Vous êtes sur la page 1sur 786

~

~~~~~
~~ ~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~ ~~~~~~ ~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~
~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~ ~~
~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~ ~~~ ~~~ ~~~~~~~~~~~~~ ~
~~~~~ ~~~ ~~~ ~~~~~~~~ ~ ~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~ ~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~ ~~~~~~~
~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~ ~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~ ~~~~~~ ~
~ ~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~ ~~~~~~~~~~~~~~ ~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~ ~~ ~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~ ~~~ ~~~~~~~ ~~~~~~~
~~~

~~

~~~~
~

~
~~~
- ~~~
~
~
~~
~~~
~~~
~

~~~

~
~ ~~~~ ~

~~~~ ~~~ ~ ~~~~~~~ ~~ ~


~~ ~~~~~~~~
~~~ ~~~~~ ~ ~~~~~~~~

~
~

~
~~
~~~
~~~
~~~~

~~~~
~~~

~~

~~~

~~~~~~ ~~
~~~ ~~~~~~~~
~~~~~~~~~~~
~~ ~
~~~~ ~~~
~~~ ~
~~ ~ ~
~~~~~~ ~
~~~~~~ ~ ~~
~~~ ~~~ ~~ - ~
~~~~~~~~~~
~~~
~~~~ ~ ~
~~~ ~~~

~~~~~~
~~~ ~
~~ ~ ~
~~ ~ ~
~~ ~~~~~
~~~~ ~ ~
~~~~~
~~ ~~~~~~~~ ~~
~
~~~

~~~ ~~~
~~~ ~

~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~ ~ ~~~~~~ ~~ ~ ~~~~~~~~~~~~~~~


~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~- ~~~~~~~ ~ ~~~~~~~~~~ ~~~~
~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~

~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~

~~~ ~ ~~~~~
~~~

~~

~~~~ ~~~~~~ ~~
~~~ ~~~~~~~~
~~~~~~~~~~~
~~~

~~~ ~~~~
~~

~~~ ~ ~
~~~ ~~ ~ ~~

~ ~~~~ ~
~ ~~~~ ~ ~~~~~

~~~~~~~~~~~ ~~~~~~~~~~ ~
~~~~~~~~~~ ~~~~
~~ ~ ~
~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~ ~~~~~
~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~ ~~~ ~~~
~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~ ~~~ ~~~~~~
~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~
~~ ~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~
~~~~~~~~ ~~ ~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~ ~ ~~~~~ ~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~ ~~~~~~~~~~~~~~ ~~ ~~~ ~
~~~ ~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~~~ ~~
~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~
~~~ ~~~~ ~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~ ~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~ ~~~~~~~~~~~~ ~~~~~ ~~~~~~ ~~~ ~~~~~ ~~~~~~~~~~~~~~~~
~ ~~~~ ~~~ ~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~~~~~~~~~~ ~~~~~~~~~ ~~~ ~ ~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~ ~~~~ ~~~~~~~ ~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~ ~~ ~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~ ~~~~~~~~
~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~ ~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~~~~~~~~~~ ~~~~~~~ ~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~
~~~ ~ ~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~ ~~~~~~
~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~ ~
~~

~~~~~~~~~~~ ~~~~~~~~~~ ~
~ ~~ ~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~ ~~~ ~~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~ ~~~ ~~~~~~
~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~ ~~ ~~~~~~~~~~~~~~~~~~~~~ ~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~
~~ ~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~ ~~~~~~~ ~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~ ~~ ~~~~~~~~~~~~~~~~~~ ~ ~~~
~ ~~~ ~~ ~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~
~~~~~~~~~~~ ~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~ ~~~~~~ ~ ~~ ~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~
~~~~~~~~~ ~~~~~ ~~~~~~~~~ ~~ ~~~~ ~~~~ ~~~~~~~~ ~ ~~~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~ ~~~~
~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~
~~ ~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~ ~~~ ~ ~~~~~~~~~~~~~~~~~ ~~
~~~~ ~ ~~~~~ ~~~~~~

~~~~~ ~~ ~~~~~~~ ~~~ ~ ~~~~~~ ~~~~~~~~~~~~ ~~ ~~ ~ ~~~~~~~~~~~~


~~~ ~~~~~~~
~~~~~~~~~~~~~ ~ ~~~ ~~~~~ ~ ~ ~~~ ~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~ ~~~~~ ~~~~~~~~ ~~~
~ ~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~ ~~
~~~
~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~ ~~~
~~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~ ~~~~~ ~~~~~ ~~~~~
~~~~~~ ~~~~~ ~~~~~~~~
~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~ ~ ~ ~~~ ~~ ~~
~~~~~~~ ~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~ ~~~~~~~~~
~~~~~~~~~~~ ~ ~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~

~~~
~~~~~~~~~~~ ~~~~~~~~~~ ~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~ ~~~~~~~~ ~~~ ~~ ~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~ ~ ~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~ ~~~ ~ ~~~~~~ ~~~~~~~~ ~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~ ~~~~ ~~~ ~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~ ~~ ~~~~~~~ ~ ~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~ ~~~~~~ ~~~~~~~~~~~~~~~~ ~~~
~~~~~~~~~~~~~~~~ ~~ ~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~
~ ~~~~~~~~~~~ ~~~~~~~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~ ~~ ~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~ ~~ ~~~~~~~~~~~~~~~ ~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~ ~~~~~ ~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~ ~~~~ ~~~~~~~ ~~ ~~~~ ~~~~~~~~~~~~~~~~~ ~ ~~~~~~~
~~~~~~ ~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~ ~ ~ ~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~ ~~~~ ~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~ ~~~~~ ~~~~ ~~ ~~~~~~~~~ ~~~~
~~~~~~~~~~ ~ ~~~~~~ ~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~ ~~~~~~~~ ~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~ ~~~


~ ~~~~~ ~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~~~~~~~~~~ ~~~~~~~~~~~- ~~~ ~~
~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~ ~~~~~~ ~~ ~~~ ~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~
~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~ ~~~~ ~~~~~
~~~ ~~~~~ ~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~ ~~~ ~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~ ~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~
~ ~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~ ~ ~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~ ~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~
~~~

~~~~ ~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~~~ ~~~ ~~~~~~~ ~~~~~~ ~~~~~~~ ~~~~~~~~~~~ ~~~~~~
~~~~ ~~~~ ~~~~~~~~~~ ~
~ ~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~
~~~~~~~ ~ ~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~~~~~~~ ~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~ ~
~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~ ~~~~~~~~~~~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~~~~~ ~~ ~~~~~ ~~~~~~~ ~~~~~~~~~~~ ~ ~~~~~~~~~~ ~~~~~~~~~~~~~~
~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~ ~ ~~~~~~~~~ ~ ~~~~~~~~~~~~~ ~~~~~~~~~
~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~ ~ ~
~ ~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~ ~~~~~ ~~ ~ ~~~
~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~ ~~~ ~~~ ~~~~~~~
~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~
~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~ ~
~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~ ~ ~~~~~~~ ~~ ~~~~~~ ~~~~~~~~
~~ ~~~~~~ ~~ ~~~~~~~ ~~~~~~~~~~~ ~~~~~~ ~~~~ ~~ ~ ~~~~~
~~ ~~~~~ ~~~~~~~~~~~~~~ ~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~ ~~~~~~~ ~~ ~~~~~~~ ~~~~ ~~~~~ ~~~~~~~~~ ~~
~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~
~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~ ~~
~ ~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~ ~ ~
~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~ ~~~ ~~~~~ ~~~~~~~~~ ~~~~ ~~
~~~~~~~~~~ ~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~
~~~~~~~~ ~~~~ ~ ~ ~~~~~~~~~~ ~~~~~~~ ~~~~~~ ~~~~~~~
~ ~~~~~~
~~~~ ~~ ~ ~ ~ ~~~ ~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~ ~~~ ~~~~~~
~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~ ~~~~~~~~

~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~


~~~
~~~~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~
~~ ~~~~~~~~~~ ~ ~~ ~ ~ ~~~~~~~~~~~~~ ~~ ~~~~ ~~~~~~~~~~~~ ~~~~~~
~~~~~ ~~~~ ~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~ ~ ~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~
~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~ ~~~~~
~~ ~~~~~~~~ ~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~ ~~~~~~~~~~ ~ ~~~~ ~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~ ~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~
~~~~~~~ ~~~~~~~~ ~~~~~~~ ~ ~~ ~~~~~~ ~~~~~~~~~~~~~~~~ ~~~ ~~
~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~
~ ~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~ ~~
~~~~~~~~~~
~ ~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~ ~~~~~~~ ~~~~ ~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~ ~~~~~~~ ~~~ ~~~ ~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~
~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~ ~ ~~~~~~~ ~~~~ ~~~~
~~ ~~~~ ~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~ ~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~ ~~~~~ ~~~~~~~~~~ ~~~~~~ ~~ ~~~~ ~~~~~~~~~~~~~~~~~~~ ~ ~~~~~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~ ~~~~~~ ~~~~~~~~~~ -
~~~~ ~~~~~~~~~~~~~ ~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~ ~~ ~~~~ ~~~ ~~~~~ ~ ~~~~~~~~ ~~~~~~~
~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~ ~ ~~~~
~
~~~~ ~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~

~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~


~~ ~

~~~~~~~~~~~ ~~~~~~~~~~ ~
~~~ ~~~ ~~~ ~~~ ~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~ ~~ ~~~ ~~~~~~~ ~ ~~ ~~~ ~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~ ~~~~~ ~~~~~~~~~~~~~ ~~~ ~~~~ ~~
~~~ ~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~ ~~~ ~~~~~~~~~~~~ ~~~~~~~~ ~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~ ~~
~ ~~~~~~ ~~ ~~~~~~~ ~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~ ~~~ ~~~ ~ ~ ~~ ~~~~~~ ~
~~~~~~~~~ ~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~ ~~~~~~~
~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~ ~~~ ~~~~ ~ ~~ ~~~~ ~~~~~~~~~~ ~ ~~~~~~~~~~~~ ~
~~~~~~ ~~~~ ~~~~~~~~~~~~ ~~~~~~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~ ~ ~~
~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~
~ ~~~~~~~~ ~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~ ~~~ ~~~~~
~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~ ~ ~
~~~~~~ ~~~~ ~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~
~ ~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~ ~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~ ~~
~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~ ~~~~~
~~~ ~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~
~~ ~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~ ~~ ~~~~ ~~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~- ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~
~

~~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~ ~~~ ~ ~~~~~~~~~~ ~
~~~~~~

~~~

~
~
~~~~~
~~ ~~~~~~~ ~~~
~ ~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~ ~ ~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~ ~~~~~~~~~~~ ~~~~~ ~
~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~ ~~~~~~~~~~~ ~~ ~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~ ~ ~~~~~~~~ ~~~~ ~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~
~~~~ ~~~~~ ~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~ ~~~~ ~~ ~~~~~~
~~~~ ~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~ ~~ ~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~ ~~~~~ ~~ ~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~ ~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~ ~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~ ~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~ ~~ ~~~~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~ ~~~~~~~~~~~~~~ ~ ~~~ ~ ~~~ ~~~~
~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~ ~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~ ~~~~~~~~~~ ~~~~~~~
~~~~~~~ ~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~
~ ~~~ ~ ~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~
~~~ ~~~~~~~~

