHV

- sanitaires
- bâtiment 1 - bureaux
- restauration (cafétéria)

- pelouse
- arrosage
(façade)

&HWDEOHDXGRLWrWUHXWLOLVpSRXUUHFHQVHUOHVEkWLPHQWVHWRXHVSDFHVH[WpULHXUVFRQFHUQpVSDU
OHGLDJQRVWLF($8

100
X.2. Fiche étape 2 : identification des ressources en eau

2ULJLQHGH 5HVVRXUFHVDOWHUQDWLYHV
5HVVRXUFH %kWGHVVHUYL 8VDJHV
O·HDX SRWHQWLHOOHV

- sanitaires
aucune
-restauration (cafétéria)
Eau potable bâtiment 1 - eau potable

- arrosage forage et eau de pluie

Source aucun - non utilisée - ancien lavoir

&HWDEOHDXDSRXUXWLOLWpGHUHFHQVHUOHVSURYHQDQFHVGHO·HDXXWLOLVpHVXUOHVLWH

101
X.3. Fiche étape 3 : identification des usages ou postes de
consommation et caractérisation des équipements

RÉFÉRENT DU SITE :

1RP : ....................................................... )RQFWLRQ : ...............................................

&RRUGRQQpHV : .........................................................................................................

1RPEUHGHQLYHDX[ : RdC + ............................... 6XUIDFHWRWDOH P2 : ...............................

+HXUHVG·RXYHUWXUH : Public : ........................ (PSOR\pV : ...............................................

)UpTXHQWDWLRQ (à remplir en fonction des éléments connus)

3HUPDQHQWV 3XEOLFPR\HQ
1RPEUHGHMRXUV
HPSOR\pVRFFXSDQWV SUpFLVHU
SDUDQG·XWLOLVDWLRQ 7RWDOVXUO·DQQpH
SDWLHQWVpOqYHV DQQXHO
GXOLHX
MRXUQDOLHU

Année 0

Année -1

Année -2

Moyenne

POSTES DE CONSOMMATION (PLUSIEURS RÉPONSES POSSIBLES, RAYER LES MENTIONS INUTILES) :

sanitaires (WC, douches, lavabos) climatisation


nettoyage (sols, véhicules, matériels) production de froid
restauration sécurité incendie,
lavage du linge arrosage
piscine bassin décoratif
logement de fonction services techniques :
autre usage :

RESSOURCES EN EAU ET PÉRIMÈTRE ALIMENTÉ :

9ROXPH 9ROXPH
9ROXPH 9ROXPH
1DWXUHGHOD DQQpH DQQpH
3pULPqWUHDOLPHQWp &DUDFWpULVWLTXHV DQQpHQ PR\HQ
UHVVRXUFH QP3 QP3
P3DQ P3DQ
DQ DQ

eau potable N°compteur :

débit minimal :
source débit maximal :
débit du jour :

N°compteur :
N°BSS :
forage
Nappe concernée :
Profondeur :

eau de pluie Volume de la cuve

autre :
* cocher de façon particulière les usages ci-dessus ou joindre un plan
102
MESURE DE PRESSION ET DE DÉBIT

8QHPHVXUHSDUEkWLPHQWVXIÀWjGpIDXWXQHPHVXUHGHGpELWVXUXQURELQHWVWDQGDUGSHUPHWG·LQGLTXHU
VLODSUHVVLRQHVWpOHYpHRXQRQ 4 OPLQjEDUVOPLQjEDUHWOPLQjEDUV 

RXGpELWVXUXQURELQHWVWDQGDUG
/RFDOLVDWLRQ 3UHVVLRQ EDUV
OPLQ

EVALUATION DES VOLUMES CONSOMMÉS PAR USAGE ET INVENTAIRE DES ÉQUIPEMENTS

6DQLWDLUHV

2EVHUYDWLRQV
1DWXUH )UpTXHQFHG·XWLOLVDWLRQ $GpTXDWLRQ
pWDW
7\SH FRGH DXEHVRLQ
/RFDOLVDWLRQ 4XDQWLWp PHVXUHV
pTXLSHPHQW pTXLSHPHQW 0RGLÀFDWLRQ
Intensive Faible UpDOLVpHV
FIDQQ moyenne jDSSRUWHU
(>15fois/j) (< 3fois/j) IXLWHV«
WC 3/6 l 3 X
douchette
douche douchette 1 X 16 l/min
économe
Bâtiment 1
lavabo mélangeur 3 X 12 l/min aérateur
évier mitigeur 1 X aérateur

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV :

)LDELOLWpGHO·pYDOXDWLRQ

103
1HWWR\DJHGHVORFDX[

- Surface des sols nettoyée à l’eau : ............................... m2


- Nombre de nettoyages par jour : ..................... semaine : .......... mois : .......... an : ........
- Matériels utilisés : ................................................................................................
- Volume d’eau par nettoyage : ..................................................................................

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV 

)LDELOLWpGHO·pYDOXDWLRQ

5HVWDXUDWLRQ

- Préparation des repas :


" Nombre de repas préparés sur place/ jour : ...............................
" Nombre de repas pris sur place/ jour : .....................................
" Nombre de jours d’ouverture dans l’année : ..............................

- Vaisselle :
" Avec appareil de lavage :
- nombre d’appareils : ........................... et capacité des appareils (Nb.couverts) : ..........
- nombre de cycles/semaine : ............ et consommation en eau/cycle : ........... litres /cycle
- ou âge et état du matériel : ...............................
" Manuel :
- nombre de robinets ............. et durée d’ouverture des robinets ............. (évalué en h/j)
- débit des robinets(mesuré) : .............

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV 

)LDELOLWpGHO·pYDOXDWLRQ

/DYHULH OLQJH 

- Nombre d’appareils .............


- Capacité des appareils (kg) .............
- Nombre de cycles/semaine .............
- Consommation en eau/cycle .............

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV 

)LDELOLWpGHO·pYDOXDWLRQ

3LVFLQH

- Volume(s) bassin(s) : ............. m3


- Nombre moyen de baigneurs par jour : .............
- Période d’ouverture : .............
- Traitement d’eau (chlore stabilisé, eau de javel + stabilisant éventuel, brome, chlore gazeux….) :
.............................................................
- Renouvellement en eau : ............. m3/j et ............. l/baigneur
- Nombre de vidanges/an : .............

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV 

)LDELOLWpGHO·pYDOXDWLRQ

104
/DYDJHGHVYpKLFXOHV

7\SHGHYpKLFXOHV 0pWKRGH UDPSHDXWRPDWLTXHMHW


1RPEUHGHYpKLFXOHV 9ROXPHXQLWDLUH
YRLWXUHFDPLRQ« KDXWHSUHVVLRQVHDXpSRQJH«

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV 

)LDELOLWpGHO·pYDOXDWLRQ

$UURVDJH

([LVWHQFHHWSDUDPpWUDJH
GHO·DVVHUYLVVHPHQW
)UpTXHQFH
0DWpULHOXWLOLVp GHO·DUURVDJH
6XUIDFH G·DUURVDJH
7\SHGH DVSHUVLRQ SURJUDPPDWHXU
DUURVpH GpELWXQLWDLUH &RPPHQWDLUH
YpJpWDWLRQ JRXWWHjJRXWWH SOXYLRPqWUH
P2 HWYDULDWLRQ
MHWWRQQH« WHQVLRPqWUH
VDLVRQQLqUHV
DQpPRPqWUH*HVWLRQ
WHFKQLTXHFHQWUDOLVpH«

Arbustes

Pelouse

0DVVLIVÁHXULV

Honneur ou
Stade
entrainement

autre :

9ROXPHDQQXHOSRXUFHWXVDJH H[SOLFLWHUOHVFDOFXOV 

)LDELOLWpGHO·pYDOXDWLRQ

6200('(686$*(692/80($118(/727$/

&RPSDUDWLIDXYROXPHUpHOOHPHQWFRQVRPPp

105
X.4 Outil d’aide : descriptif sommaire des principaux équipements

:&

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

A chaque utilisation, la totalité du réservoir


est vidée (généralement 9 litres, jusqu’à
Système le Dispositif classique, très
12).
plus courant consommateur
Fuites fréquentes (joint situé à la base du
WC mécanisme mécanisme WC).
simple commande
non interrompable
Information sur le bon usage
du mécanisme à prévoir.
Matériel fragile peu adapté
aux usages intensifs ou
Ce système permet de ne vider que
Remplacement aux enfants, et souvent
partiellement le réservoir (la moitié). Il
partiel mal utilisé par les adultes
peut s’adapter sur un réservoir classique.
dans les lieux publics
WC avec mécanisme
où il ne permet pas de
double commande
réaliser d'économies d'eau
(3/6 litres)
importante.
Les modèles interrompables
Ce matériel est économe car la quantité jWLUHWWHVRQWWUqVHIÀFDFHV
d’eau est adaptée aux besoins, pour réaliser des économies
DYHFFDVGHÀJXUH d'eau (>3/6 l) et peuvent
1 - Modèles simples à tirette qui même être utilisés pour
s'interrompent quand on la relache. Ce sont de forte fréquentation.
Remplacement
OHVSOXVHIÀFDFHVV
LOVVRQWUREXVWHV En revanche, les modèles
partiel
2 - Modèles encastrés d’origine au sein du interrompables à 2 boutons
WC mécanisme
réservoir (photo) ou qui peuvent s’installer présentent peu d'interêt pour
simple commande
en remplacement de mécanisme à bouton économiser l'eau : l'utilisateur
interrompable
central. L'interruption se fait par un nouvel doit être sensibilisé et utilise
appui sur un second bouton. peu le bouton d'interruption.
Ce mécanisme est fragile.
Il est parfaitement adapté
aux sanitaires des sites à
IRUWHDIÁXHQFH
Ce système est dépourvu de réservoir : une
colonne d’eau (interrompue par un robinet
Par rapport au mécanisme
temporisé) vient directement alimenter
3/6l, ce système résout
OH:&,OQpFHVVLWHXQHFXYHWWHVSpFLÀTXH
les problèmes de temps
(différente de celle des WC à réservoir), et
Remplacement d’attente de remplissage du
doit être installé par un professionnel.
total réservoir entre deux chasses,
Le robinet temporisé, est activé par
de blocage de mécanisme
WC à robinet pression, et délivre de l’eau pendant une
et d'obstruction des
temporisé durée d’environ 6 à 7 secondes. Le volume
canalisations d'évacuation.
délivré est faible (3 à 6 litres).
Il nécessite un réglage
régulier (tous les ans) de la
temporisation.

