Vous êtes sur la page 1sur 22

Anticorpos Monoclonais Diagnstico e Frmacos inovadores

Fernando Thom Kreutz, M.D./Ph.D. FK-Biotec PUCRS CNPq 1B

Estrutura do anticorpo
Cadeia dividida em Domnios: Leve 2 (VL e CL) Pesada 4 (VH, CH1, CH2, CH3) Pontas do Y representam o Paratopo (VH + VL) amino terminal; Caractersticas de reconhecimento e afinidade so determinados

pelo Paratopo; Uma clula B produz um nico tipo de anticorpo!

Kreutz, FT 1997

Estrutura do Anticorpo

Ligao Paratopo-Eptopo

Antgeno e Anticorpo

Complexo Ag-Ac

Estrutura do Paratopo (VH e VL)


Frame work - Regio de Borda CDR -Regio Determinante de Complementaridade;
<---------L1---------> KASQDV----G-AA------IA RASES-------VDSYGKSFMH RASESVDNYGI-------SFMN RASESVDSYGK-------SFMH SVSSSIS----------SSNLH RASQEIS-----------GYLS KSSQSLLNSGNQK-----NYLT <--L2-> WASTRHT IASNLES AASNLGS IASNLES GTSNLAS AASTLDS WASTRES <----L3---> QQYSGYPL--T QQNNEDPP--T QQSKEVPL--T QQNNEDPP--T QQWNSYPY--T LQYASYPR--T QNDYSYPL--T DIVMTQSPSSLSVSAGERVTMSC DIVMTQSPASLVVSLGQRATISC DIVLTQSPASLAVSLGQRATISC DIVMTQSPASLVVSLGQRATISC DIQLTQSPAFMAASPGEKVTITC DIQMTQSPSSLSASLGERVSLTC DIVMTQSPSSLTVTAGEKVTMSC WYQQKPGQPPKLLIY WYQQKPGQPPKVLIY WFQQKPGQPPKLLIY WYQQKPGQPPKVLIY WYQQKSETSPKPWIY WLQQKPDGTIKRLIY WYQQKPGQPPKLLIY GVPDRFTGSGSGTDFTLTISSVQAEDLAVYYC GVPARFSGSGSRTDFTLTIDPVEADDAATYYC GVPARFSGSGSGTDFSLNIHPMEEEDTAMYFC GVPARFSGSGSRTDFTLTIDPVEADDAATYYC GVPVRFSGSGSGTSYSLTISSMEAEDAATYYC GVPKRFSGSRSGSDYSLTISSLESEDFADYYC GVPDRFTGSGSGTDFTLTISSVQAEDLAVYYC FGAGTK-----FGAGTK-----FGAGTKVELKRA FGAGTKLEMRRA FGGGTKLEIKRA FGGGTKVEIKRT FGAGTKLEP---

Anticorpos Monoclonais (1976)


Clula B FUSO
Produz um anticorpo especfico Morre em cultura
No Produz anticorpo Imortal em cultura

Mieloma

Produz um anticorpo especfico

Hibridoma

Imortal em cultura

Etapas para Produzir um AcM - HIBRIDOMA


Imunizao - CFA e IFA Intra-esplnica (18 a 30 dias). Isolar linfcitos Bao Cultivo de SP2-0 FUSO celular ARTE E TCNICA! Seleo Metablica MEIO HAT AMINOPTERINA SP2-0 sensvel ao meio HAT bloqueio da via de novo mutao na via de salvagem. Linfcito clula Terminal morre em cultura, possui a via de novo e de salvagem.

Anticorpos Monoclonais Seleo


Clula B
Sintese de nucleotdios De novo Salvagem - Reciclagem

Mieloma FUSO
Sintese de nucleotdeios De novo Mutao na via de salvagem

MEIO HAT Bloqueia a via de novo.

Hibridoma

Sobrevive utilizando a via de salvagem da clula B

Etapas para Produzir um AcM - HIBRIDOMA


Seleo dos clones positivos definir

ensaios Expanso e criopreservao Retestagem Reclone Produo - Ascite ou cultura de clulas. Banco de Hibridomas.

Produo de Anticorpos Monoclonais (FK)

ELISA - Imunomtrico
Substrato
Anti-IgG ou IgM

humano - conjugado

Y YY

Soro do paciente
Antgeno (Insulina)

ELISA - Sanduche
Substrato
Anti-Albumina -

conjugado
Amostra paciente
Anti-Albumina

ELISA - Captura
Substrato Antgeno -

conjugado
Soro do paciente Anti-IgG ou IgM

humano

Vantgens dos AcM


Sem variao de lote a lote. Alta capacidade produtiva. Baixo custo para produo.

Capacidade de selecionar Ac com caractersticas

imunoqumicas desejveis. Excelentes para diagnstico. Imunoensaios Ag-Ac-Marca!

Problemas com AcM convencionais para uso in vivo


Os anticorpos monoclonais MURINOS No prprios Alto peso molecular (160 KDa)

Proteco
Altamente Imunognico HAMA (Human Anti-Mouse Antibody)

Tipos de Anticorpos Monoclonais

Anticorpo Murino
Sequncia Humana

Anticorpo Humanizado

Sequncia Murina

Anticorpo Quimrico

Anti-TNFalfa Infliximab ) (Remicade


Aprovado FDA 1998; Anti-Fator de Necrose Tumoral alfa (TNF ); Anticorpo Monoclonal Quimrico (IgG1-Kappa); P.M.149 KDa;

Afinidade: Kd 1, 8 x 109 M-1


Frascos contendo 100 mg de anticorpo liofilizado; Dose 3 a 5 mg/Kg com intervalos de 2 a 8 semanas;

~ 4 a 5 g/paciente.ano (40-50 frascos)


Expresso em SP2/0 perfuso Protena A

Anti-Her2 Trastuzumab (Herceptin)


Aprovado FDA 1998; Anti-domnio extra celular do receptor ErbB

2/Her2/neu (oncogene). Anticorpo Monoclonal Humanizado (IgG1-Kappa); P.M. 149 KDa; Afinidade: Kd 4,7 x 109 M-1 Frascos contendo 440 mg de anticorpo liofilizado; Dose inicial 4 mg/Kg + semanal de 2 mg/Kg 8 g/paciente.ano. Expresso em CHO (aderente) Roller Protena A

Anti-CD20 Rituximab (Mabthera)


Aprovado FDA 1997; Anti-CD20 Anticorpo Monoclonal Quimrico (IgG1-Kappa); P.M. 145 KDa; Afinidade: Kd 7,4 x 109 M-1 Frascos contendo 100 mg de anticorpo lquido (10 mg/ml); Dose inicial 375 mg/m2 / semana 4 a 8 doses. ~2.5 a 5 g/paciente Expresso em CHO ou SP2/0 Suspenso Protena A

Anticorpos Monoclonais Teraputicos Humanizados


MAb hV12.22 Novo alvo;

Antgeno solvel e ligado a

membrana. Tumores do TGI. Desenvolvimento pr-clinico. 5 novos Biosimilares (pipeline). Sistemas de Produo em alta densidade reduo de volume. Escalonamento de produo.

Pesquisa Faz Sentido


fkreutz@fkbiotec.com.br www.fkbiotec.com.br