~ ~ ~

~
~ ~~
~
~

~ ~~~
~~~ ~~~

~
~~~~~~~~~~~ ~~~~~~~~~~ ~

~~~

~
~~~~ ~
~~
- ~~
~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~
~
~


~
~
~

~
~~

~
~~
~~~~~~
~
~~
~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~

~~~
~~

~
~

~
~
~~~~ ~
~~
- ~~
~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~~~
~
~
~~

~~~
~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~~~~

~
~~

~~

~~
~~~
~~~~~ ~

~~

~
~
~

~
~~~
~~~
~~~
~~~~~ ~

~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~

~~~~ ~ ~ ~
~~~
~~ ~
~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~

~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~


~~~~~ ~~~~~~~~~~~~~~ ~~ ~~ ~ ~~~~~~~~~~~~ ~~~~~~~ ~~~
~~~~~~~~ ~~~ ~~~~~
~~~~ ~

~~ ~

~~

~

~~~~ ~
~~ ~~~~~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~
~~~~~~~

~~ ~
~~~~ ~
~~~~ ~~~ ~ ~~~~~~~ ~~ ~
~~~

~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~
~

~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~
~~~~
~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~

~
~

~
~~~~~
~~~~ ~ ~~ ~~~~ ~~

~~~~~~~~ ~~ ~~ ~~~ ~~ ~ ~ ~ ~~~~~~ ~~~ ~~~~~~~~


~~~ ~~~~~ ~ ~ ~~~~ ~~~~ ~~~~~~~~ ~~ ~ ~~~ ~~~ ~~ ~~~~~~
~~ ~ ~~~~ ~~~~ ~~~~~ ~ ~ ~ ~~ ~~~ ~ ~ ~~~~~
~~ ~ ~~ ~ ~~~~~~~~~~~ ~~ ~~~~~~ ~~~ ~~~ ~~~~~~~~~ ~~ ~~~
~~ ~~~~~~~~ ~ ~~~~~~~ ~~~ ~ ~~~ ~~ ~~ ~~ ~~ ~ ~ ~~~~
~~~~~ ~~ ~~~ ~~ ~~~~~~~~ ~~~ ~~~~~~ ~ ~ ~~~~~~~~ ~~
~~ ~~ ~ ~~~ ~~ ~ ~ ~~ ~ ~~~~~~~~~~ ~ ~ ~ ~ ~~ ~
~ ~~~~ ~ ~~~ ~~~~ ~~~ ~ ~~~ ~ ~~~ ~~ ~~~~~~
~ ~ ~~ ~~~~ ~ ~~~ ~~~~~ ~ ~~~~~ ~~~~ ~~~~ ~~~
~ ~~~~~~~~ ~~~~~~ ~~~~~~~~ ~ ~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~ ~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~ ~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~ ~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~ ~~~~~~~~ ~~
~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~ ~
~~~~~~~~ ~~~~~~~ ~~ ~~ ~~~ ~~
~~~ ~~~~~~~ ~~~~~~~
~ ~~~~~~~ ~ ~~~~~~~
~
~
~~ ~~~~~ ~~~~~ ~~~~ ~~~~ ~~ ~~~~~~~~~~~~~~~
~ ~~ ~ ~~~~ ~~ ~~~ ~~~ ~~~~~ ~ ~~~~ ~~~ ~ ~ ~~~~
~~~ ~ ~~~ ~~~~~~~~ ~ ~~~~~~ ~ ~~ ~~~~~~~~~ ~ ~~~ ~~~~
~~~~ ~~~ ~~ ~~ ~~~ ~~~~~~~ ~~ ~~~ ~~~~ ~~~ ~ ~~~~
~~ ~ ~~~~ ~~~~~~~~~ ~~~ ~ ~ ~~~~ ~~~~~~ ~~~~~ ~~~~
~~ ~~~ ~~~~~~ ~
~~~~~ ~~~ ~ ~~~~ ~
~~~~~~~~~~~ ~~~~~~~ ~~ ~~ ~ ~~~~~~ ~~~~~~~ ~ ~ ~~ ~
~~~~~~~ ~ ~~~ ~ ~~~ ~~~~~~~~ ~~ ~~ ~~ ~~ ~ ~~~ ~
~~~~ ~~ ~~~~~~ ~~~~ ~~~~ ~~ ~~~~ ~~~~~~~~ ~~~~ ~~
~~ ~~ ~~ ~~ ~ ~~ ~ ~~~~~~ ~~~ ~~~~ ~~ ~~ ~~~ ~~
~~~~ ~~~~~~ ~~~ ~~ ~~ ~~ ~ ~~~ ~~~~~~ ~~ ~ ~~~~~~ ~
~~~~ ~ ~~~~~~~ ~~ ~~ ~ ~~~~~~~ ~ ~ ~~ ~~ ~ ~~~~~
~~~~~~ ~~~~~~~ ~~~~~~ ~~~ ~~~~~~ ~~ ~~~ ~~~ ~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~ ~~
~~~~~ ~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~~~ ~ ~ ~~ ~
~~~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~ ~~~~~~
~~~~ ~~~~ ~ ~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~ ~ ~~~ ~ ~~ ~~~~ ~ ~~~~~~ ~~~~

~~~~~
~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~
~~~~~~~~~ ~~~~~~~~~~~ ~ ~~~~~~ ~~~~~ ~ ~~~
~~ ~ ~~~~ ~~~~ ~~ ~~ ~~~ ~~~~~~~~ ~ ~~~~~~~~~~~~~

~~
~~
~~~~~~~ ~~ ~~ ~~~ ~ ~~ ~~~~~~~ ~~~ ~ ~~~~~ ~~~ ~~
~~~~ ~ ~~~~~~~~ ~ ~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~


~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~ ~~ ~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~
~~~~~~~ ~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~ ~~ ~ ~~~~ ~~~~ ~ ~ ~~~~~~~~~~~~


~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~ ~~~

~ ~~~~~~~~~~~~~~~~~~~~~~~~~- ~~ ~~~~~~~~~~~~~~~~~~

~ ~~ ~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~


~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~ ~~~~~~~~
~~~~~ ~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~ ~~ ~~~~ ~~~
~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~ ~ ~ ~~~~ ~ ~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~

~~~

~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~


~~~~~~~ ~~~~~~~~ ~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~
~~
~
~~ ~~
~~
~~~
~~~~
~~
~~ ~
~~~ ~
~~~~
~ ~~~
~ ~~~
~~~~~
~~ ~
~~~
~~~~~~
~~~~~~
~~~
~~~~~~
~~~~~
~~~~
~~~~
~~~~~
~~ ~~~~
~ ~~
~~~~~~
~~~
~~~~~~~
~~ ~~~~~~~~
~ ~~
~ ~~~~~~~~ ~~~
~~~~~
~~~~~ ~
~~ ~
~~~~~~~~~
~~~~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~ ~ ~~~~~~~~~~~~~~~~~
~ ~ ~~ ~~ ~~~~~~~~~~~~ ~~ ~~~ ~~ ~~ ~~ ~~~~ ~~~~~ ~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~ ~~~~~ ~ ~~ ~~~ ~~~~ ~~~~ ~ ~~~~~~ ~~~~~~ ~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~
~~~~~~~ ~~ ~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~~ ~~ ~~~~ ~~~~~~~~~~~~~~~~ ~
~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~ ~~
~ ~ ~ ~~~~~~~~~~~~~~~~

~~~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~ ~~~~~~~~~~~~~~~~~
~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~
~~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~ ~
~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~ ~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~ ~~~~~~ ~~~
~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~ ~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~
~~~ ~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~ ~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~ ~ ~~ ~~~ ~~~~~~~~
~ ~~~~~~ ~~~~~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~
~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~ ~~ ~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~ ~~
~~ ~~~~~~ ~~~ ~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~
~~ ~~~~~~ ~~~ ~~~~ ~~ ~ ~~~ ~~~~~~~~~~~~ ~~~~~~
~~~ ~
~~~~ ~~~ ~~~~~~ ~~~
~~ ~ ~ ~~~~~~~~~~~~~~ ~
~ ~~ ~~~~~~~~~~~~~ ~~~~~ ~~~~~
~~~~~~~~~~ ~~~ ~~ ~~~~~~~~~~
~~~~~~~~~ ~~

~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~~
~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~
~~~
~~~ ~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~ ~~~~~

~~~ ~~~~ ~~ ~ ~~ ~ ~ ~ ~~~~~~~~ ~ ~~~~ ~ ~~~~ ~~~


~~~ ~~ ~~~~~ ~ ~ ~ ~~~ ~~ ~~~ ~~ ~~ ~ ~~~ ~~~~~~
~~~~~ ~ ~~~~~~~~ ~ ~~~~~ ~~ ~ ~~ ~ ~ ~ ~ ~~~~~~
~~~~ ~~~~~~~~~ ~~ ~~
~ ~~
~~ ~ ~~~~ ~ ~~~~~~~~~~~ ~~~~~ ~
~ ~~~~~~ ~ ~~~ ~~~ ~ ~~~~~ ~ ~ ~~ ~~ ~~~ ~ ~~ ~~ ~
~~ ~~~~~~~~ ~~~~~ ~ ~ ~~~~~~~~~~~~ ~~~ ~~~ ~ ~ ~~~
~~~~~ ~~~~~ ~~~ ~~~~~~~~~ ~~~ ~ ~ ~ ~ ~~
~~ ~ ~~ ~ ~~~ ~ ~~~~~~ ~ ~~~~~~~~ ~~ ~ ~~~~~
~~~ ~~ ~~~~~ ~ ~ ~~~ ~ ~ ~~~~~ ~ ~ ~~~~~
~~ ~ ~ ~~~~ ~~~ ~~~~~ ~~~~~~ ~ ~ ~~ ~~ ~
~~~ ~~~~~~~~~~~ ~~~~~~ ~~ ~ ~ ~~~~~~~~~ ~~ ~ ~ ~~ ~
~~~~~~~ ~~~ ~~~ ~~ ~ ~~~ ~~~~ ~~~~~~~~~ ~ ~~~ ~~
~~~ ~~~~~~~~ ~~~~~~~~~~~~ ~~ ~~~~~~ ~~~ ~~~ ~ ~~~~~~~~~~~

~~ ~ ~ ~~~~ ~~~~ ~~~~~~~