Ce système à manette est


Ce système fonctionne sur le même plus adapté pour les enfants
principe que le précédent. Toutefois, le (actionnement facilité par
volume d’eau délivré est forfaitaire et pas rapport au bouton poussoir),
Remplacement toujours économe en eau mais il n’est pas toujours
total (parfois 9 litres/chasse). économe en eau.
WC à levier Certains modèles sont munis d’un bouton La présence d’un bouton
d’arrêt qui permet de le réduire le volume d’arrêt rend le dispositif plus
chasse mais sont peu utilisés. économe mais l’utilisateur
doit y être sensibilisé.

106
:&

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Un réservoir longitudinal contenant de l’air


Ce système de plus en plus
(sous pression) permet d’amener l’eau à
rare, est économe en eau.
une pression pouvant aller jusqu’à 6 bars.
Système Lors du déclenchement de la manette, une
Il n’est toutefois pas adapté
existant (rare) certaine quantité d’eau est libérée avec
aux utilisations intensives
force (2 à 5 litres). Le système s’arrête lors
WC à contre-pression (temps de remplissage du
du relâchement de la poignée. Ce matériel
d’air (réservoir réservoir trop long).
doit être installé par un professionnel.
hydropneumatique)

Ce dispositif nécessite une cuvette


VSpFLÀTXHDLQVLTXHOHUHVSHFWGHUqJOHV
d’installation. L’augmentation de hauteur &HV\VWqPHWUqVVSpFLÀTXH
Matériel
d’eau déclenche l’écoulement à travers peut être envisagé dans des
VSpFLÀTXH
WC à acclération un siphon, produisant un effet venturi. La installations neuves.
(source Agence de l’Eau consommation d’eau est limitée (réservoir
Adour-Garonne) de 4 litres).

Il s’agit d’un rectangle en matériau


polymère souple, qui se place au fond
du réservoir, permettant de retenir 1 à
1,5 litre(s) d’eau. Généralement deux Système bien adapté à la
plaquettes peuvent être installées dans un réduction de consommation
même réservoir (3 litres d’eau retenus). d’eau des WC.
Contrôle régulier de la bonne
Assez faciles à mettre en place, adaptées installation des plaquettes
à tous les WC simple commande non à prévoir.
Complément
interrompable, elles ne nécessitent pas
obligatoirement l’intervention d’un Attention : installation à
Plaquette WC professionnel pour la mise en place. YpULÀHUSpULRGLTXHPHQW
Il n’y a pas d’intervention de l’usager. la plaquette peut se
désolidariser du réservoir et
A chaque utilisation le volume libéré sera être inopérante.
identique, et réduit de 1.5 à 3 litres (selon
que l’on peut installer 1 ou 2 plaquettes)
par rapport à un système classique.

Plus facile à installer que le dispositif


précédent, il est aussi moins onéreux,
pour un effet assez similaire, qui préserve
cependant un peu moins l’effet de chasse.
Il n’y a pas d’intervention de l’usager. A
chaque utilisation le volume libéré sera
identique, et réduit d’environ 2 litres par
rapport à un système classique. C’est le système le plus
Complément Les modèles qui peuvent être suspendus sur adapté pour réduire la
le côté du réservoir sont préférables (pas consommation d’eau des WC.
de risque d'entraver le fonctionnement du
Sacs WC mécanisme).
(Source Eco-techniques)
Attention aux boutons de mécanisme
à visser : l’épaisseur de l’attache de
suspension du sac peut gêner le revissage
du bouton.

Système adaptable à certains


Ce dispositif permet de transformer mécanismes seulement.
Complément un mécanisme simple en mécanisme Forme et poids variables
interrompable. selon les mécanismes
Poids pour mécanisme existants.
:&jÁRWWHXU
(source Bascoplus)

107
85,12,5

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Il est parfaitement adapté


aux sanitaires à forte
Matériel le Le fonctionnement est identique au WC à
DIÁXHQFH,OQpFHVVLWH
plus courant robinet temporisé.
un réglage régulier de la
Urinoir temporisé temporisation.
(bouton poussoir)

Ce matériel est parfaitement


adapté aux sites à forte
fréquentation dans un temps
limité. L’économie d’eau
SURYLHQWGXUpJODJHÀQGX
débit et de la durée de
Une cellule à détection de présence
fonctionnement.
actionne l’ouverture puis la fermeture de
L’utilisation de systèmes
la vanne alimentant l’urinoir (temporisation
de détection à distance
Remplacement réglable entre 0 et 9 secondes) au départ
permet d’améliorer
total de l’utilisateur. Pour certains modèles ,
Urinoir électronique l’hygiène des sanitaires
un pré-rinçage de l’urinoir peut être
(infrarouge) étant donné que le rinçage
programmé à l’arrivée de l’utilisateur.
s’effectue automatiquement
derrière chaque utilisateur
contrairement aux systèmes à
bouton poussoir pour lesquels
l’utilisateur doit actionner le
système.

Ce dispositif est adapté aux


sanitaires très fréquentés.
Ce dispositif fonctionne totalement
Le retour sur expérience
sans eau. L’économie d’eau est donc
est, selon les fournisseurs,
importante.
soit très bon, soit très
Remplacement L’hygiène est assurée par une pellicule
mauvais (odeur et/ou
total d’huile qui isole (et surplombe) l’urine,
coût de fonctionnement
HWSDUXQHÀOWUDWLRQGDQVXQHFDUWRXFKH
Urinoir sans eau trop important du fait du
dédiée qui doit être régulièrement
(à huile) remplacement fréquent des
remplacée.
(source SMEGREG - cartouches).
MC Donald's)

9$11('(&28385((7*(67,21&(175$/,6((

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Pour les sites peu visités


susceptibles de présenter
des fuites ou de subir
du vandalisme et où une
coupure d’eau est tolérable.
Coupe automatiquement l'eau dès lors
Vanne de coupure Variante pour l'arrosage :
qu’un débit continu est détecté
automatique coupe l'eau chaque jour
(il est réglable).
après délivrance d'un volume
programmé à l'avance (limite
(source : Hydrelis)
les pertes d'eau par des
arroseurs défectueux ou
vandalisés).

Mesure le débit en continu à partir d’un


compteur et transmet les données :
Gestion technique centralisée
SDU*60RXOLDLVRQÀODLUHjXQSRVWHÀ[H
Module de d'arrosage ou de sites
Celui-ci peut alors être interrogé à
transmission pour étendus (supermarchés,
distance via Internet,
compteur aéroports, hôpitaux ...).
- par radio un poste mobile embarqué à
bord d'un véhicule.
(source Hydreka)

108
'28&+(6

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

/HVGRXFKHVÀ[HVLQWpJUHQWXQV\VWqPHGH
Ces douches sont adaptées
réduction de débit (6 à 10 litres/minute) :
aux sites recevant du public
- dans leur conception d'origine
et à forte fréquentation.
- ou à l'aide d'un adaptateur.
Remplacement Le conseil d'un professionnel
partiel ou est recommandé pour
Certains modèles sont équipés d’un bouton
total le choix d'un éventuel
'RXFKHÀ[HPXUDOH poussoir avec un système anti-blocage :
adaptateur de pomme de
économe avec robinet il faut relâcher le bouton pour que l’eau
douche économe (parfois ce
temporisé ou bouton continue de couler. Cela permet de limiter
n'est pas possible).
poussoir rotatif la durée des douches.

Ensemble composé d’une douchette


hydroéconome (6 à 10 litres/minute, 8 à
9 litres/minute étant l'optimum) et d'un
ÁH[LEOHUHQIRUFp ODUpGXFWLRQGHGpELW
DXJPHQWHODSUHVVLRQXQÁH[LEOHUHQIRUFp
est donc recommandé).
Attention :
- les douchettes multijets économes pour Les ensembles douchette/
un seul jet ne sont pas recommandées ÁH[LEOHVRQWSOXW{WDGDSWpV
Remplacement
- certaines douchettes ne sont pas pour des usages à
total
conçues comme hydroéconomes (principes fréquentation moindre.
Douche « téléphone » compression - injection - éclatement ou
GRXFKHWWHÁH[LEOH turbulence ou pulsante) mais seulement
munies d'une pastille de réduction de débit
jQHSDVFRQIRQGUHDYHFXQÀOWUHTXLOXL
est recommandé). Elles ne sont alors pas
recommandées car elles procurent un
confort très limité.

Ce dispositif, très facile à installer est très


HIÀFDFHSRXUUpGXLUHOHGpELW
(6 à 12 litres/minute, un débit supérieur à
10 litres/minute étant recommandé pour le A réserver aux douches peu
Complément
confort d'utilisation). Il procure un confort utilisées
d’utilisation nettement inférieur à
Réducteur de débit l’équipement précédent, pour un coût
pour douchette moindre également.

$pUDWHXUVSRXUODYDERVHWpYLHUV

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Pièce située en sortie de robinetterie


qui ne sert qu’à « casser » le jet. Il n’y a
Dispositif
aucune réduction de débit. Le débit en
courant
sortie pour une pression de 3 bars est de
Brise-jet
12 litres par minute.

Ces modèles permettent de donner un Ces aérateurs peuvent être


aspect « crémeux » (mélange air/eau) laissés en place seulement
Dispositif
à l’eau en sortie de robinet. Le débit si le robinet sert peu et
courant
Aérateur classique minimum de sortie est de 12 litres/minute, principalement à remplir des
au minimum, sans économie d'eau. récipients.

Contrairement aux modèles « standard » A positionner en sortie de


les aérateurs économes comportent un robinet (pourvu d’une bague)
réducteur de débit permettant de ramener à chaque fois que cela est
ce dernier de 2.5 à 10 litres / minute : possible.
- OPLQHQJpQpUDO, Il existe des modèles non
Remplacement
- au minimum 8 l/min pour garantir autorégulés (le débit est
partiel
le déclenchement d’un chauffe eau sensible aux variations de
Aérateur économe instantané, pression) et autorégulés
jOPLQSHXYHQWVXIÀUHSRXUOH (débit constant quelle que
lavage des mains des enfants ou pour une soit la pression, préférables,
salle de bain. mais plus onéreux).