~~~~~ ~~~ ~ ~~~~~ ~~~ ~ ~~ ~ ~~~~~~~~~~ ~
~~~~~ ~~~ ~ ~~ ~ - ~~~~~ ~~~~~ ~~ ~ ~~~~~ ~ ~ ~ ~~~~
~~~~ ~~~~~ ~~ ~~~ ~~~~~~ ~ ~~~~ ~~ ~~~ ~ ~~
~~ ~ ~~~~ ~~~ ~~~~~ ~~~~~~~ ~~~~~~~ ~~ ~~~~~~~
~~~~~ ~~~ ~ ~~~~~~~
~~~~~~ ~~~ ~~ ~ ~
~~~~ ~~~~~~~~~ ~~~ ~~~~~ ~ ~~~ ~~~~ ~~~ ~~~~
~ ~~~~~~ ~ ~~~~ ~ ~ ~~~~ ~ ~~~~ ~~~ ~ ~~~~~~~ ~
~~~ ~~ ~~~ ~~~ ~ ~~~ ~~~ ~~~~ ~~~ ~~~ ~~ ~~~~~~ ~~~
~ ~ ~ ~~~~ ~ ~ ~~~~ ~ ~ ~~~ ~~~ ~~~~~~ ~ ~~ ~~~
~~~~~ ~ ~~ ~ ~~ ~~~ ~~~~~~~~~~~ ~~~ ~ ~~ ~~ ~~~~~ ~~~
~ ~ ~~ ~~ ~ ~~ ~~~ ~ ~~~~~~~~~~~ ~~ ~~~~~~ ~~ ~
~~~ ~~ ~ ~~~ ~~ ~~~~~~~ ~~~ ~~~~~~~ ~~ ~~~ ~~ ~~~
~~ ~~~~~~~~~~~~~~
~
~~
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~
- ~~ ~~ ~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~ ~~~~~~~~
~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~~~~ ~
~~~~ ~ ~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~
~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~ ~~~~ ~~~ ~~~~~~~~~~~~~~~~ ~ ~~~ ~~~
~~~~~~~~~~~~~~~~~~~~~~ ~- ~~ ~~~~
~~
~~
~~~ ~~~~~ ~~~~~~~ ~~~~~~~~~~ ~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~ ~~~~~~
~ ~~~~~~~~~~~~~~~~~~~~~~~
~- ~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~ ~~ ~ ~ ~~~~ ~~~~~~~~ ~
~~~ ~~ ~~ ~~~~ ~ ~~~~ ~~ ~ ~~~ ~~
~~ ~~~~~~ ~ ~~~~~~~~~ ~
~ ~~~ ~ ~~ ~ ~ ~~ ~~
~~~~~~~~~~~~~~ ~ ~~~~~ ~~~~~~~~~~~~~~~~~~~
~ ~~~~ ~~~~~~~~ ~~~~~~~~~~ ~~~~ ~~~~~ ~~
~ ~~ ~~~~~~ ~ ~ ~~ ~~~~~~~~
~~~~ ~~~~~~~ ~~~~~~~~~~~~~~
~ ~ ~~~ ~ ~ ~~ ~~~~~~~
~ ~ ~ ~ ~~~~~~~~ ~~~~~~~~~~ ~~~~~~~ ~~~~~ ~

~ ~~ ~
~~~~~ ~ ~~~~~~ ~~~
~~ ~~ ~~~~~~~ ~~~~~~ ~ ~ ~~~~
~~~ ~~~~~ ~ ~~ ~ ~ ~~ ~
~~~ ~~ ~~ ~~~~ ~~~ ~~ ~~ ~ ~~ ~ ~~~ ~ ~~
~~~ - ~~ ~ ~~ ~~~~~~~~~ ~ ~ - ~~
~ ~~ ~ ~ ~~~~~~ ~ ~~~ ~ ~~~~~~~~
~ ~~~~~~ ~~~~~ ~~~~~~~~~~~ ~ ~~~~~~~
~~ ~~~~~~~~~~~ ~~~~ ~ ~~~ ~~~~~~ ~ ~~~~~~ ~ ~~ ~~
~ ~~~ ~~ ~~ ~~~~ ~~ ~~ ~~~~~~~~ ~~~ ~ ~~ ~
~ ~ ~~~~~~ ~ ~~~~ ~~~~~~~~~ ~~~~ ~ ~~~~~ ~ ~~
~~~ ~~~~~ ~~~~~~~~~ ~ ~~~~~~~~~~~ ~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~ ~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~ ~~~ ~~~~~
~~ ~~~~ ~ ~~ ~ ~ ~ ~ ~~~~~~~ ~ ~ ~~~ ~~ ~~ ~~~~~~
~~~~~~~~~~~ ~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~ ~~~ ~~ ~~~~~~~ ~ ~~ ~~~~~~~~~~~ ~~~ ~~~
~~~~~~~~~ ~~ ~ ~~ ~~ ~~~ ~~ ~ ~~~~~~ ~~~ ~
~~ ~~ ~ ~ ~~~~~~~ ~~ ~ ~~~~ ~~~ ~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~ ~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~
~

M
LESSON FOUR
GEMATRIA
GematriaisabranchoftheLiteralKabbalahwhichisnumero-
logicalinform .ThewordGematriaitselfisametathesisofthe
GreekwordGrammateiawhichhasacontemporarymeaningof
Secretariat .Formanyyearsithasbeenusedforindepthanalysis
manysacredHebrewtextsbylearnedRabbisandbythosewho
studytheHermetictradition .Itsbasisconsistsofthenumero-
logicalvalueofeachletteroftheHebrewalphabet(andany
otheralphabetthathasanumericalvalue)whichisusedtogive
avalueofanyparticularword .ByuseofaHebrewLexiconone
canthenuncoverotherwordsofthesamenumerationwhosemeaning
throwslightonthehiddenmeaningofthosewordswhichhavethe
samenumericalvalue .
OneexampleofthisistheHebrewwordADNI(1+4+50+10=65)
meaning'MyLord' .TurningtotheLexiconwefindawordof
similarvalueHLL(5+30+30=65)whichmeans'shone,gloried,
praised'- aclearelaboration . ThereisalsoHYKL
(5+10+20+30=65)meaningthe'Palace'whichdescribesyetanother
aspectofthenatureofADNI .

Bylookingattheword'Unity'
whichisAChD(1+8+4=1":-)onefindsthatother
L4/pg 1
wordsofthesame
valueare,AHPH(1+5+2+5=13)meaning'love',andGHH(3+5+5=13)
meaning'raisedup'whichhintsattheexaltednatureofunityas
wellaslove ..
YouwillfindthatwithfiveoftheHebrewlettersthereare
two sets of values present .

One is for the ordinary letter and


the other is for when any of these are the final letter, at
end of a word .

As an example, take the word ChKM


original word examined .

In Gematria,
to blend both the positive and the negative
a concept of the totalmeaning .
L4/pg 2
f
the
be wise',
whichcould be either 8+20+40=68or8+20+600=628,takinginto
accountthefinalnumeration .Mostoftentheformer is used
gainageneralinterpretationwhilethelatterforpinpointing
morespecificmeanings .SoforChKMinsearchofthegeneralor
evenpassive,onecantakethewordChLL(8+30+30=65)meaning
'emptiness'(undistorted,uncluttered)andforsomethingmore
particularoractivethewordBRKVTh(2+200+20+6+400=628)turns
uptoexplainsomethingofthedivineprocesstherein,witha
meaningof'blessing' .
WhenusingGematriaanimportantthingtoconsideriswhet-
herthewordsbeingutiliseddorelate .ByreferringtoaHebrew
Lexicon or textssuch as the Sepher Sephiroth, one will find that
themajorityofwordsofthesamevalueareincontextwiththe
originalwordchosen,itmustalsobepointedoutthattheremay
besomewordsthatdonotfit,andintheseinstancesintuition
playsanimportantpartbycombiningwiththescienceofnumero-
logytoproduceadesiredeffect .Donotbeatallsurprisedto
findoppositesinwordsofthesamenumericalvalue,insome
instancestheycanbeappliedtotheextremeaspect

the
onewillfindthatto
uncoverthebroadestandtruestmeaningofaworditisnecessary
aspectstoformulate
1
1
41
1
Possibly the best period of Hebrew writings to work on is
the Old Testament, and alexicon of this period will help greatly
though it must be remembered that alexicon provideswords and
roots only, and not the numerical values which the student will
ahve to work out, or purchase some of the existingliterature in
this field. It must be remembered though that in Gematria not
only words but the Hebrewroot meanings as well are to be used as
more often than not they provide more information on the word
than the word itself . If you examine many of the biblical names
and break them down into their root form one can uncover a wealth
of information not previously suspected .

Take for example the


10
I
I
I
I
r
A breakdown of the value of a word can be utilised when that
number is a double digit figure or more . For example : ADNI =65,
6+5=11, which turns up wordssuch as DHE+ (4+5+2=11) meaning
'gold' ChBA (11) 'to conceal', GCh (11) 'to erupt or burst
forth' etc ; all of which show aspects of the Adonais nature .
Suchreduction provides clarification at a morefundamental
level ; a further breakdown of 11, 1+1=2 implies 'wisd.om and
duality' which are even morefundamental aspects of the naturt~ of
the word .
name of, the Archangel Auriel (AVRYAL) from which
If we wish to use Gematria to relate to
L4/pg
therootwords
ARV'tosee,behold'andYAL'towillorbewillful'canbe
derived .Thesemeaningssuggestdualaspectsofopeningupto
thelightandthewayofaspiration,herelinkeddirectlytothe
divinelight .
the10Sephirothof
the Kabbalahwewouldhavethefollowing :
1 .Kether(KTHR=20+400+200)=620
2 .Chokmah<ChKMH=8+20+40+5)=73
3 .Binah(BYNH=2+10+50+5)=67
4 .Chesed(ChSD=8+60+4)=72
5.Geburah(GBVRH=3+2+6+200+5)=216
6.Tiphareth(ThPARTh=400+80+1+200+400)=1081
7 .Netzach(NTzCh=50+90+8)=148
8.Hod(HVD=5+6+4)=15
9 .Yesod(YSVD=10+60+6+4)=80
10.Malkuth(MLKVTh -- 40+30+20+6+400)=496
Thoughtheremaynotappeartobemanydirectrelative
associationsatthislevel,alittlesearchingwillalwaysyield
somethingofvalue .TakeKetherasanexamplewhichhasavalue
of620andcompareitwithaanotherHebrewwordsuchasShAaRYM
(inthisinstancethefinalnumerationisdiscounted)whichmeans
'TheDoors',clearlyreferringtoanentrancepoint,thewayin
orout
.Further,if620isreducedtoasingledigit - 6+2+0=8,
wordssuchasAHB'love'andDD'breasts'canbederivedand
thesearetwoassociationsthatshowKetherinamatriarchial
way.Thisisanenergythatgivesloveandnurturesitself<and
others)throughthedevotionalmodeofexistence
.Another
exampleisChok::mah ; otherwordsofthesimilarnumericalvalue
havemeaningssuchastotrust,shelterin,feast,andpositive
retribution.73reducesto1,generallyrelatingtoitsbeingan
entirety,anemanationfromKethertheCrown .
L 4 /pg4
1
41
1
M
r
L 4 /pg
Another method which can be usedis to multiply the number
of the word,i .e . with Netzach : 1x4x8=32, which yields associa-
tions such as 'glory' and 'mind' . Such amethod relates more to
theexpanded meaning ofa word, but still in a general sense .
Another point ofimportance in gematria lies in the use
discrimination .

Take the Hebrew word 'lily' as an example;


ShVShNTh,whichequates to1056. Since there are very few words
of thisvalue, we resort to 1+0+5+6=12, which aligns with other
wordsmeaning 'longed for', 'departed', etc . This
showthis are thefollowing biblical examples .
numeration of "Lo!
H

Sv

Sh

N
alludes tothe
lily which represents those who have gone and are missed (hence
the lily as the flower of funerals) . A further breakdown, of 12
to 3, provides only a very generalmeaning .
Gematria works well on sentences andgroups

words, to
Working with the
threemen stood by him" (Gen xviii,2) it can
revealed that these were Michael, Gabriel and Raphael, the
sentence having the same value as "These are Michael, Gabrieland
Raphael" . Thus:
Lo! three men stoodby him
V
5+ 300
+ 30 + 300 +5+50+5+= 701
andRaphael
L
+ 30 +
These are Michael
L

A
30 ++ 20 + 10 + 40 +6+ 30 +1
Gabriel
L

R
30+1+10+200+2+3
+ 80 + 200 +
V
='701
[BearinmindthatHebrewiswrittenrighttoleftas
sentencesherequoted .

However,throughoutthislectureallof
thewordswrittenontheirown(i .
phrase)willbefromlefttoright .]
verse19,whichreadsthus :
L4/pg 6
withthe
. notwithin a sentence
AnothergoodexamplecanbegivenwithExodusChapterxiv,
ofElohim

Angel

Andthe
M(F)YHCAH(=651)

K(F)ALM(=571)

AaSYV(=146)
Israel

thecampof

whichwentbefore
LARShY(=541)

HNChM(=103)

YNPL(=170)
or
1
1
41
M
N(F)NAaH(=825)

CVMAa(=120)

AaSYV(=146)
behind them

and stood

removed from before them


M(F)HYRChAM(=864)

DMAaYV(=130)

M(F)HYNPM(=785)
There are of course numerous methods (as previously des-
cribed) for analysingandinterpreting writings such as this, but
to really open it up, there is the technique whereby eachwordis
replacedbyanother of thesamevalue,therebycreatingawhole
newsentence .This,aswithsinglewords,wouldstillhavea
directparallelwiththefirstsentence,thewholeprocessbased
veryfirmlyonnumericalassociation .

Inaddition,wordsofthe
samevaluearenotalwaystobe
toreplaceitwithtwowords,i . . forMARVTh(647) - 'lights',
onecouldutilisePSG(143) - 'makedistinct',
'arrangeintoorder' .
found,
L4/pg 7
wentbehindthem

removedand
M(F)HYRChAM(=864)

K(F)LYV(=546)
of cloud

Pillar

and the
butitisquitefeasible
andShDR(504) -
Workingfromtheaboveverse,thefollowingisonepossible
derivation :
(reading right to left)
L4/py8
pronouncesolemnly

balance

The first gate


M(F)AN(=651)

ALOThM(=571)

AMU ABB(=146)
sharp+secure

Oblation

theWand
BRD+HLSh(=541)

HChNM(=103)

LOM(=170)
Sun+Moon

aWatchman
ShMSh+ChRYV(=864)

RMVSh(+546)
Master

shelter,trustin+returning,positiveretribution
LAaK(=120)

HSCh+LlMG(=146)
blessings+leapforth

arrangetogether+anassembly
ThVKRB+

ONZ(=785)

M(F)S+HTzAa(=825)
rainbow

extend

repeat
ThShO

HTN(=864)

Lf'K(=130)
Thiscouldbereadas"Thefirstgateuntobalancewas
pronouncedsolemnly withthewandandoblation,
ingstorepeatandextendasarainbow" .
sharpbut secure,
withaWatchmanbidingtheSunandMoon,toshelterandtrustin,
alwaysreturningand withpositiveretribution .

Hereinthe