109
$pUDWHXUVSRXUODYDERVHWpYLHUV

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Ce type de réducteur de débit fournit un


jet laminé (sans mélange d’air), à débit
réduit (4 à 10 litres/min).
Remplacement Milieu médical
Il existe aussi des réducteurs de débit à jet
partiel Personnes sensibles
Réducteur de débit à aiguilles, interressants pour les salles de
non aérateur bain (rinçage des brosses à dents et
(sources ECOPERL et des rasoirs).
NEOPERL)

5HPDUTXHW\SHGHEDJXHSDUW\SHGHURELQHW OHMRLQWHVWDORUVGXPrPHGLDPqWUHTXHODEDJXH 

source ECOPERL

/HVKDXWHXUVGHEDJXHVYDULHQWDXVVLVLHOOHHVWFRXUWHSUpIpUHUXQDpUDWHXUQRQUpJXOpHQJpQpUDO
PRLQVKDXWTX
XQDpUDWHXUUpJXOp
&HUWDLQVURELQHWV GHVLJQWHPSRULVpVDYHFGRXFKHWWH« QHFRPSRUWHQWSDVGHEDJXH

5RELQHWWHULH

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Conserver ce matériel au
niveau de points de puisage à
faible fréquentation, sauf en
Robinet ne distribuant que de l’eau chaude
cas d’ouverture intempestive
ou froide. 2 systèmes : à clapet et à tête
Matériel fréquente.
en céramique. Le système à tête en
classique A déconseiller sur des sites
Robinet simple céramique permet une ouverture ou
présentant une forte
mécanique fermeture complète en un demi-tour.
fréquentation (temporisation
préférable). Risque
de surconsommation.
Ce matériel est parfaitement
bien adapté pour les sites
Une pression sur le bouton poussoir à forte fréquentation ou
Matériel
déclenche l’ouverture du robinet pendant les robinets retrouvés
classique
10 à 20 secondes, ce dernier se fermant fréquemment ouverts.
ou
automatiquement avec le retour du Prévoir un réglage régulier
remplacement Robinet simple
poussoir. Certains modèles sont économes (tous les ans) des durées de
total temporisé
en eau (débit réduit) mais pas tous. temporisation, d'autant plus
court que le débit délivré est
important.

Ce matériel est parfaitement


Robinet ne distribuant que de l’eau
bien adapté pour les sites
chaude ou froide mais avec commande par
Matériel à forte fréquentation. De
détection de présence (infrarouge), et
VSpFLÀTXH plus, l’hygiène est améliorée
fourniture d’un volume d’eau limité (ils
par l’absence de contact au
Robinet simple sont tous économes en eau).
niveau de la robinetterie.
électronique

110
5RELQHWWHULH

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Le robinet mélangeur est constitué de deux


A bannir dans les installations
poignées (une pour l’eau froide et une pour
neuves.
l’eau chaude). On règle manuellement le
Matériel débit et la température simultanément. La
Peut être conserver pour les
courant Matériel courant recherche de la température souhaitée
installations existantes, sauf
génère une surconsommation.
en cas d’usage très intensif
Deux systèmes existent : à clapet et
(privilégier les mitigeurs).
à têtes en céramique.

Le robinet est pourvu d’une seule


Matériel
commande permettant à la fois de régler le
courant
débit et la température de l’eau. Ce Adapté aux utilisations
ou
matériel permet a contrario du mélangeur intensives
remplacement
Mitigeur mécanique GHPRGLÀHUOHGpELWWRXWHQFRQVHUYDQWXQH
total
température constante.

Nettement plus onéreux que


le précédent, ce matériel est
recommandé pour les
Ce matériel en plus du mitigeur mécanique,
utilisations intensives,
Matériel possède un bouton poussoir qui délivre
lorsque les mélangeurs ou
VSpFLÀTXH l’eau pendant un temps donné (soit
mitigeurs précédents sont
1.5 à 3 litres à chaque cycle), réglable.
Mitigeur temporisé retrouvés ouverts et qu’il
n’est pas possible de ne
fournir que de l’eau froide.

Ce matériel est très bien


adapté à une utilisation en
La cartouche céramique de ce type de
cuisine, et peut s’envisager
mitigeur présente la particularité d’avoir
pour les salles de bain
deux positions : la première fournit
ou autres dès que l’on doit
Remplacement un débit limité pour les utilisations
remplir ponctuellement des
total courantes (6 à 8 l/min) ; et la manette est
récipients.
débrayable (par simple poussée plus
Il présente aussi l’avantage
importante) pour le remplissage de
Mitigeur à double de moins s’entartrer que les
récipients de grande capacité par exemple.
butée ou à manette aérateurs installés au bec des
clic-clac robinets.

La douchette de prélavage permet de


Ce matériel est recommandé
délivrer une plus forte pression pour le
pour les cuisines, en
nettoyage préalable de certains récipients.
Complément particulier lorsque le
/·HIÀFDFLWpGXSUpODYDJHUpGXLWHQVXLWHOH
ou volume de vaisselle est
temps de lavage.
remplacement assez important mais pas
total DVVH]SRXUMXVWLÀHUO·DFKDW
Mitigeur avec Ce système peut s’adapter sur certains
d’un lave batterie ou lave
douchette de rinçage mitigeurs, mais en général, un mitigeur
ustensiles.
pour évier VSpFLÀTXHHVWQpFHVVDLUH
(source Sider)

Ce matériel est adapté


Complément La commande au genou est recommandée
dans les cuisines (souvent
ou pour faciliter l’ouverture et la fermeture de
obligatoire), les ateliers ou
remplacement certains robinets et ainsi réduire le temps
certains équipements
total Commande au genou global d’ouverture.
sportifs.
pour lave-mains
(source Sider)

111
$UURVDJH

7\SH 0DWpULHO 'HVFULSWLI 3UpFRQLVDWLRQG·XWLOLVDWLRQ

Le goutte à goutte permet d’optimiser la


consommation en eau, en apportant la Système à privilégier pour les
Remplacement
quantité en eau nécessaire directement au PDVVLIVÁRUDX[OHVKDLHVOHV
total
pied du végétal (limitation de l’évaporation arbustes.
et du ruissellement).
Goutte à goutte

Jets de petites dimensions permettant Système adapté pour les


Matériel d’arroser au ras du sol en limitant au PDVVLIVÁRUDX[OHVKDLHV
courant maximum les déperditions liées à un vent les arbustes, mais moins
excessif. économe que le précédent.
Microjets

$ÀQG·DPpOLRUHUOHV
performances, la mise en
Système adapté pour l’arrosage de surfaces
marche de l’installation est
engazonnées ou de massifs. Un système de
préconisée la nuit et
programmation y est en général couplé.
Matériel en absence de vent. Un
Préférer les systèmes à faible débit et
courant arrosage en 2 temps avec
longue portée, voir avec régulateurs de
KXPLGLÀFDWLRQSUpDODEOH
Turbine et tuyère pression pour réaliser des économies d'eau
réduit la consommation d'eau
escamotable plus importantes.
mais aussi la durée de vie du
matériel.

La mise en marche de
Matériel l’installation est préconisée
Permet l’arrosage de surfaces importantes.
courant la nuit et en absence de vent,
limitant ainsi les pertes.
Enrouleur

Le programmateur permet d’ajuster la dose


d’eau apportée à la saison et aux
différentes zones arrosées (séparées
par des électrovannes), voire à la
Complément Dans tous les cas
pluviométrie, à l’humidité du sol ou au
Programmateur
vent si le programmateur est couplé à des
Sources Rain bird
équipements supplémentaires (pluviomètre,
et Toro
tensiomètre, anémomètre).

Le tensiomètre, associé au programmateur,


permet de déclencher l’arrosage quand la Très fortement recommandé
réserve d’eau utile dans le sol est trop Préférable au suivant si des
Complément
faible. Il permet d’ajuster les doses au plus actes de vandalisme sont
juste des besoins des plantes, sans craindre possibles.
de faire trop souffrir les plantes.
Tensiomètre

Très fortement recommandé


Préférable au précédent
Le pluviomètre, associé au programmateur, si la surface à arroser est
Complément permet d’éviter l’arrosage en cas de importante et la nature du
Pluviomètre pluie. sol variable.
électronique Attention : ne pas l'installer
(source Leroy Merlin) à l'abri

L’anémomètre, associé au programmateur, Recommandé pour l’arrosage


permet d’éviter d’arroser par vent fort à l’aide de turbine ou tuyères
Complément
(évaporation importante et surtout escamotables, et surtout
déviation du jet). d'enrouleur.
Anémomètre

112
X.5 Outil d’aide : principaux ratios de consommation d’eau

$9(57,66(0(17 : la comparaison à des ratios d’études plus systématiques par secteurs et


permet d’une part de se situer globalement par usages ;
par rapport aux établissements similaires. - les consommations actuelles des bâtiments
Néanmoins il est nécessaire de faire les mises tertiaires ne sont pour la plupart pas
en garde suivantes concernant l’utilisation des optimisées. En conséquence se situer dans
ratios : une moyenne, voire même dans le bas de la
IRXUFKHWWHQHVDXUDLWrWUHXQHUDLVRQVXIÀVDQWH
- les études sur les consommations d’eau sont pour ne pas mener dans son établissement une
encore peu nombreuses et peu de valeurs analyse des consommations et une politique
de ratios sont disponibles, on retrouve en de réduction des consommations.
fait un certain nombre de valeurs qui sont
reprises d’une publication à une autre, cette /HWDEOHDXVXLYDQWGRQQHOHVSULQFLSDX[UDWLRV
répétition ne constitue pas une validation. FRQQXV j FH MRXU DYHF GHV UHPDUTXHV TXL
Les ratios doivent être considérés comme des VRQW GHVWLQpHV j SHUPHWWUH G·DSSUpFLHU OHXU
indications dans l’attente de la publication DPSOLWXGHRXOHXUGRPDLQHG·HPSORL

7<3(
RATIO 5(0$548(6
'·(7$%/,66(0(17

Bâtiment administratif 30 à 50 litres / jour et S’applique à des bureaux recevant peu de public.
de faible capacité employé Peut aussi correspondre à la consommation stricte des
(5 à 30 personnes) 4l/j/m2 de bureau sanitaires d’un employé de bureau.

Ce ratio s’applique plutôt aux grands ensembles de


bureaux multiservices (cantine, clim, réception de visiteurs
nombreux...).
Grand ensemble de 100 à 150 litres / jour et Il est souvent présenté, à tort, par rapport au précédent
bureaux employé administratif ratio comme correspondant aux bureaux climatisés. En
effet, tous les types de climatisation ne consomment pas
beaucoup d’eau, et d’autres postes de consommation
peuvent expliquer la différence.