Masterarrangedtogetheranassembly,toleapforthwithbless-
1
44
M
1
t
L4/pg 9
To furtherclarify, one may takethetotalofallthese
numbers(6463),andbytheuseoftheosophicalreductionand
multiplication,constructafurthersentencethereforederiving
THBL(432)'amixtureoftwokinds',k:D(24)'propelforth',
ChVH(19)'manifest',ChB(10)'ahiddenplace',plusthetotalof
thesenumbersreducedHZH(17)'dreams' .Thisprovidessuchan
explanationas"Amixtureoftwokinds,propelledforthtomani-
festfromahiddenplaceindreams(orvisions)" .
RememberthatinallofGematriathegreatestkeyliesin
discrimination,recognisingtheunderlyingthread .
Gematriathereisamethodofutilisationthatwas
popularamongtheadeptioftheGoldenDawnwhichwascalled
theosophicaddition .Earlierinthislessonitwaspointedout
howadoublenumbercanbereducedtoasingledigittofurther
expandonitsmeaning .Theosophicadditionfollowsareverse
direction,thenumberinvolvedaddedwithallthenumberspreced-
ingit,from1upwards .Thisyieldsalargerkeynumbertowork
with,thoughgenerallythisformofadditionisonlyusedin
areaswherelownumbervaluesareinvolved .Toworkwithlarger
numbersthereisameansknownastheosophicmultiplication,
wherethevalueofawordorsentenceismultipliedout,i .e.
MANBN(alover)=53,5x3=15whichyields'overflowing,abound-
ing,pride,exaltationetc' .Theosophicreductioncanbeapplied
theresultsofboththesemethodstofurtherexpandonthe
generalmeaninginvolved .
Netzach
10
21
7 28
8=36
9=45
55
11=66
12=78
13=91
14=105
15=120
renderedbytheosophicadditionisgivenbelow :
=1+2=3
=1+2+3=6
=1+2+3+4=10
=1+2+3+4+5=15
Tiphareth=1+2+3+4+5+6 1
=1+2+3+4+5+.6+7=28
16=136
17-=153
18171
19=190
20=210
21=231
22=253
23=276
24=300
25=325
26=351
27=378
28=406
29 - 435
30=465
L4/pg10
Alistofnumbersfrom1t30showingtheirvaluesas
TheSephirothcanbeworkedwithinasimilarmanner,i .e .
Kether
Chokmah
Binah
Chesed
Geburah
1
44
f
t
The sum of thesetotals equals 220, the numeration of AaNC,
meaning 'surround, encompass' and BChYR 'the Elect' .

There are

many other possibilities inherent in workingwith the values


the Sephiroth, experimentation and discriminative analysis yields
much which is ordinarily hidden from view .
A few more examplesfollow, using the three methods of
theosophical addition, multiplication and reduction .
M
By reduction the number of Kether (KThR =-20+400+200)=620,
produces 8, suggesting the Splendour of
applied to 8 turns up 36, one associationi 'perhaps,possibly'
from the word LV intimating the potential yetnot manifested
state of Kether .

Taking thisone more step, 3+6 = 9, hinting at


Kether's Foundation aspect (Yesod) ; and
tial number of 11-'ether) the wholeness of the esoteric concept of
returning to the sourceis described .Multiplication 62C)
leaves us with 12, describing as an expanded aspect of Kether the
Universal form, as in the Sphere of the Zodiac . 12 can also
represent another type of expansion in 1x2 = 2, 1+ = 3, 2x2 = 4,
2+3ri etc ., alluding to the unfoldinga
Hod .

Further,addition
with 9 added to 1 (essen-
the Sephiroth .
Tiphareth, the sixth Sephira which is central to the Tree,
has a wordvalue-of10:61,thatreducesto10 .

Henceonthe
L4/pg11
Hod

= 1+2+3+4+5+6+7+8= 36
Yesod

= 1+2+3+4+5+6+7+8+9 = 45
Malkuth

= 1+2+3+4+5+6+7+8+9+10 = 55
5)
appropriate consideringsuch
male and femal
L4/pg 12
fundamental side ofTiphareth we have it described as
midway between 10 and 1 ;
menting this line of analysis is the number derived from
emphasises the mid-point .

There is also NGB (50+3+2 =


point
the equipoised manifestation .

Comple-
10 by
addition, 55. This, when rendered into two single digits (5 and
55)
which represents 'noon, mid-day' -a reference to its solar
nature as well .Working on 1081 Theosophical Multiplication
would normally only give us 8. To go beyond this there is an
occasionally used method which combines the 1 and 0 as 10 . So
from that would result lOx8xl = 80, the numerical valueofwords
suchasKSmeaning'Throne' (see Ex .xxii,16),andVAaDwhichis
translatedas'Union' .Whenanalysingthroughthismethod,it
canbehelpfultobearinmindtherelationshipbetweenthest
and10thSephiroth .
Mathematicalconsiderationsprovideforanotherdirectionto
workwith,takingintoaccountthenatureofanyparticular
numberanditscross-relations .Anyprimenumber,suchas13,
41,or107,suggestanindivisiblewholenessorsimilar .

Very
wordsasChGL(41)'togoroundina
circle',andBYTzH(107)'anegg' .

Anynumberdivisibleby
couldbeinterpretedinlightofpositiveandnegative,paternal
and maternal archetypes.
others, YOD meaning 't burn' .
Agoodexampleis114,providingamong
Halfof114is57wherewefind
DNG'soft,likewax',therebyillustratingactiveandpassive
stages combustion .Thevalueof57(MZBCh)whichmeans
'Altar' .

CombinethiswithYODanditalludestoaspectsofthe
1
I
44
I
r
e
similar concept can be applied to those
divisibleby3,onlyinthiscasetherelatingisthroughany
L4/1:)g

_
particulartriadconceptorTrinity
wordvalues
archetype .

Forexample,the
wordABVS'amanager,stable',=69,69t3=23,givingusChDVH
meaning'joy',andChYHmeaning'stronginliving' .Thiswell
describesthejoyoftheMother(Binah)andFather(Chol ::mah)in
thebirthoftheirsonJesus(Tiphareth)andhisstrengthof
life.
Thesameprocessisapplicableasfarasonewishedtoup
throughthenumberscale,thoughthismaybeimpracticalbeyond
doubledigits .
NumericalpatternsareanotherkeyinGematria,withnumbers
suchas64,88,81and147containingsequencesallowinga more
developedinterpretation ofthewordsinvolved .88forinstance
suggests11/22/33/44/55/66/77/88,yielding :
ChKLL(88)'toinherit'
GCh(11)'eruptorburstforth'
ZVVG(22)'stateofpuberty'
GL(33)'spring,fountain'
YLD(44)'tobreed,procreate'
HYM(55)'swell,heave'
NBZBH(66)'giftorreward'
AaZ(77)'strength,vigour'
RelatingtothisthereisNChL'to inherit'
64 is a very versatilenumber,
exampleofanotherkindofpattern, i .e .
L4/pg14
ChKLLalsoamountsto88,'redness,sparkling',bothwords
describingthroughthissequencethecyclefrombeingbornto
givingbirthandbeyond,butfromtwodifferentperspectives
.
suggestingwithanywordof
thatkindofvaluemuchdiversityinmeaning .

147providesan
1+3=4+3=7etc . . .
Thismoresuggestsanexpansiveflowofideas,possiblyutilising
triadconceptsinanalysis,orrecognisinginthewordsmeaning
anindicationofsteadygrowthormovement
.81isaproductof
3x3x3x3,aswellas9x9,intimatingideasofbalanceinthepairs
ordoublepairsofnumberscomposingit .Notionsof thorita-
tivepoweranduniversalityarealsoderivedaddingmuchtowords
suchasKSA'throne',andALYM'Gods' .Keepinmindthatany
processorsequencewhichworksonewaycanworktheother .For
instance :24canbebuiltupby3,6,12,orto48,96,192
etc.,andthisenlargesonthemeaningofaword .
Geometricformsareanotherareaofconsiderationsuchas
linkingupwordmeaningsthroughthetriangle,square,circle,or
evencubeandotherthreedimensionalforms
.Oneexampleliesin
groupingthreewordsofthesamevaluearoundthepoints
an
equilateraltrianglethus :
t
1
r
LHB-

DGL-Banner or beacon
Flame
L4/pg 1 5
fordivinetravel
Readingclockwisefromtheapex,thiscouldbeinterpreted
as"Godissuingasabeaconforthedivinetravellertheflame" ;
readinganticlockwisetherearises"thelightofGodistheflame
whichilluminatesthedivineway" .TransposingALHAandDGL
rendersafurtherinterpretationof"totravelalongthewayto
God,seekthebeaconofdivineflame" .Furthertothisisthe
addingofthethreewordvalues,37+37+3=111,andpickingup
onwhatideasthatpresents .
Anotherprocessliesinplacingathreelettered(oreven
sixlettered)wordequallyaroundthepointsofatriangle,i .
withthewordTBR(211)meaning'elevatedpartofcountry' :
andRB'contend,strive',
earthwhichcausedsuchelevation .
FirstwehaveTB'relate
wellto,becompassionate',
thenBR'pure',andthirdly
TR'order,consistency',all
speakingwellofthesignificanceofsuchplacestospiritual
aspirants in easternlands .
AlsoyieldingfromthisareRT'tremble,excessivelyeven'
suggestingtheconflictwithinthe
L4/pg 1 6
Much the same ideascan be used inworking with the square
or rectangle, but with aneven greater possible diversity. Take
the word PRKTh, which means 'Veil of the Holy' . Apart from what
may be found in other words formed (i .e . KPR 'cover over'), we
may take the value of the word
700 and divide it amongst the

R
four sides or angles of the
square. Thisyields 175, the
number of T :PH 'overspread'

K
suggesting four layers composing
this veil ; the doubling of thesefour
'Th
numbers leaves 2x300, hence
the words OR 'emanate', and AaRL 'superfluous'are afew more
descriptive keys . With the sides at 175, the length from oneto
the opposing angle is 247, the numerationofZMR'topruneuse-
lessbranches' .Thiscanberelatedtothehexagramformedwhen
thetrianglescreatedbythatlineareplacedontopofone
another .

Thehexagramisaprimesymbol/toolforcontactwith
theactualuniverse,and henceassistinginuncoveringtheWay.
ThecircleasatoolinGematriaexplainslargelyinterms
ofthewhole,orthepositionofsomethingwithinthat .Using
thewordZHB(14)'gold',asanexample,wetake14astheradius,
andfindthecircumferencetobe88 .Apartfromother ideas to
bederivedfromthatnumber,itisthevalueofNChL'seething,
burning',explainingthenatureofgoldasanexpressionofthe
Sun .Workinginreverseonecouldloot; intothewordAPYLH<126)
'darkness' ; theradiusofacirclewithsuchacircumference
0
46
1
I
i
being 20, also the number of TATA 'deep hole',
one' .

Similar ideas can be used withthediameter,oreven


angleswithinthecircle .
WithGreekalphabeticallyhavingasimilarstructure
Hebrewwehavebeenusing,itisquitepossible
Gematriawithit in muchthesameway,
versionsofvarioustexts,where(forexample)
Finally,

in
L4/pg 1 7
or 'thecreating
utilise
orevencrossthetwo
languagesinsomeinstances.

Asanexample :inGk.AGGELIA(53)
'message','andinHebrewNBA(53)'prophesy' .
Utilisingsuchatechniquecanbe very usefulinverifying
withdifferent
translationsfthebiblemisunderstandingofawordorarrange-
mentofasentencehaseasilyknockedoutthesubtletyofmeaning
therein .
workingwiththe .broadspectrumoftechniques
whichGematriacontains,itcanbe very handyconstruct
variousnumericaltablesforuse,suchasthelistofnumbers
fromtheosophicaladditiongivenearlier .Onepossibilityisto
graduallyassembleadictionaryofnumbers,relatingtoeachwhat
itbreaksdown,addsormultipliesto,alsowhetheritisaprime
numberordivisibleby3,4,5etc . . .Enjoyyourself!
1
1
a
f
L
M
r
LESSON FIVE
NOTARIQON
L5/pg1
I
Notariqonisthesecondofthreeprimarymethodsofthe

LiteralKabbalahcoveredhere .Itsoriginsareexpressedwell
enoughintherootoftheword,whichistheLatin"notaries",
meaningshorthandwriter .Itisamethodcomprisedoftwobasic
forms,whicharetheexactoppositetoeachother .Theideaisto
takeawordandformasentencefromitutilisingeachletteras
thefirstineachwordofthatsentence .Theopposingform
consistssimplyoftakingthefirstletterfromeachwordina
sentenceandfromtheselettersconstructing a wordwhichis
interpretedasakeysynthesisofthesentencemeaning,orthe
containerofamysterytobeunravelled .
thesetwotechniquesbackontoeachother,onebeingthemeans
ofaccesstotheother .
HerearesomeexamplesofHirachyb(theHebrewwordHRChYB -
'toexpand'),largelyderivedfromMcGregorMathers'excellent
introductiontothe'QabalahUnveiled' .StartingwithBRAShYTh
(Berashith,thefirstwordofGenesis)everyletterofit is made
theinitialofaword,andsoweobtainBRAShYThRAHALHYM
ShYQBLVYShRALThVRH,readas"Berashith,fiahiElohim
SheyequebeloIsraelTorah" ; InEnglish :"InthebeginningEl~ohim
sawthatIsraelwouldaccepttheLaw ."
Itiseasytoseehow
Inthis connectionsome more very interesting specimensof
L5/pg
Notariqon are formed from this same word BRAShYTh, as given by
SolomonMeir Ben Moses, a Jewish Kabbalist who embraced the
Christian faith in1665 and took thename of ProsperRugere .
These all have a Christian tendencyand by their means Prosper
Rugere converted another Jew, who hadpreviouslybeenbitterly
opposedtoChristianity.ThefirstisBNRVChABShLVShThMYChD
ThMYM - "Ben,Ruach,AB,ShaloshethemYechadThaubodo",tran-
slatedas"TheSon,thespirit,theFather,yeshallequally
worshiptheirTrinity" .Next,BKVRYRAShVNYAShRShMVYShVO
ThOBVDV - "BekoriRashuniAsherShamoYeshuahThaubodo",tran-
slatedas"Yeshallworshipmyfirst-born,Myfirst,Whosename
is Jesus. Thirdly, BBVA RBN AShR ShMV YShVO ThOBVDV- "Beboa
RabbanAsherShamoYeshuahThaubodo",translatedas"Whenthe
Master shallcomeWhoseNameisJesusyshallworship" .
Fourthly,BThVLHRAVYHABChRShThLDYShVO ThAShRVH-"Bethulh
RaviahAbacharShethaledYeshuahThashroah",translatedas "I
willchooseavirginworthytobringforthJesus,andyeshall
callherblessed.

Andfifthly,BOVGThRTzPYMASThThRSh6VPY
YShVOThAKLV "BeaugothRatzephimAsattarShegopiYeshuah
Thakelo",andtranslatedas"Iwillhidemyselfincake(baked
with)coals,foryeshalleatJesus,MyBody" .TheKabbalistic
importance

fthesesentencesasbearingonthedoctrines
Christianitycanhardlybeover-rated .
InworkingwithmoreofaKabbalisticthemegivenbeloware
twomoreexamplesofwhatcanbederivedfromBRAShYTh,followed
bymoreexamplesderivedfromotherwords .
1
1
r
t
1
L5/pg
BL RVCh AShYN ShChR YM ThBL - "Bel Ruach Ashin Shacher
Thebal",translated as "The Lord with Spirit laid foundations
Ilavidah Thavidoh", translated as "Created he them a Womb
Light in Two for the birth of consciousness ."
for
thedaybreaktocomeupontheSeaandgreettheWorld" .

BRAM
RChMAVRShThYYMYLVDHThVDAaH - "BramRachimAvarShathyim
of
Turningtothetitleofthe6thSephiraThPARTh,or
Tiphareth,wehave:ThChYYHPAaMALYMRBHThChVLH - "Thachiiah
PornAlimRibahThichavilah",whichis"InthisRebirththeheart-
beattunestotheGods,thusgrowgreatinthetimeofcoming
intoforce" .

AsecondexampleofTipharethturnsfromamicro-
cosmictomoremacrocosmicdomainasin :ThVKYVThPZASVKRYNH
ThAaLVMH

"HevakivathPazAsivakiRinahTholivamah",whichis
"AllinnernatureisGold,aCupaboundingwiththemusicof
Mysteries" .
movenowtotheHebrewwordforthePillarswhichis
I
AaMDVM, orOmadivem.

Somepossiblederivationsare :

AaRYGH
MBVKHDMYVSThMThNGD- "OrigahMabvikahDemyVasithMethinaged",
meaning "A yearningfromconfusionfoundrest in aregulatorf
allcontrary" .SecondlythereisAaRBMQVHDRKVDAVThMAZNYYM -
"OrbMiqevahDerekVedavithMazniym",whichequateswith"The
MixturefromtheFountainofLivingWatersknowthePathbythe
certaintyofbalance" .AthirdexampleofAaMDVMisAaShRThMRKZ
DVMY

VMThQBLMOBYL - "OshirathMerkez

Divemi

vemithqabal
Miqebil", which is"Inagroupof
withbothActiveand'Passive" .
Tenthecentreknew quietness
Israel ; andthere was the Cloud and the darkness,
L5/pg 4
Weshallnow examinethepossibilities ofthismethodin
exploringanumeral .Inthisinstancewewillchoosethenumber
sevenwhichinHebrewisShBAaH(Shiboh) .Shibohisoftenspelt
withoutan'H'butweshallincludethis letterin ourexampleto
facilitateafullexpansionofmeaning .Firstly,ShGYABRAShYTh
AaVNHHMVTzYA - "ShigyaBerashithOvenahHemvatzya",translated
as"TheseexaltedintheBeginningoftheseasonsoftheBringing
ForthOne" .ThesecondexampleisShBAaThYYMBRAMAaVMOHShLYM -
"ShibothiimBramOvamiqHashalim",whichis"SevenfoldHecreated
themuntoprofounddepthandin perfection" .

I
Proceeding on to another.areaoftheOldTestamentwe will
examineExodus,ChXIVVerse20.TheEnglishtranslationofthis
verseis"Andit came betweentheCampofEgyptandtheCamp
yetgaveit
lightbynight,andtheonecamenotneartheother all night" .
IthasbeenconsideredthatwithHebrewtextorwriting,the
firstwordofitsfirstsentence(sometimesthesentenceitself)
isthetitlethereof,byvirtueofitsdescriptivecapacity.
clearinstanceofthisisBRAShYThoftheOldTestament
. The
firstwordoftheabove verse, VYBA(Vibah),whichistranslated
as"Anditcame"expandsto
:VGVMRYYChVDYVThBLAaMALHYM -
"VagivimarYichevedivathBlomElohim",whichis"Andso,onto
theendexclusivenessmadeastrangerofElohim" ; second
exampleisVHKNYHVHBMHAVPN - "VibakinYehovahBimahAvipen",
whichis"AccordinglyYehovahformedthecloudfortheWay"
; and
thirdly,VAaDYRDBR.-AALVHY - "VodIradBra A iviby",or"An
J
41
11
1
1
1
M
Assembling came downand created within the Divine" .
These examples shouldbe quite satisfactory in indicating
the essential process in Hirachyb, again these are only really
practical in partnership with clear discrimination .Meditation
on the results such as those above is also invaluable in yielding
inner content which adds refinement to your technique.
L5/pg 5
Using' the BQYTzR (fromthe Hebrew Beqitzar meaning
abridge") method of Notariqon on ChKMA NSThRH "Chokmah
Nesethrah" whichmeans "the secret wisdom", take the initials of
these two words, Ch and N we form the wordChN -"Chen"meaning
"Grace" .ThesamemethodcanalsoapplywithHRYARRT - "Heri
Ararat"or"TheMountainofArarat" .Thetwofirstlettersof
thesewordsmakeupHA- "Hah"whichis"Behold!" .Clearlynot
allsentencesorphrasesreducedinthiswayyieldactualwords,
onepossiblewayoftacklingthisistoreverseorrearrangethe
lettersderived .AnexampleofthisisRVChALHYM - "Ruach
Elohim","theSpiritofGod" .Thereisnosuchwordas'RAin
Hebrew,butAR(Ar)existswiththemeaningof"Light",orasa
rootword"tflow" .Also:MShVShKLHARTz - "MeshaveshKel
Haretz",whichmeans"thejoyofthewholeEarthFromthisone
canformulatethewordMKH(Mikah)thoughitsmeaning(abeating,
striking)ismoreofanexampleofanantithesisturningup .A
rearrangementofthelettersgetsaroundthisandprovidesKMH
"Kemeh"whichtranslatesas"Warm,friendly,heat
Anotherinstanceofaphrasereducedtocontain
"to
itsown
description is OVLShVPR - "Oivel Shaviper", "the Voice of the
Trumpet", it's two initialletters spellingOSh -"Qesh"meaning
"gathertogether" .ThevariousnamesofGodhavemanyunderlying
meanings .Takingthefollowingsentenceasanexample :AChD
RAShAChDVThVRAShYYHVDVThVThMVRThVAChD - "AchadRash
AchadivathevRashYihavadivathivThemavirithavAchad"whichis
"OneisHisBeginning ; OneisHisIndividuality; HisPermutation
One" .ThisyieldsfromtheinitialletterofeachwordARARYTA
-
"Ararita",oneoftheprinciplenamesoftheDivineOne .
AnothervariationwithinBeqitzar
lies inusingtheletter
endingeachwordtoconstructanewword,orusingthe
letterofthewords .Furthercombinationsofthefirst,last,or
middlelettercanbeassembledwiththeonlyprovisobeingthat
oneisconsistentinwhateverpatternisusedtochooseand
arrangethe letters .Considertheseexamples :
VYAMRALHYM - "VyamarElohim","AndGodsaid" (Gen .I,3.) ;
thefinallettersspellRM - "Rem"or"High,Lofty" .

HRTVB -
"HarTiveb",whichmeans"GoodlyMountain" (E :: .III,25.) is
deredRB"Rab" - "tostrive" .

Workingwithmiddleletters,we
havefromSBADSBYN - "SibaDasbin",whichis"TheAncientamong
theancient",thewordBB
-"Beb",meaning
"Paq' ,
awordmeaning"stumblingblock" .
"a
LS/pg 6
middle
ren-
vein" .FromShPTh
ShOR -
"ShepethShiqar",meaning"thelipoftheliar"comesPQ
-
Withphrasescontainingevenlyletteredwords,thesolution
issimplytomakeuseofthetwonearest
thecentre.

Using
1
44
1
1
1
deriveBAaMY,thoughit isnot a word in itself, as AaM BY - "0m
Bih", it translates as "by bringing together attend to
letters from each word,
L5/pi 7
ShBAaTh YMYM - "Sheboth Imim", which is "the seventh day", we
self ",
relatingwelltoaspectsofthesabbath .

Whencombiningseveral
suchasChBLYLYDH - "ChebeliLidah"
meaning"thepangsofchildbirth",fromwhich wetakethefirst
andlastlettersandassembletheword LChYH - "Lechyh", trans-
latedas"stronguntoliving" .
complete thissectionontheBeqitzarmethod of
Notariqon,wewillreturntoVerse20ofthe14thChapter
Exodus.WorkingfromitsHebrewform :VYBABYNMChNHMTzRYM
VBYNMChNHYShRAL; VYHYHAaNNVHChTzK,VYARAThYHLYLH,VLAYQRBZH
ALYZHBLYHLYLH-wecanderive,usingthebasictechniqueof
extractingfirstletters :VBMM VM Y VH VVAV ZAB.