3.2 m3/an/élève de collège en Gironde


peut aller jusqu’à 6 m3/an/élève, pour les établissements
3 à 4 m3 / an et élève en techniques ou les laboratoires universitaires. En général la
Scolaire
moyenne consommation unitaire augmente avec l’âge des élèves, de
2.5 à 4 m3/an/élève : maternelle<primaire
<college<lycée

Centre de vacances 100 litres / jour et personne

Activités sportives sans Du nettoyage seul à d’autres prestations (climatisation à


2 à 35 litres / personne
douche eau, cafétéria,…).

Activités sportives avec


50 à 90 litres / personne Précédent et douche
douche

70 à 120 litres / baigneur en moyenne, 45 à 60 l/j/baigneur


Stade nautique/piscine 50 à 200 litres / baigneur si optimisé au maximum
NB : toujours > mini légal de 30l/j/baigneur

Ces données moyennes peuvent varier d’au moins 20 % en


arbuste ou vivaces : 4 l/m2
fonction de la nature du sol (besoin en eau supérieur si sol
Arrosage des espaces gazon : 2.6 l/m2
sableux par rapport à un sol argileux), de l’exposition au
verts ÁHXUVDQQXHOOHVOP2
vent… Des consommations optimisées au plus juste sont
inférieures d’au moins 20% à ces ratios

Maison de repos et de
60 à 90 m3 / an et lit 82 m3/an/lit en moyenne en Gironde
retraite

Moyenne girondine
La consommation fût un temps plus faible (100 à 150
Hôpitaux / cliniques 150 m / an / lit
3
m3/an/lit) ; les récentes contraintes liées aux maladies
nosocomiales l’ont faite augmenté.

Tableau N°11 : Ratios de consommation d’eau


113
7<3(
RATIO 5(0$548(6
'·(7$%/,66(0(17

10 à 20 litres / repas Selon que le repas est pris ou non sur place
Restauration collective
préparé (vaisselle ou non)

Moyenne girondine : varie de 13 m/an/empl en zone rurale


à 50 m3/an/empl en zone littorale (et d’autant plus que la
Camping 30 m3/an/emplacement camping a une piscine).
La présence d’une piscine augmente la consommation de
30% environ.

150 à 300 l /nuit jusqu’à


Hôtel
2 étoiles, 400 à 600 au-delà

Port de plaisance 15 à 20 m3/an/place

La moyenne en Gironde (perfectible) est d’environ


4 200m3/an/stade
Stade 3000 à 5000 m3 / an L’arrosage optimisé d’un stade nécessite environ 2000
à 3500 m3/an selon la nature du sol et sa fréquence
d’utilisation (honneur ou entraînement).
Très variable selon la taille de la salle, ses équipements et
Salle de sport 300 à 500 m3 / an
sa fréquentation.

Moyenne girondine, valeur variable de 50 à 500 m3/an selon


Salle des fêtes 220 m3/an
la fréquentation.

Pour 2,3 personnes / logement en moyenne. Il s’agit de la


Logement de fonction 115 m3 / an
moyenne girondine en 2004.

Laverie libre service 1 200 m3/an/U

Pressing 900 m3/an/U Très variable selon clientèle, peut aller jusqu’à 3 000.

Blanchisserie 10 000 m3/an/U moyenne girondine

Fleuriste 70 m3/an/U

Bar, café 400 m3/an/U moyenne girondine


130 m3/an/U coiffeur homme,
Coiffeur 180 m3/an/U
350 m3/an/U coiffure dame
moyenne girondine, un peu plus faible estim. Asso copro
Boulangerie 190 m3/an/U
1998 : 250 à 400 (plus de traiteurs ?)
moyenne girondine, cohérent avec estim. Asso copro 1998 :
Boucherie 130 m3/an/U
150 à 200

Poissonnerie 290 m3/an/U

hypermarché (> 2 500m2) : Etude SMEGREG (2006) :


2.1 m3/m2 grandes variations liées au système de froid
supermarché : 1.3 m3/m2 (tour aéroréfrigérante, brumisation sur condenseurs en été,
Surface de vente >
galerie : 3.8 m3/m2 ou pas de consommation).
300 m2
discount : 0.3 m3/m2 Consommations stables pour la production en atelier (0.8
bricolage, vêtements et l/client pour la boulangerie, boucherie, poissonnerie), le
divers : 0.2 m3/m2 nettoyage ou les sanitaires internes (8 à 10 m3/an/empl).

Centrale béton 7 700 m3/an/U Moyenne girondine

Nettoyage des voiries


5 litres / m linéaire Varie en fonction du type de machine et du réglage
ou parkings

Suivant l’état de propreté du véhicule (et la fréquence de


Nettoyage des nettoyage), et son volume (la fourchette haute correspond
100 à 250 l/véhicule
véhicules plus aux camions ; compter 150 l en moyenne pour
une voiture).
Hydrocurage de réseau
20 à 30 m3/km moyenne girondine
d’assainissement

Essai de poteau
150 l /U (soit environ 10 secondes à pleine ouverture)
incendie

114
3RVWHGH
9ROXPHFRQVRPPp &RPPHQWDLUH
FRQVRPPDWLRQ

60 à 150 litres/usage (soit


Douche 4 à 10 minutes à 15 litres/ Très variable selon le temps d’utilisation.
minute)

Selon le volume du réservoir et son mécanisme.


Chasse d’eau 6 à 12 litres/usage
Le volume le plus courant est de 9 litres environ.

Selon l’âge du lave-linge (depuis 2000 environ, les


consommations unitaires ont beaucoup diminué).
La fourchette haute correspond aux très anciens modèles,
qui consomment environ 120 l/cycle.
Les lave-linge ayant une dizaine d’années consomment
Lave linge 5 kg 40 à 120 litres
entre 80 et 100 litres par cycle en général.
la fourchette basse correspond aux modèles les plus récents
et performants (ils sont en général de classe A
pour l’énergie), qui ont en général une consommation
de 40 à 50 litres/cycle.

Dans ce cas également, la consommation est surtout


Lave vaisselle type liée à l’âge :
domestique 15 à 50 litres/vaisselle - > 10 ou 15 ans : 50 litres/cycle ;
(12 couverts) - une dizaine d’années : 40 litres/cycle ;
- récent et performant : 15 à 20 litres/cycle.

Préparation des repas 10 litres Si vaisselle : + 10 litres/repas

115
X.6. Outil d’aide : tarif indicatif des principaux matériels
hydroéconomes

)RXUQLWXUH ½77& 3RVH

3URGXLWV 0RQWDQW WHPSV PLQ VLOD &RPPHQWDLUHV


&R€WVL &R€WPR\HQ
IDFWXUpSDU SRVHHVWUpDOLVDEOH
DFKDW H[WHUQDOLVp
XQLQWHUYHQDQW SDUXQHPSOR\p
LQWHUQH ½77&  
H[WHUQH  KRUVGpSODFHPHQW

Compteur individuel ou
50 65 50 60
divisionnaire (DN15)
Compteur individuel
divisionnaire 350 400 250
(DN 50)
Réducteur de pression
40 50 50 A positionner si P > 4 bars
individuel (DN15)
6SpFLÀTXHjFKDTXH
Tête émettrice 40 50 50 5
compteur
Pour reporter à un endroit
visible et accessible la
Report d’index 220 260 valeur de l’index d’un
FRPSWHXUGLIÀFLOHPHQW
accessible
Vanne de coupure
automatique d’eau en 200 240
cas de fuite
Module de comptage et
de transmission radio
250 350
pour un compteur
simple
Système de
rapatriement et de
gestion de données de
comptage centralisé
(ex : équipement de
7 000 3 000
15 compteurs dans
un grand bâtiment,
centralisation sur 1
poste informatique par
OLDLVRQÀODLUHORJLFLHO
choisir du matériel conçu
Robinet mitigeur
90 115 100 avec un limiteur de débit
mécanique
intégré ou double butée
Robinet mitigeur
150 190 120
thermostatique
Robinet temporisé à
80 100 100
bouton poussoir
Robinet temporisé
400 450 200
électronique

Aérateur avec limiteur


de débit ou mousseur 7 9 3 5
économique

Douchette
25 30 6 5
hydroéconome

Flexible renforcé (à
15 20 5 5
associer au précédent)

Procure un confort
Régulateur de débit
12 15 10 10 inférieur aux deux
pour douchette
précédents

116
)RXUQLWXUH ½77& 3RVH

3URGXLWV 0RQWDQW WHPSV PLQ VLOD &RPPHQWDLUHV


&R€WVL &R€WPR\HQ
IDFWXUpSDU SRVHHVWUpDOLVDEOH
DFKDW H[WHUQDOLVp
XQLQWHUYHQDQW SDUXQHPSOR\p
LQWHUQH ½77&  
H[WHUQH  KRUVGpSODFHPHQW

Adaptateur et pomme
de douche économe
YpULÀHUVXUVLWHDX
(simple vissage sur
préalable la
dispositif existant, 40 50 10 10
compatibilité des
VDQVPRGLÀFDWLRQ
matériels
de la canne ou de la
canalisation).
Régulateur de débit
anti-vol pour pomme de 30 40 10 15
GRXFKHÀ[HPXUDOH
Robinet temporisé,
canne de douche pour remplacer une canne
apparente inox et 170 213 120 de douche encastrée
pomme de associée à un mitigeur.
douche économe
non conseillé pour un
usage intensif,
Mécanisme WC à
uniquement pour des
double commande ou 50 65 120 90
bureaux accessibles
interrompable
à un personnel limité (et
sensibilisé).
solution préférée à la
Remplacement cuvette
précédente par un
et réservoir WC
plombier qui aura
classique par un
80 100 70 un coût de revient
pack complet avec
souvent plus faible que
système 3/6l ou
le remplacement du
interrompable
mécanisme seul.

permet de réaliser
Remplacement cuvette des économies en eau
et réservoir WC de l’ordre de 70%.
200 240 150
classique par un WC Mécanisme adapté à
temporisé des sites à forte
fréquentation.

permet de conserver
l’installation en place,
Réduction de volume
très facile à installer,
du réservoir WC 8 10 3 5
permet de réaliser
(1 sac WC)
des économies de 25%
environ.
SOXVGLIÀFLOHjLQVWDOOHU
Réduction de volume que le précédent,
du réservoir WC 25 30 6 10 permet de réaliser des
(2 plaquettes WC) économies de 10 à
30% (1 ou 2 plaquettes).
Bloc urinoir
pas de contact avec le
électronique (cellule 300 à
480 200 matériel. Hygiène
de détection et 400
accrue.
électrovanne)
Programmateur 4 voies
170 200 140 240
pour électrovannes