ThefirstsentenceoftheVersereads :"Anditcamebetween
thecampofEgyptandthecampof Israel ; its initials(ofthe
firstsevenwords)provideuswithMVMBVYM- "MevMebavim",
translatedas"theverystaging . . ." .Thesecondsentence is :
"andtherewastheCloudandthedarkness",thelettersderived
beingVHV.TheserearrangedproduceHVV - "Hivav",whichis"for
thelinkingtogether" .Thethirdsentenceis"yetitgavelight
bynight",theaccompanyinginitialsbeingVandA .Herewehave
thewordAV -"Av",whichis"eitherwith"(sometimesalsomean-
ing"desire") .Thelastsentenceis :"andtheone came notnear
theotherallnight",itslettersareVZAB
.Therearetwoposs-
ible interpretationsofthese,thefirstisZBAB - "ZebAvi",
1
1
41
1
I
M
1
1
t
L5/p g B
which is Hebrewfor"flowor",andthesecondisABZV - "Ab
Ziv", translated as "The Father or this" .
Joinihgthesederivativestogetheryields"Theverystaging
forthelinkingtogethereitherwiththeflow or . . .", oralterna-
tively"Theverystagingforthelinkingtogethereitherwiththe
Fatherorthis" .

Bothareequallyvalid,dependingonhowthey
areread ; theyarealsoclearlyunfinishedinkeepingwiththe
verseitselfnotcontainingthewholepicture .

Forfurther
clarification,youcould either utilise other methodsmentioned,
such as working out a complementarysentencefromthemiddleor
lastletters,orobtainfromagoodHebrewBibletheaccompanying
verses,andexperimentwiththem .
mentwithVYAMRALHYMYHYAVR,translatedas"AndtheGodssaid,
lettherebeLight" .
Youmayalsoliketoexperi-
I
r
r
LESSON6
TEMURAH
Temur ah (the per mutation of letter s) is the thir d ar ea of
L6/pg1
theLiter alKabbalahtobecover ed,completingatr iadofmethods
developedfor unveilingtheinner natur eofKabbalistic
knowledge .Thewor dTemur ahitselfisHebr ewandspeltThMVRH,
whichtr anslatesas'per mutation,apposition,exchange' .Applying
Gematr iatoitwehave651,ofthatsamenumer ationisNAM(f)
whichmeans'asser tor pr o-nouncesolemnly' ;ther eisalsothe
Gr eekwor dEPI STEME,meaning'insight,science' .
Br eakingdown651byTheosophicr eduction12isder ived,
indicatingthebr oadestspectr umofknowledgesuchaswiththe
spher eoftheZodiac .Tur ningagaintoaHebr ewlexiconwefind
ChDwhichtr anslatesas'tpenetr ate',emphasisingTemur ahasa
meansofaccessintosomething .Bymultiplication651comesto
30(6x5x1)thevalueoftheHebr ewletter Lamed,whichisattr i-
butedtotheJusticecar doftheTar ot .Thisisanalogoustothe
twofoldstr uctur eandbalanceinthemethodofTemur ah,whichin
essenceconsistsoffoldingthealphabetinhalfaccor dingto
cer tainr ules.Thennewwor dsar eder ivedtowor kwithther efr om,
byswappingeachletter withitscounter par taboveor below .
Tobeginwithwewillwor kfr omthefir stletter ar r angement
ofasetof22,whichar ecalledthe'TableoftheCombinations
ofTzYRVP(Tzir uph) .Thisar r angementiscalledALBTh(Albath),
thenameasyouwillseeisfor medfr omthe
1 .
M
T Ch
entr y,andtheElementof
Q R
L6/pg
letter stother ight .
B
ShTh
infor mationonthemeaningofAlbathfor analysingits
Befor epr ovidingexamplesfr omthis,her eissomebackgr ound
der iva-
tions .Tobeginwithther ear ethegener alideasakin

the
monad(valueassociatedtotheAlbathtable),pointofor iginor
Air .UtilisingGematr ia,thenumer ation
ALBThis433,equatingwiththewor dZKVThmeaning'pur ity,
innocence' .ALBThcanalsobebr okendowntother ootwor dsofAL
meaning'tointer vene'(alsoaDivineName),plusBThmeaning '
passthenight' .Thesesuggesttheconceptofdivineinter ven-
tionwithinthedar knessasapathtolightisfor ged,r efer also
tothear chetypeoftheEgyptianSunGodRa .Fur ther ,thenumer a-
tionofAL(31)isthatofVYHY -'andther ewas',thiswhenadded
toBQSh - 'soughtintoor after ',whichhasthesamenumer ation
asBTh,yieldstheideaofmovementatthebeginningofacycle .
Alloftheselinesofthought,whencondensedandconsider ed
together ,pr ovideabr oadbutdefinitekeyconceptfor inter pr e-
tationofwor dsder ived .
anexample,thewor dRAShmeaning'thehead'tr anslates
intoDLG,whichmeans'leapfor war dly' .
descr ibesthe'upfr ont'natur eoftheheadsummedupbybeing
associatedtothezodiacsignAr ies ;fr omanother appr oachit
r efer stotheconsciousness,wher eactionsbeginasideasand
Withoneappr oachthis
1
I
M
1
Lb/pg
inspir ations .Fr omahigher per spectiveonecouldinter pr et'the
head'astheDivineOne,with'leapfor war dly'descr ibingthe
initialspar kor movementinacycle .
Takefor another examplethewor dChPHmeaning'cover over ',
viaAlbathAaZQisder ived,awor dtr anslated as 'fencear ound' .
Clear lyther eisadir ectassociationbetweenthesetwo,butin
or der toexpandittoitsfullestthekeyconceptofthetable
usedmustbeinter posed .'Cover over 'couldbeanalysedasdar k-
nessspr eading,with'fencear ound'theDivineLightmoving
binditwithinalimitedspher e .Fr omamor edowntoear thview-
point,thefir stwor dsignifiestheinitialcover ingof
withsoil,withtheder ivedwor dsignifyingthenextstepof
pr epar ingdefencesfor thatgr owth .
Another meaningofAaZQis'r ing'(thekindwor nonafinger ) .
Thisleadstoaninter pr etationinlightofthemar r iagecer emony
andthecyclesofgr owthwhichitbegins,'cover over 'a
r efer encetothepr otectiongainedthr oughthatunionandwithin
thehomeestablished .
ThesecondtableisnamedABGTh(Abgath),adir ectcontinua-
tionofAlbathwiththeexceptionofLamedbeingr etur nedto
usualplaceintheletter sequence .ThisisthetableofAbgath :
2 .
T

ChZ

a
M N S

Aa

Tz a ShTh
seeds
its
The key concept to be used with this begins with the dyad and
idea of dividing into two, dr aw your impr essionsofthesefr om
theSephir aChokmahandnatur eoftheplanetMer cur y
.Gematr ia
appliedtoABGThyields406towor kwith,fthatvalueisthe
wor dGRGRmeaning'neckar eawher ethebr eathflows' ;inflowand
outflowcomestomindalongwithconsider ationofthepointwher e
thesetwoar einbalancedmotion .
ByTheosophicr eduction406br eaksdownto10,thenumber of
ZG 'jointogether '
.Thismethodbeingar efer encetothekey
meaning abasiclevel,itlinksfundamentallytheideaof
'jointogether 'withtheaboveconceptofdividinginto
Thusitismadeclear thatunitinganddividingar e
associationinmeaning,
natur eofthetr adeor tr ader .
yetstilltheessenceofthematter
L6/pg4
evennessor justicecomesacr ossstr onglydeter mining
opposite
sides ofthesamecoin ;bothar eofsignificanceher e .ABGTh
pr ovidestwor ootwor ds,AB - 'father 'andGTh - 'actionsin
pr epar ingfood',thesesuggestingthepater nalandmater nal .
OnnowtosomeexamplesusingAlbath .Thewor dMNHmeaning
'distr ibuteconsistently'becomesLKR,whichisinthatfor mno
knownwor d .Ther emaybeasolutioninadiffer entar r angement
ofthesameletter sthough,inthiscasether etur nsupRKL - 'to
tr ade,mer chandiser ' .Againwehavetwoter mswithadir ect
is
untapped.ThekeyconceptofAbgathisclose

'distr ibute
consistently'inpar t,hintingatanundistor tedflow ;theidea
the
Ultimatelyther eissuggestedtte
valueofbalancingactionsindealingwith All, ther ebyclear ing
1
t
r
41
1
t
I
M
1
1
r
the way for the Univer sal Flow.
in
L6/pg 5
Her e ar e some r oot wor ds for you to examine via Abgath,
caseyou'r ewithoutanappr opr iatelexicon,theder ivativeshave
alsobeenincluded .
ChKL - 'r esplendent,ar edshine',

whichconver tsto:
PNM(F)-'within,oftheinter ior ' .
PAR - 'tobeautify,anador nment',

whichconver tsto:
ChBH - 'hiding,asecr etplace' .
RAM - 'elevatedexalted',

whichconver tsto:
HBL- 'r eleaseavapour ,evapor ate' .
N~r nr ^r ti
Thethir dtablehasthetitleofAGDTh(Agdath),itskey
conceptisbasedonthetr iadandexpansionintofor mor ar ea .
Anyexpr essionofthetr inityisr elativetoit,aswellasthe
natur eofLunatheplanet .Thenumer icalvalueofAGDThis408,
thesameasChShQ - 'connect,likespokesofawheel',andQShCh
'har den,evenwithanintensity' .Theseindicatetheconfir ma-
tionofadefinitefor m,inessenceaver ysur estep .Ther oot
wor dsder ivedfr omAGDThar e`GA - 'pr oud'andDTh - 'law,edict' .
Sodescr ibedisthesur enessofthetr inity,itbeingthetr uest
pointofjudgementor issuingfor thofDivineLaw .
Thisisthetableofflgdath :
3.
Using the table ofAgdath we can take the wor d GAaL
'r eject theseed' and der ive AYN

'non-existent' . Developed fr om
these comes the idea of the unmanifest str iving for existence,
but without a balanced union (sper m & ova, etc)with the Divine
spar k pr esent it is notexcepted . I n amuch mor e gener al context
these explain how nothing comes fr omnothingshowing (in tr iune
for m) that 0+0=0, or 1+0=0.
Natur ally not all conver sions will for m wor ds dir ectly .
a sense it is poetic licencewhichr emovesthatdifficulty
.
ar r angement
.Hencewelookfor twoor mor ewor dsinit
'essence,
M

L
B

AaP

Tz0
K T

ChZ

V
R Sh
L6/pg6
Th
A
For
instancether eisYShVAaH - 'help,salvation',byAgdathit
becomesAaHRYSh

withtheletter sfor mingnoknownwor dinany


tur ning
asoneexampleRAaH -
'feedupon,nour ish'plusYSh
being' .

Ther efer enceisclear lytothecor e


nour ishment,whenexpr essedthr oughthekeyconcept,thepur est
andtr uestflowofener gycomestolightasfoodfor thesoul
.
Fur ther r efer encestothehar monyinYShVAaHar econtained
initsconver sionhavingthesameletter s,exceptingthecentr e
one,apointofbalance
.Ther eisaswellthethr eewor dsfor ming
atr iad,withthequantityoftheir letter sbing1
.0;br eaking
thatnumber downwehaveiastheunity,plus0astheessence,
unityandhar mony .
y
S
r
Thetitleofthefour thtableisADBG,whichhasasabasisfor
its key concept : the squar e, matter changing, movement in time,
pater nalor ientationandtheanima,alongwiththechar acter of
theplanetVenus .Thetitleitselfhasanumer ationof10,
sameasGZ - 'r emovefr om',
stateor locale .I nmakinguse'ofTheosophicaddition 10 becomes
55,thevalueofKLH - 'thebr ide',asinameansofcr eating
changethr oughanewlyfor medgr owthcentr e .
ADBGar eAD - 'emanationofmist,vapour 'andBEG

'meat,f