Pluviomètre 30 35 30 60 à relier à un
programmateur
Tensiomètre 50 60 30 60 d’arrosage

Electrovanne 30 35 30

117
)RXUQLWXUH ½77& 3RVH

WHPSV PLQ 
0RQWDQW VLODSRVH
3URGXLWV &R€W &RPPHQWDLUHV
&R€WVL IDFWXUpSDU HVWUpDOLVDEOH
PR\HQ
DFKDW XQ SDUXQ
H[WHUQDOLVp
LQWHUQH LQWHUYHQDQW HPSOR\p
½77&  
H[WHUQH  KRUV
GpSODFHPHQW

Arrosage goutte à goutte (système


200 240 250
complet pour un massif d’au plus 50 m2)

Gazon résistant à la sécheresse (par m2) 5,6 7 5

Plantes vivaces (par m2) 15 18 18 Coût très variable

A éviter, coût utile à la


7DSLVGHÁHXUV HQYLURQP2) 12 15 15
comparaison

Déchloraminateur (petit bassin 25 m


30 000
unique, cas simple)

Déchloraminateur (bassin à vagues de


70 000
grande dimension ou cas complexe)

Location une semaine d’un débitmètre


170
à ultrason externe

Débitmètre à ultrason externe 10 000

Pour enregistrer les


débits transités en
Centrale d’acquisition de donnée
4 000 continu au niveau
portative et logiciel
d’un compteur équipé
d’une tête émettrice

Pour mesurer les


Débitmètre à lecture directe (Q max
30 débits des douches ou
20 l/min)
robinets
Certains exploitants
Prestation d’enregistrement pendant 7 proposent cette
1 000
à 10j et d’analyse de débit en un point prestation à un tarif
avantageux
9ROXPH
0DWpULDX
P3

béton ou Le montant de la fourniture


3 m3 2 000 à 3 500
PEHD est très variable selon le
fournisseur. Le coût de la
béton ou cuve seule représente 1/3
10 m3 5 500 à 10 000 à # du prix du matériel;
PEHD prix de pose
variable le débit de la pompe
béton ou en général intervient aussi dans le
Cuve de stockage 20 m3 15 500 à 25 000 prix. Le coût de la « pose »
spéciale eau de PEHD entre 1/3 et
1 fois le prix variable selon la présence
pluie (résiste à de nappe (lestage), le
l’écrasement si du matériel
PEHD 35 m3 20 000 à 40 000 recouvrement (terre
elle est vide), végétale ou enrobé…), la
toute équipée GLIÀFXOWpG·DFFqV YRLUHOH
(pré- et post PEHD 50 m3 25 000 à 60 000 chemin à aménager),
ÀOWUDWLRQ l’existence ou non d’une
disconnection surface stabilisée (pour
/ basculement prix de pose variable en
acier 120 m3 32 000 à 45 000 général de 0.5 à 1.5 fois prix les bâches souples ou
eau potable, pose en surface) et de
pompe, regard matériel
l’éloignement de la toiture
de visite,…) et de la zone d’utilisation,
bâche
20 m3 1 500 à 2 000 la réalisation ou non
souple
pose d’un local technique,
bâche variable la pose d’une clôture
50 m3 4 000 à 6 000 en général (recommandée pour les
souple
de 2/3 à 2 bâches souples),….
fois prix du Regroupement des
bâche matériel descentes d’eau
120 m3 8 000 à 15 000 (potentiellement onéreux)
souple
non compris.
118
COMMENTAIRES DU BORDEREAU DE PRIX

)RXUQLWXUH

Il s’agit de matériel « spécial collectivités ou


entreprises », à usage potentiellement intensif,
donc de bonne qualité, ni bas de gamme, ni
design.

Pour la fourniture par un plombier externe,


prévoir une marge de 1,35 à 1,5 sur le prix de
gros par un fournisseur (qui est 20% environ
inférieur au prix de vente au détail).

3RVH

La pose est évaluée sur la base d’un coût horaire


d’environ 40 ! HT, avec une TVA à 5,5%, compte
tenu du fait qu’il s’agit de travaux de rénovation
(attention en travaux neufs la TVA est de 19,6%)

Il faut prévoir au minimum environ 40 ! HT


quel que soit le nombre de produits hydro
économes à installer. Cela équivaut au coût d’un
déplacement.

A noter que certains fournisseurs de matériels


hydroéconomes « simples » (aérateurs, plaquettes
WC et douchettes économiques) peuvent
proposer une démarche intégrée de fourniture
et pose. Dans ce cas, la pose a un coût de revient
très faible (1 à 4 heures de main d’œuvre par
site, pour 3 à 20 matériels à poser).

3RXU VH À[HU XQ RUGUH GH JUDQGHXU HQ FH TXL
concerne les travaux de plomberie, on peut
retenir qu’il est assez peu fréquent que le prix
de pose soit inférieur au prix du matériel, quelle
TXHVRLWODGLIÀFXOWpG·LQVWDOODWLRQ/·LQYHUVHHQ
revanche est tout à fait possible.

(QÀQSRXUOHVFROOHFWLYLWpVLOIDXWQRWHUTXHOHV
plombiers externes majorent parfois leurs prix
du fait du paiement à 90 jours (et souvent au-
delà) : négocier un règlement plus rapide peut
être une bonne voie de réduction des coûts.

)RXUQLWXUHHWSRVHH[WHUQDOLVpH

Le coût total est obtenu en faisant la somme des


colonnes (1) et (2).

)RXUQLWXUHHWSRVHHQJUDQGHTXDQWLWp

Une commande importante (de l’ordre de :


fourniture > 5 k! de matériel hydro économe, ou
fourniture et pose > 10k!), permet généralement
d’obtenir un maximum d’environ 25% de rabais
sur les montants mentionnés.

Il peut donc aussi être intéressant de travailler


sur des périmètres importants et de grouper les
opérations.
119
X.7. Exemples

EXEMPLE I : HOTEL

6,7(

- Nom du site : hôtel Bonne nuit - N° du compteur : 47580100,


- Adresse : 10, rue principale - 33 001 GASPIVILLE - Calibre du compteur : DN 32
- Personne rencontrée : M. DUPONT - Facturation : eau potable et assainissement
- Calibre du compteur : DN 32
- Facturation : eau potable et assainissement

86$*(6'(/·($8 &5248,66&+(0$7,48(

- Sanitaires
- Arrosage Pelouse Hotel Parking
- Restauration
- Nettoyage surfaces
Massifs

$875(5(66285&((1($8 compteur général


rue principale
- Aucune

&216200$7,216'·($8

(DXSRWDEOH $XWUHUHVVRXUFH

2003 2004 2005 2003 2004 2005

3 948 3 251 3 510 0 0 0

Commentaires :
- 50 chambres
- Fréquentation : 15 000 nuitées/an, en moyenne 1,5 personnes par chambre
- Surface à arroser : 1.000 m$

(48,3(0(176(;,67$176

Par chambre :
- 1 WC simple commande
- 1 lavabo avec mitigeur 12 l / min (avec bague)
- 1 douche téléphone 15 l /min

Coin cuisine (petit déjeuner uniquement) :


- Lave-vaisselle (capacité 36 tasses ou verres ou assiettes)

Lavage surfaces :
- Seau et lave-pont

Arrosage :
- Turbines et tuyères escamotables

120
(9$/8$7,21'(692/80(6&216200(63$586$*(

Arrosage :
- Surface à arroser : 1000 m$
- Débit d’arrosage : 3 000 l/h (50 l/min)
- Durée arrosage : 1 heure / jour
- Période d’arrosage : juin à septembre

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 360 m3

 9 OK KM DQ P3

/HVDSSRUWVVRQWUHODWLYHPHQWRSWLPLVpVLOVVRQWLQIpULHXUVjFHX[G·XQHSHORXVHHQ]RQHFHQWUH
GHOD*LURQGHTXLQpFHVVLWHP3DQ GRQQpHLVVXHGHZZZMHFRQRPLVHOHDXRUJ 

Lavage des surfaces (réception, entrée). Les chambres et couloirs sont équipés de moquette.
- Surface à nettoyer : 200 m$
- Matériel de nettoyage : lave-pont , consommation en eau 30 litres (3 seaux)
- Fréquence de nettoyage : 7j/7

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 11 m3

9 O M P3

Restauration :
- Nombre de petits déjeuners servis par an : 10 000 (en moyenne 30 par jour)
- Consommation en eau pour un lave-vaisselle : 25 litres par cycle de lavage
- Nombre moyen de cycles par jour : 3

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 27 m3

9    P3

Sanitaires des chambres :

Volume consommé par jour, par chambre, y compris le nettoyage des chambres.

3RVWH 'RXFKH /DYDER :&

Temps d’utilisation /nombre d’utilisation 9 minutes 4 minutes 3 utilisations

Débit /volume 15 l/min 12 l/min 9 litres

Consommation par poste 135 litres 48 litres 27 litres

Consommation totale/chambre/jour 210 litres

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 9 P3

 9 OMFKDPEUH QXLWpHV P3

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 3 140 m3

727$/*(1(5$/$118(/ 3 548 m3

(YDOXDWLRQFRKpUHQWHDYHFODFRQVRPPDWLRQPR\HQQH

121
$0(/,25$7,216327(17,(//(6

7HPSVGH
3UL[ &R€WWRWDO
3UL[SRVH SRVHVL
PDWpULHO VLSRVH
(TXLSHPHQWVSURSRVpV H[WHUQH  IDLVDEOH 4XDQWLWp
½77& H[WHUQH
½77& HQLQWHUQH
LQWHUQH ½77&
PLQ

Sanitaires :
- 1 sac WC 8 3 5 53 583
- 1 aérateur 6 l/min 7 3 5 55 550
- 1 douchette économique 4 jets à 25 6 5 51 1 581
9l/min **
Arrosage :
- 1 sous compteur 50 65 1 115
Cuisine :
- 1 autoclave avec recyclage de 700 0 1 900
l’eau (5 litres/cycle + remplissage)

* la pose de matériels hydroéconomes est nettement moins onéreuse dès que le nombre d’équipements est important, et dès lors qu’elle est réalisée
par une société spécialisée
OHVÁH[LEOHVVRQWUHQIRUFpVjO·RULJLQH
*** les sanitaires du personnel sont inclus dans le bilan

(9$/8$7,21'(/·()),&$&,7(

(IÀFDFLWp
7HPSVGH
9ROXPH &R€W PR\HQQH
,QYHVWLVVHPHQW 9ROXPH UHWRXUVXU
PR\HQ GHSRVH DWWHQGXH
8VDJH 'HVFULSWLI HQPDWpULHO pFRQRPLVp LQYHVWLVVHPHQW
DFWXHO H[WHUQH GH
½77& P3DQ SRVHH[WHUQH
P3DQ ½77& UpGXFWLRQ
HQDQQpH
GHFRQVR

Equipement
Sanitaires 3 150 hydroéconome 2 084 630 35% 1 103 0,6
systématique

Arrosage 360 sous compteur 40 65 5% 18 2

Nettoyage Pas de
11 0% 0
des surfaces PRGLÀFDWLRQ

Autoclave plus
Restauration 27 700 60% 13 13
performant

Total 3548 881

* dans un logement individuel, les mêmes équipements permettraient de réaliser un peu plus d’économies, mais à l’hôtel, les clients ont tendance à
prendre plus de bains que de douches, et les équipements hydroéconomes n’ont pas d’impact sur le volume utilisé sur un bain.
** gain moyen correspondant à la détection d’une fuite, appliquée à plusieurs années.

&+2,;'8352*5$00('·$&7,216

L’équipement hydroéconome de l’intégralité des sanitaires a été retenu, de même que la pose d’un
compteur d’arrosage et l’achat d’un autoclave. Ce dernier est plus long à rentabiliser du seul point de
vue de la consommation d’eau, mais la consommation énergétique moindre divise le temps de retour
sur investissement par deux et les meilleures performances de l’appareil limiteront les nettoyages
manuels complémentaires.

122
EXEMPLE II : CAMPING

6,7(

- Nom du site : Camping AU BON AIR - N° du compteur : 2788200


- Adresse : Bellevue - 33 000 MONREPOS - Calibre du compteur : DN 32
- Personne rencontrée : M. MARTIN - Facturation : eau potable et assainissement

86$*(6'(/·($8327$%/( &5248,66&+(0$7,48(

- Sanitaire
- Nettoyage surfaces Air de camping
Piscine
- Piscine
Accueil
Bloc sanitaire Pelouse & bar
$875(5(66285&((1($8

- Aucune compteur général

&216200$7,216'·($8

(DXSRWDEOH $XWUHUHVVRXUFH

2003 2004 2005 2003 2004 2005

6 402 6 903 6 251* 0 0 0

Commentaires :
- 30 emplacements tente, et 120 emplacements caravane
- Fréquentation moyenne sur la période d’ouverture (mi-mai à mi-octobre) : 57%
- Fréquentation journalière moyenne : 180 personnes par jour (environ 2,1 personnes par emplacement
* 150 emplacements * 57% fréquentation).

(48,3(0(176(;,67$176

Bloc sanitaire :
- 12 WC simple commande non interrompables et 5 urinoirs temporisés
- 18 lavabos avec robinets simples, avec bague en bout de bec
- 12 bacs à vaisselle et 5 bacs à linge, équipés de mitigeurs simples, avec bague en bout de bec
- 12 douches murales temporisées

Sanitaires de l’accueil :
- 2 WC simple commande non interrompables et 1 urinoir temporisé
- 2 lavabos eau froide seule, avec robinet simple

Lavage surfaces :
- Tuyau d’arrosage (100 m$)

Arrosage (platebandes, massifs et arbustes pour ombrage) :


- Tourniquets pour les massifs et platebande (environ 250 m2),
- Arrosage au jet pour les arbustes (5 rangées de 50 m)
- Période d’arrosage : mi-mai à mi-octobre.

Piscine :
- Dimension bassin : 15*10 (2 mètres de profondeur)
7UDLWHPHQWGHO·HDXÀOWUDWLRQVDEOHHWFKORUDWLRQ
- Une vidange annuelle

123
(9$/8$7,21'(692/80(6&216200(63$586$*(

Arrosage :
- Surface à arroser : 250 m$ de massifs et 250 m2 d’arbustes
- Durée arrosage : 1,5 heures/j pour les massifs, et 1 heure par jour au jet pour les arbustes
- Débit d’arrosage (mesuré sur site) : 18 l/min pour le tourniquet et 25 l/min pour le jet
- Période d’arrosage : juin à septembre

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 374 m3

9  OPLQ PLQMOPLQ PLQM  MDQ P3

Lavage des surfaces (réception, entrée).


- Surface à nettoyer : 250 m$
- Matériel de nettoyage : tuyau d’arrosage et raclette, 20 litres/minute
- Temps d’utilisation : 1 heure par jour
- Fréquence de nettoyage : 7j/7

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 180 m3

9 OPLQ PLQ MDQ P3

Restauration :
- Nombre de petits déjeuners servis par an : 10 000 (en moyenne 30 par jour)
- Consommation en eau pour un lave-vaisselle : 25 litres par cycle de lavage
- Nombre moyen de cycles par jour : 3

Sanitaires :

%DFVYDLVVHOOH
3RVWH 'RXFKH /DYDER :&HWXULQRLUV
HWOLQJH

Temps d’utilisation 5 minutes 30 secondes 4 minutes


2 utilisations
/nombre d’utilisation/jour 1 utilisation 2 utilisations 2 utilisations /
par personne
par personne par personne emplacement

Débit /volume 15 l/min 12 l/min 12 l/min 9 litres

Consommation par poste, par personne / jour 75 litres 12 litres 45 litres ** 22 litres

Consommation totale
154 litres
/personne/jour

&RQVRPPDWLRQWRWDOH
9 P3DQ
VXUPRLV
 9 OSHUV SHUVM MDQ P3
9YDLVVHOOH PLQ 8M OPLQ SHUVM OLWUHVSHUVRQQHM

Piscine :
9ROXPHG·HDXSRXUOHUHPSOLVVDJH   P3
- Apport d’eau quotidien : environ 18 m3/j, pendant 3 mois

&RQVRPPDWLRQWRWDOHVXUOHVPRLV 1 920 m3

9   P3

$QRWHUTXHODSUpVHQFHG·XQHSLVFLQHHQWUDvQHXQHDXJPHQWDWLRQGHj G·DXWDQWSOXV
LPSRUWDQWHTXHOHFDPSLQJHVWSHWLW GHODFRQVRPPDWLRQG·HDXGXFDPSLQJ

6 632 m3,
727$/*(1(5$/$118(/
soit environ 44 m3/an/empl.

Evaluation cohérente avec la consommation moyenne des trois dernières années et dans le haut de la
fourchette de consommation d’eau des campings sur la côte girondine (30 à 45 m3/an/emplacement) :
en effet, la piscine représente 30% de la consommation d’eau du camping. Sans elle, ce camping aurait
une consommation dans la fourchette basse (31 m3/an/emplacement).
124
$0(/,25$7,216327(17,(//(6

7HPSVGH
3UL[ &R€WWRWDO
3UL[SRVH SRVHVL
PDWpULHO VLSRVH
(TXLSHPHQWVSURSRVpV H[WHUQH IDLVDEOH 4XDQWLWp
½77& H[WHUQH
½77& HQLQWHUQH
LQWHUQH ½77&
PLQ

Sanitaires :
- sac WC 8 3 5 14 154
- OU remplacement WC temporisé 200 150 14 4 900
- réglage des temporisations 6 5 31 186
(douches et urinoirs)
- aérateur 6 l/min sur mitigeurs et 7 3 5 37 370
robinets
- OU remplacement mitigeurs 160 150 10 35 10 850
temporisés
- adaptateur et pomme de douche 40 10 12 600
économique à 9 l/min
Arrosage :
- 1 sous compteur 50 65 1 115
- 1 système complet de goutte à 500 500 1 1 000
goutte, avec programmateur et
dissociation des massifs et arbustes
- récupération de l’eau de 2 500 3 000 1 5 500
renouvellement de la piscine, y
compris stockage de 3 m3.
Nettoyage :
- Jet haute pression pour le bloc 200 100 1 300
sanitaire

/HWDX[GHUHQRXYHOOHPHQWGHO·HDXGHODSLVFLQHSHUPHWG·REWHQLUXQHTXDOLWpG·HDXVDWLVIDLVDQWH
HWLOQHIDXWSDVOHUpGXLUH(QUHYDQFKHRQSHXWUpFXSpUHUO·HDXGHUHQRXYHOOHPHQW PDLVSDV
O·HDXGHODYDJHGHVÀOWUHV SRXUO·DUURVDJH

(9$/8$7,21'(/·()),&$&,7(

(IÀFDFLWp
7HPSVGH
9ROXPH &R€W PR\HQQH
,QYHVWLVVHPHQW 9ROXPH UHWRXUVXU
PR\HQ GHSRVH DWWHQGXH
8VDJH 'HVFULSWLI HQPDWpULHO pFRQRPLVp LQYHVWLVVHPHQW
DFWXHO H[WHUQH GH
½77& P3DQ SRVHH[WHUQH
P3DQ ½77& UpGXFWLRQ
HQDQQpH
GHFRQVR

Sac WC 112 42 25% 149 0,3


WC 594
Ou temporisation 2 800 2 100 50% 297 5

Equipement
739 417 50% 770 0,2
Lavabos et hydroéconome
1 539
éviers
Ou temporisation 5 600 5 250 70% 1077 3,3

Douches 2025 Réduction débit

Récupération
d’eau de
2 500 3 000 100% 374 4,5
renouvellement
Arrosage 374 de piscine
Et/ou goutte à
500 500 50%** 187 1,7
goutte

Nettoyage 180 Haute pression 200 100 40% 72 1,4

&+2,;'8352*5$00('·$&7,216

L’équipement hydroéconome de l’intégralité des sanitaires et du système de nettoyage a été retenu,


y compris le remplacement des robinets et WC classiques par des systèmes temporisés. Cela permet
aussi de limiter les interventions d’un plombier pour des problèmes d’obstruction de canalisation ou de
WC. Pour l’arrosage, le camping a opté pour la seule mise en œuvre d’un goutte à goutte. Le stockage
de l’eau de la piscine nécessitant des démolitions trop importantes (implantation de la cuve).
125
EXEMPLE III : IMMEUBLE DE BUREAUX

6,7(

- Nom du site : Immeuble XX - N° du compteur : 47580600,


- Adresse : 50, rue principale - 33 001 GASPIVILLE - Calibre du compteur : DN 32
- Personne rencontrée : M. DUPONT - Facturation : eau potable et assainissement

86$*(6'(/·($8327$%/( &5248,66&+(0$7,48(

- Sanitaire
- Nettoyage surfaces Pelouse Immeuble Parking
- Arrosage
sous compteur
Massifs
$875(5(66285&((1($8 compteur général
rue principale
- Aucune

&216200$7,216'·($8

(DXSRWDEOH $XWUHUHVVRXUFH

2004 2005 2006 2004 2005 2006

3 400 3 500 2 734 0 0 0

Commentaires :
- Immeuble de bureaux de 3 étages ( 4 niveaux), avec 2 blocs sanitaires par niveau.
- Présence d’un espace vert au pied du bâtiment
- Effectif total moyen par jour : 100 personnes, pendant environ 220 jours par an
- Public reçu : peu, environ 70 personnes par jour

(48,3(0(176(;,67$176

Blocs sanitaires :
- 16 WC simple commande non interrompable
- 16 lavabos avec robinet simple eau froide

Lavage surfaces :
- 600 m$ à chaque niveau, surface totale : 2.400 m$

Arrosage (platebandes, massifs et arbustes pour ombrage) :


- Turbines et tuyères escamotables
6XSHUÀFLHHQYLURQPð
- Période d’arrosage : mai-octobre.

(9$/8$7,21'(692/80(6&216200(63$586$*(

Arrosage :
- Surface à arroser : 1000 m$
1DWXUHJD]RQUD\JUDVVDQJODLVHWDUEXVWHVÁHXULVSODWHVEDQGHV
- Dose d’arrosage théorique (information de l’installateur) : 5 l/m2
- Période d’arrosage : environ 2 heures le matin (06h/08h)
- Période d’arrosage : mai-septembre

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 750 m3

 9 OP2 * 1 000 m2 MDQ P3


126
Lavage des surfaces (hall, réception, entrée) :
- Matériel de nettoyage : auto-laveuse
- Volume de remplissage : 250 l/U
- Fréquence de nettoyage : 2 j/semaine, 1 remplissage chaque fois

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 26 m3

 9 O  VHPDLQHV P3

Sanitaires :

3RVWH /DYDER :&

Temps d’utilisation /nombre d’utilisation par 30 secondes /


2 utilisations
employé /jour 3 utilisations

Temps d’utilisation /nombre d’utilisation 30 secondes / 1 utilisation


par visiteur/jour 1/5 visiteur 1/5 visiteur

Débit /volume 12 l/min 9 litres

Consommation par poste/employé/j 18 litres 18 litres

&RQVRPPDWLRQSDUSRVWHYLVLWHXUMRXU OLWUHV OLWUHV

&RQVRPPDWLRQWRWDOHVXUOHVPRLV 838 m3

9      P3

$0(/,25$7,216327(17,(//(6

7HPSVGH
3UL[ &R€WWRWDO
3UL[SRVH SRVHVL
PDWpULHO VLSRVH
(TXLSHPHQWVSURSRVpV H[WHUQH IDLVDEOH 4XDQWLWp
½77& H[WHUQH
½77& HQLQWHUQH
LQWHUQH ½77&
PLQ

Sanitaires :
16 176
- sac WC 8 3 5
16 160
- aérateur 6 l/min sur lavabos 7 3 5
Arrosage :
1 115
- 1 sous compteur 50 65
1 850
- 1 programmateur, 1 pluviomètre, 2 350 500
tensiomètres, 2 électrovannes pour
dissocier l’arrosage du gazon et des
arbustes

/DUpFXSpUDWLRQG·HDXGHSOXLHSRXUO·DUURVDJHQ·DSDVpWpHQYLVDJpHFDULOpWDLWSUHVTXHLPSRVVLEOH
GHFHQWUDOLVHUOHVGLIIpUHQWHVGHVFHQWHVG·HDXGXEkWLPHQWHQXQSRLQW

(9$/8$7,21'(/·()),&$&,7(

(IÀFDFLWp
7HPSVGH
9ROXPH &R€W PR\HQQH
,QYHVWLVVHPHQW 9ROXPH UHWRXUVXU
PR\HQ GHSRVH DWWHQGXH
8VDJH 'HVFULSWLI HQPDWpULHO pFRQRPLVp LQYHVWLVVHPHQW
DFWXHO H[WHUQH GH
½77& P3DQ SRVHH[WHUQH
P3DQ ½77& UpGXFWLRQ
HQDQQpH
GHFRQVR

Equipement
Sanitaires 838 240 96 30% 251 0,4
hydroéconome

Arrosage 750 Optimisation 400 560 50% 375 0,8

&+2,;'8352*5$00('·$&7,216

Tous les travaux proposés ont été retenus.


127
EXEMPLE IV : CLINIQUE

6,7(

- Nom du site : clinique du Salut - N° du compteur : 15478002


- Adresse : 5, rue du Bout - 33 000 GASPIVILLE - Calibre du compteur : DN 32
- Personne rencontrée : M. ANTOINE - Facturation : eau potable et assainissement

86$*(6'(/·($8327$%/( &5248,66&+(0$7,48(

- Sanitaires
- Nettoyage surfaces Clinique Parking
- Arrosage
- Laverie
- Stérilisation
- Restaurant
Pelouse
$875(5(66285&((1($8 compteur général
rue du bout
- Aucune

&216200$7,216'·($8

(DXSRWDEOH $XWUHUHVVRXUFH

2004 2005 2006 2004 2005 2006

20 597 21 107 20 008 0 0 0

Commentaires :
- Clinique de 4 étages (5 niveaux), avec 2 blocs sanitaires par niveau.
- 100 chambres avec un bloc sanitaire par chambre
- Taux d’occupation des chambres : 92%
- Espace vert : 700m$
- Effectif total moyen par jour : 250 employés

(48,3(0(176(;,67$176

Par chambre :
- 1 WC double commande 5,5 l / usage
- 1 lavabo avec mitigeur 12 l / min
- 1 douchette 18 l /min

Sanitaires communs ou du personnel :


- 20 WC double commande 5,5 l /usage
- 10 lavabos avec mitigeur 12 l / min

Coin cuisine :
- 195 repas livrés par jour (195 plateaux, récupérés par le traiteur, seuls les verres et les couverts
sont lavés dans la clinique)
- 2 lave-vaisselle (capacité 36 tasses ou verres ou assiettes)
- Consommation lave-vaisselle par cycle 70 l
- Nombre de cycles par jour 3*2

Lavage surfaces :
- Seau et lave-pont pour les chambres, auto-laveuse pour les couloirs

128
Laverie :
- Quantité de linge à laver par jour : 500 kg
- 3 machines à laver d’une capacité de 32 kg
- Consommation d’un lave-linge 32 kg par cycle : 850 l
- 1 lave linge 24 kg conso/cycle 600 l
- Nombre de cycles par jour 5 (4 et 1)

Stérilisation :
- Autoclave 6 paniers, avec une consommation par cycle de 305 l
- Nombre de cycles /j : 2
- Cabine pour chariot, avec une consommation par cycle de 360 l
- Nombre de cycles /j : 6

Arrosage :
- Goutte à goutte
$UEXVWHVÁHXULV
- 700 m$

(9$/8$7,21'(692/80(6&216200(63$586$*(

Arrosage (eau potable) :


- Surface à arroser : 700 m$
- d’arrosage moyen par semaine : 5 (programmateur existant, durée d’arrosage variable en fonction
des mois)
- Consommation : 1 000 l/h
- Durée arrosage moyenne : 2 heures (22h/00h)
- Période d’arrosage : mai – septembre
- Présence d’un sous compteur

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 200 m3

9 P3K MVHPDLQH VHPDLQHVPRLV KHXUHVM MRXUVVHPDLQH P3/an

Lavage des surfaces :


- Surface à nettoyer : 3 000 m$
- Matériel de nettoyage : sceau et lave-pont, auto laveuse pour les couloirs
- Consommation : 600 l par jour
- Fréquence de nettoyage : 7j/7

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 1 971 m3

9     P3

Sanitaire :

- Les chambres

3RVWH /DYDER :& 'RXFKH

30 secondes / 4 utilisations 10 minutes


Temps d’utilisation /nombre d’utilisation
4 utilisations + + 1 par /0.7
1 par personnel visiteurs utilisation**

Débit /volume 12 l/min 5,5 litres 18 l/min

Consommation par poste, par personne / jour 30 litres 27.5 litres 126 litres

Consommation totale/patient/jour 183.5 litres

&RQVRPPDWLRQWRWDOHVXUO·DQQpH P3

 9     P3


** tous les patients ne peuvent pas se doucher tous les jours

129
- Les sanitaires du personnel

3RVWH /DYDER :&

30 secondes/
Temps d’utilisation /nombre d’utilisation 3 utilisations
8 utilisations

Débit /volume 12 l/min 5,5 litres

Consommation par poste 48 litres 16,5 litres

Consommation totale/employé/jour 64.5 litres

&RQVRPPDWLRQWRWDOHVXUO·DQQpH P3

9    P3

1%OHSHUVRQQHOVHODYHDXVVLOHVPDLQVGDQVOHVFKDPEUHVGHVSDWLHQWVODUpSDUWLWLRQHQWUHOHV
OLHX[G·XVDJH VDQLWDLUHVGHVFKDPEUHVRXGXSHUVRQQHO SHXWrWUHLQH[DFWH

Coin cuisine :
- Nombre de couverts (assiette + verre) par jour : 195
- Nombre de lave-vaisselle : 2
- Consommation lave-vaisselle par cycle : 70 l
- Nombre de cycles par jour : 6

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 307 m3

9     P3

Laverie :
- 3 machines à laver d’une capacité de 32 kg
- Consommation d’un lave-linge 32 kg par cycle : 850 l
- Nombre de cycles par jour/machine de 32kg : 4
- 1 lave linge 24 kg conso/cycle : 600 l
- Nombre de cycles par jour/machine de 24kg : 4

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 4 600 m3

9      P3

Stérilisation :
- Autoclave 6 paniers conso par cycle : 305 l
- Nombre de cycles : 2
- Cabine pour chariot conso par cycle : 360 l
- Nombre de cycles : 6

&RQVRPPDWLRQWRWDOHVXUO·DQQpH 1 011 m3

9     P3

&RQVRPPDWLRQWRWDOHVXUO·DQQpH
20 136 m3
GHODFOLQLTXH

9  P3

&HWWHFRQVRPPDWLRQLPSRUWDQWHG·HDX HQYLURQP3DQOLWDORUVTXHODPR\HQQHHVWjHQYLURQ
P3DQOLWVRLWP3DQSRXUXQHFOLQLTXHGHOLWV GRLWrWUHUHODWLYLVpHSDUOHIDLWTXHOD
ODYHULHHVWLQWHUQHjODFOLQLTXHDORUVTXHGDQVODPDMRULWpGHVFDVFHWWHDFWLYLWpHVWVRXVWUDLWpH

130
$0(/,25$7,216327(17,(//(6

7HPSVGH
3UL[ &R€WWRWDO
3UL[SRVH SRVHVL
PDWpULHO VLSRVH
(TXLSHPHQWVSURSRVpV H[WHUQH IDLVDEOH 4XDQWLWp
½77& H[WHUQH
½77& HQLQWHUQH
LQWHUQH ½77&
PLQ

Compteurs divisionnaires (laverie,


stérilisation, 1 par étage, eau froide 1 400 1 400 6 2 800
seule)

Sanitaires :
 OLPLWHXUGHGpELWVSpFLÀTXHPLOLHX 8 3 5 110 1 210
médical 6 l/min sur lavabos
- douchette économique à 9l/min 25 6 5 100 3 100

Coin cuisine :
- Remplacement lave-vaisselle par 600 200 1 800
un plus économe en eau

Laverie
- Remplacement 4 lave-linge par 50 000 0 1 50 000
plus économes en eau

Stérilisation
- Mise en place d’un tanker pour 2 000 2 000 1 4 000
recycler l’eau de lavage des chariots

(9$/8$7,21'(/·()),&$&,7(

(IÀFDFLWp
7HPSVGH
9ROXPH &R€W PR\HQQH
,QYHVWLVVHPHQW 9ROXPH UHWRXUVXU
PR\HQ GHSRVH DWWHQGXH
8VDJH 'HVFULSWLI HQPDWpULHO pFRQRPLVp LQYHVWLVVHPHQW
DFWXHO H[WHUQH GH
½77& P3DQ SRVHH[WHUQH
P3DQ ½77& UpGXFWLRQ
HQDQQpH
GHFRQVR

Compteurs
Comptage 1 400 1 400 5% 1 007 0,9
divisionnaires
Lave-vaisselle
plus récent et
Cuisine 307 700 0 50% 154 1,4
plus économe en
eau
Lave-linge plus
Laverie 4 600 récent et plus 50 000 0 40% 1 840 8,5
économe en eau
Tanker et
Stérilisation 1 011 bâche de 2 000 2 000 50% 505 2,5
refroidissement
Aérateur 6 l/min
Sanitaire
9 618 et douchette éco 3 380 1 760 50% 4 573 0,35
(sauf WC)
10 l/min

Total 15 536

&+2,;'8352*5$00('·$&7,216

La clinique a retenu tous les travaux envisagés, excepté le remplacement des lave-linge, très onéreux.
Seul l’un d’entre eux, qui avait plus de 10 ans et n’offrait pas certains programmes de lavage, a été
remplacé.

Cela dit, la clinique a mesuré l’importance du volume consommé dans ce poste laverie, elle a aussi
décidé :
- d’installer un compteur divisionnaire et d’instaurer des relèves hebdomadaires pour ce poste,
- de sensibiliser le personnel concerné à l’importance de l’optimisation du remplissage des
machines.
131
X.8. Bibliographie et sites Internet de référence

6LWHV,QWHUQHW - &DKLHU 7HFKQLTXH Qƒ  © 5HFKHUFKH GH


IXLWHV7HFKQLTXHV HW PpWKRGHV GH GpWHFWLRQ
- KWWSZZZVPHJUHJRUJ, site institutionnel HQUpVHDX[G·HDXSRWDEOHª  
du SMEGREG 2IÀFH,QWHUQDWLRQDOGHO·(DX 2,($8 S
- KWWSZZZMHFRQRPLVHOHDXRUJ, site grand - &DKLHU 7HFKQLTXH Qƒ  © /H FRPSWDJH ª
public dédié aux économies d’eau, avec  
QRWDPPHQWGHVÀFKHVG·H[HPSOHVGHUpDOLVDWLRQV 2IÀFH,QWHUQDWLRQDOGHO·(DX 2,($8 S
pour les entreprises et collectivités.
- &DKLHU7HFKQLTXHQƒ©/·DOLPHQWDWLRQHQ
- KWWSZZZVDJHQDSSHVRUJ site de la HDXSRWDEOHª  
Commission Locale de l’Eau du SAGE nappes 2IÀFH,QWHUQDWLRQDOGHO·(DX 2,($8 S
profondes de Gironde.
- (WDWGHVFRQVRPPDWLRQVGDQVOHEDVVLQ/RLUH
- KWWSZZZFJIU, site du Conseil général %UHWDJQH &RQVRPPDWLRQV G·HDX SRWDEOH HW
de la Gironde SRWHQWLHOV G·pFRQRPLH ÀFKHV DUJXPHQWDLUHV
SRXUGHVDFWLRQVGHPDvWULVHGHVFRQVRPPDWLRQ
- KWWSZZZHDXDGRXUJDURQQHIU, site de G·HDX  
l’Agence de l’eau Adour-Garonne Agence de l’eau Loire-Bretagne
- KWWSZZZHDXORLUHEUHWDJQHIU site de - *XLGH©/HVERQQHVSUDWLTXHVGHO·DUURVDJH
l’Agence de l’eau Loire-Bretagne GHV HVSDFHV YHUWV HW GHV WHUUDLQV GH VSRUW ª
- KWWSZZZDUSHPLSFRPKWPO  
$FWXDOLWHVSKS"LG 8, site de l’Agence Syndicat Mixte d’Etudes pour la Gestion de la
régionale pour l’environnement Midi-Pyrénées Ressource en Eau de la Gironde (SMEGREG).

- KWWSZZZHFRORJLHJRXYIUVRPPDLUHSKS3, - (FRQRPLVHU O·HDX XQH QpFHVVLWp SRXU OHV


site du ministère de l’écologie, du développement FROOHFWLYLWpV ² JXLGH WHFKQLTXH j O·XVDJH GHV
et de l’aménagement durables FROOHFWLYLWpV  
Eau et rivières de Bretagne
- KWWSZZZFDUWHOHDXRUJFRQVRHDXLQGH[KWP,
ÀFKHVSUDWLTXHVSRXUODPLVHHQ±XYUHG·DFWLRQV - *XLGH GH JHVWLRQ GLIIpUHQWLpH 3RXU XQ
de maîtrise des consommations ÁHXULVVHPHQWUDLVRQQpGHVYLOOHV  
Mission gestion différenciée
- KWWSZZZJHVWLRQGLIIHUHQFLHHRUJ
- (WXGH SRXU OD PLVH HQ ±XYUH G·XQ SODQ
G·DFWLRQV HQ IDYHXU GH OD PDvWULVH GHV
%LEOLRJUDSKLH FRQVRPPDWLRQVHQHDXSRWDEOH  
Département de l’Hérault
- /D JHVWLRQ GH O·HDX GDQV O·KDELWDW FROOHFWLI - (WXGHVXUOHVpFRQRPLHVG·HDX²OHWRXULVPH
  HQ9HQGpHFRQVRPPDWLRQVHWpFRQRPLHVG·HDX
Association des Responsables de Copropriété  .
(ARC), 52p Vendée Eau
- *XLGH PpWKRGRORJLTXH © (FRQRPLVHU O·HDX - (FRQRPLH G·HDX HW G·pQHUJLH O·DpURSRUW
GDQV OD YLOOH HW O·KDELWDW VXU OHV WUDFHV GH GRQQHO·H[HPSOH  
O·H[SpULHQFH GHV 9LOOHVSLORWHV GH %UHWDJQH ª Aéroport de Strasbourg
 
Agence de l’eau loire-bretagne/ Région - (WXGHGHVFRQVRPPDWLRQVG·HDXGHO·DpURSRUW
Bretagne, 64 p. GH%RUGHDX[²0pULJQDF  
CREAQ
- *XLGHSRXUOHVpFRQRPLHVG·HDX&DKLHU
©(DXSRWDEOHHWVDQLWDLUHª   - *XLGHGHVPHVXUHVG
pFRQRPLHVHWGHPDvWULVH
&HQWUH 6FLHQWLÀTXH HW 7HFKQLTXH GX %kWLPHQW GHV XVDJHV GH O
HDX GDQV OHV FROOHFWLYLWpV
(CSTB)/ Ministère de l’Equipement des  
Transports et du Logement, 32p. Conseil Général de la Gironde
- *XLGH ©,QYHQWDLUH GHV PDWpULHOV K\GUR
pFRQRPHVª  
L.TALPAERT- Centre Régional d’Eco-énergétique
d’Aquitaine (CREAQ), 59 p.
132
Ce document a été réalisé par OH &5($4 (Centre régional
d’éco-énergétique d’Aquitaine), avec l’appui et pour le
compte du 60(*5(* (Syndicat mixte d’études pour la gestion
de la ressource en eau de la Gironde), en collaboration avec un
groupe de travail associant :
- l’$JHQFHGHO·(DX$GRXU*DURQQH,
- le &RQVHLO5pJLRQDOG·$TXLWDLQH,
$ÀQ GH OLPLWHU OHV LPSDFWV HQYLURQQHPHQWDX[ OD GLIIXVLRQ
- le &RQVHLO*pQpUDOGHOD*LURQGH, GH FH JXLGH D pWp GDQV XQ SUHPLHU WHPSV OLPLWp DX
- la ''$66 (Direction départementale des actions sanitaires IRUPDWLQIRUPDWLTXH SGI 9RXVSRXUUH]OHWpOpFKDUJHUVXU
et sociales) GHOD*LURQGH, ZZZVPHJUHJRUJRXVXUZZZMHFRQRPLVHOHDXRUJ GHVPLVHV
- la DDAF (Direction départementale de l’Agriculture et de jMRXUUpJXOLqUHVVHURQWUpDOLVpHV 
la forêt) GHOD*LURQGH.
&RQFHSWLRQ  
Photos : SMEGREG, Rain Bird, Toro, Sider, Ecoperl, Neoperl,
Hydreka, Hydrelis, Eco-Techniques, Agence de l'eau Adour-
*DURQQH3KRQLÁHXU.LSRSOXLH*UDI6DSSHO&UHDT)UDQoRLV
9$,//$17$OEDWURV0DUV

Vous aimerez peut-être aussi