Theseintimateabackgr oundofsubtleaffectation,alongwith
tr ansmutationfor gr owth .
C
J .
N M
K
AaP Tz
Tz
a
wr tin,Ar h
Following ar e ther emainingnineteentablesoftheCombina-
tionsofTzir uph .Witheachisabr eakdownofitsnameusing
Gematr ia,alongwithother infor mationr elevanttothekeycon-
ceptsassociatedtothem .
4 .
Ch
i .e .movementawayfr oma'pr evious
z
tititititi
T

Ch
Sh
ShTh
Lb/pg7
Th
V
the
Ther ootwor dsin
D H
signify the four Elements and Spir it . AHBD has anumer ation
12, equating itwith DGH - 'to multiply' and ChD - 'to pene-
tr ate', solidifying the concept of theDivine
matter with the essenceofgr owth .

Ther ootwor dsar eAH


'under lying,potentialwill'plusBD - 'singled,alone',i .e .the
Divineutter ingmanyindividualspar ks,allimbuedwithapoten-
tialwilltolive .
6 .
M
titititi
K

Y
ShTh
Ch

A
H
ThesixthtableiscalledAVBH .I tskeyconceptisfounded
onthebasisof : focusingtoacentr alpoint,anhor izon
infinity(especiallyr ethemicr ocosm/mind),
par entalchar acter istics,andthefixedear thysignofTaur us .
Ther eisalsothehexagr am,twotr ianglesco-joinedwhich
theplanets,withtheSunatitscentr e .AVBHhasanumer ical
valueof14,thesameasHDH - 'str etchout'andGYA
L6/.pg-0
AHBD, the fifth table is defined by such ideas as : the Divine
making its fir st move with matter , plus mater nal or ientation and
the animus . The fier y sign of Ar ies (r uled by Mar s) is of signi-
ficance, along with thepentacle, a symbol of power usedto
enter inginto
asonpar takingof
signify
- 'r ising
gr ound' .

Theaboveideascanbeemphasisedfr omoneper spective


asanoutwar dexpansionmovingtowar dssomething .Ther ootwor ds
ofthetitlear eAV - 'desir einessence'andBH - 'complete or
i
41
M
I
L
7 .
NNNnr N
N

T
R

Sh Th 6

Z
The seventh table has a titleofAZBV.

Refer r edtoitar e
theideasof : dualmotion,
r ootwor dsofthetitlear eAZ - 'atthattime,
B.
T
S

M
ShTh
NNNN
L
L6/pg9
air y vacuum', show a backgr ound of the will to evolve in clear
space .
ChB

A
communicationbetweendiffer ent
r ealms,theor acleoftheGods,andtheair ysign Gemini .
Consider alsothemathmaticalnatur eofsevenasapr imenumber ,
aheptagonanddoubletr iadbalancedonacentr alor focalpoint .
AZBVitselfhasavalueof16,withitbeingsuchanextr emely
divisiblenumber ,whenassociatedwithseventheideaof'two
totallydiffer entnatur eslinked'ar ises .Ofthevalueof16
ther eisGBVH-'elevated,high'andZVG -'like,equalto' .
Thesebackuptheconceptofassociationbetweendiffer ent
r ealms,descr ibingespeciallywhatisconducivetocontact .The
'communicatedto,contagion',r elatingasunder lyingfactor sthe
pointandpr ocessofcontact .
D
T
H

V
then'plusBV
Ch
ShTh G H

Ch
L6/pg10
The title of theeighthtableisAChBZ,basictoitskey
conceptar eideasof : flexibility,changeinstability,lower
r easonbutwithahigher link,andthenatur eoftheogdoad ;the
water ysignofCancer expr essesitastr ologically .AChBZhas
numer ationof18,equatingitwithChY -'living'whichintimates
thecyclesoflife ;withTheosophicaddition18=171,thevalueof
NATzL - 'emanatingfr om' .Thisexpandstheconceptoffluctuation
thr oughthemovementsofhigher ener giesor for ms,

typeof
flexibility,theopeningofwhichallowseaseofr eactionbythe
lower .Ther ootwor dsar eACh - 'equilibr ium'(oneofanumber of
meaningsgiven)plusBZ - 'spoil,plunder ' .Sothebackgr ound
expr essestwoextr emes,linkedbyacycleboundupwithlife .
Ar ^r titi
9 .
AaS

Y
TheninthtableiscalledATBCh .I tskeyconceptisbased
ar ound : theennead(aninesidedfigur e,consider thr eetr iangles
inter wovenwithinacir cle),stabilityinchange,consistentin-
ter action,alongwiththefixedandfier ysignofLeo .Movingon
totheGematr iaofthetitle,itsvalueis20suggestingfir stof
allalinkwiththesecondtable(r efer tothenumer icsofthe
AiqBekar system,cover edlater inthislectur e) .Withacompar a-
tivevalueof0isChZH - 'settled,fixedintoplace',
Theosophicadditionappliedtoitpr oduces210,thatofHRH
r
t
t
M
t
r
- 'toincline(postur e)'plusChB - 'beobligedtpaymentor
punishment', i .e .
under lyingisacknowledgementoftheDivinein
allowingsuchpur ityofmovement,
thatb .
ft,tititi
10.
P

K
Sh Th
ThetenthtablehasatitleofAYBT,for itskeyconcept
associateideasof
: completionpointatopofsteadycontinuance,
summar yoftheouter for m,thedecadandtheear thysignof
Vir go
.AYBThasanumer icalvalueof22,linkingitsmeaningwith
thestr uctur eofanentir ecycleandsuggestingpossiblyan
openingintosuchwholeness .Wor dswithanumer ationof22ar e
ZVVG -
'thestateofpuber ty'andYChD - 'uniteintoone',with
fur ther clar ificationthr oughTheosophicadditionwher ein22=253,
thevalueofNGR-'bespr eadout' .Thesebr ingtomindthetenth
Sephir aMalkuth,themater ialspher ewher ehigher for cesand
for msar eintegr atedintoaction
.Ther ootwor dsofAYBTar eAY
- 'settle,takeuponeshabitation'plusBT - 'spar kling,mur mur -
ing',thusthebackgr oundisthatofsolidness,withbothlively
andpassiveemanationsoflifesfor ces .
Lb/pg11
'swell, r ise in height', making clear the incr eased potential
gr owth when change is stabilised . The r oot wor ds of ATBCh ar eAT
for
andr espectpaidtothefor ces
T z Ch
11 .
12.
Sh Th
Sh
Th
Q

L
G
0
D
Tz
H
P
o%,ti-%, ti
Aa
Z
Ch
Ch
based on ideas of :

br eakingaway to an
T
L6/pg
Y
The eleventh tablehasatitleofAKBY,itskeyconceptis
inter naldir ection,
dir ectivefor tunes,andthenatur eoftheplanetassociated
theWheelofFor tune,Jupiter .
33,linkingittothewor dsBLA - 'todestr oy'andGL
'spr ing,fountain',expandingonthenotionofr emovingpastand
exter nallimitations,soastor eleaseinner flows .

Ther oot
wor dsofAKBYar eAK - 'cer tainly,compacting'plusBY - 'attend
self',descr ibingabackgr oundofkar micpr essur es,wor king
thr oughopeningscr eatedbyinwar dattention .
M

A
K
Thetitlehasanumer icalvalue
ThetwelfthtableiscalledALBK(f),andisbasedonideas
of : connectingor linkingtogether ,thewholenessofacycleand
itsintegr atedfunctioning,plustheair ysignofLibr a .With
ALBK(f)havingafinal,twodiffer entnumer icalvaluescanbe
attr ibutedtoit,533&53.Asnowor dsavailfor 533Theosophic
r eductionshallbeutilised,yielding11andthewor dChG -
'cir cular ityofmotionor for m' .Withthevalueof53(also
pr ovidingmor eofanon-specificmeaning)isNG-'r eflectedlight
or ener gy' ; theser elate tothecosmicinter actioninsuchfunc-
1
y
t
1
1
r
r
Ther ootwor dsar eAL
subject)'andBK(f) - 'contr actionintoflow',
factor s ener gyactedon,tor esolveitintoitsstr angest
for m .Notealsothepar tsimilar itybetweenthetitlesofthe
fir standtwelfthtables,alongwithlinksbetweentheir
meanings .
N..NtiN
13.
ThSh

N
basedonideasof
14.
6

V
D

H V Z
Z
7
Ch T

K
L6/pg1 35
tioning, with the consistencyther einofthequalityofpur ity .
inter vene(for pr otection
henceunder lying
M
Thethir teenthtableiscalledAMBL .

I tskeyconceptis
unityandloveor devotionemphasisedwith
stabilityasabackgr ound,alongwiththeelementofWater r elat-
ingtothesoulor emotion .Thetitlehasavalueof73,linking
itwithChKMH - 'theWiseOne(Chokmah,thesecondSephir a)'and
ChSH - 'tr ustin,shelter in',suggestingthecontextofpr otec-
tionwithintheauspicesofaunified,beneficientsoul
hti^r hti
Th

P
.Ch T

Y K
B

A
L

N
or
centr e .Ther ootwor dsofAMBLar eAM(f) - 'suppor t,sustain,
confir m'plusBL - 'tomix,mingle',i .e .abackgr oundofposi-
tiveinter actionfor gr owth .
L6/pg 14
The four teenth path has a titleofANBM(f) .I tskeyconceptis
basedon : for ceappliedintr ansfor mation,effor tofselfor
beingutilisedthr oughthought,andthefixedwater ysignof
Scor pio,r uledbyMar s .ANBM(f)isanother titlewithtwo
values,653and93,thefir sttur nsupnothingfr omthelexicon,
soviamultiplication90isder ivedtowor kwith,thevalueofSL
I
- 'r aise,exalt',thesecondtur nsupSGL - 'makeonesown' .
Theser efer totheunder takingofaper sonalpr ojectfor gr owth,
tr ansfor mingwithanindividualcentr easbase .Ther ootwor ds
ar eAN(f) - 'tolabour (bodyor mind)'plusBM(f) - 'themost
sacr ed,elevatedthr oughunionofinner &outer ,positiveand
negative,etc .,essentiallymeansandend .
N.NNnr
15.
D

ThSh

Tz

A
H

Ch T Y

K
for minganewindividualbeingor str uctur e
L S
ThefifteenthtableisnamedASBN(f),itskeyconceptis
center edar ound : r elatingunity(suchasmaleandfemale,etc)in
alongwiththefier y
signofSagittar ius .Ofthe'twovaluesder ivedfr omthetitle
763&113,thefir stthr oughTheosophicr eductionequals16, the
numer ationofChZA - 'behold,focuson',thesecondpr ovidesPLI G
- 'str eam,br ook' .Theseemphasiseattentiontoapointofsigni-
ficance,aswellaslesser flows - theor iginatingsour ce
lar ger movements .Ofther ootwor dsther eisAS - 'basis'plus
1
1
1
46
t
M
1
V Ch T

Y M N
The sixteenth table is titled AAaBS, with a key concept der ived
fr om ideasof : r enovating the foundation ar ea for the s ke of
pr ogr ess, fur ther establishing the str ength of a position,
the ear thy sign of Capr icor n . The titlehasavalueof133,
linkingits,meaningtoGPN(f) - 'vine',plusbymultiplication
ofthatvaluethenumber 9andthewor dGAH - 'becamepower ful,
gr ewhigh' .Bothar estr aightfor war denoughtoassociatetothe
key,'vine'suggestingthewellmanageduseofsur r oundingfor ms .
Ther ootwor dsextr actedfr omAAaBSar eAAa - 'wood'andBS -
'tr eadunder -foot',henceabackgr oundtothisconceptofnatur al
substancesusedr esolutely .
17 .
V

Th Sh

Tz
Z

Ch

K M N

S
L6/pg15
BN(f) - 'divide, cr eate distinction', descr ibing a backgr ound of
the or igin and the separ atingfr om that as par t f fur ther
gr owth .
Nnr ^r nr N
16 .
H

Th Sh
P
and
Theseventeenthtablei stitledAPBAa, withitskey-concept
18 .
Ch T
titi .ft,
G

ThShR

B
L

AaP
knownwor d,theletter meaningswillber ever tedto .
L6/pg16
der ived fr om ideasa excitedmovementexpr essed,anar oused
spher e,withthemostener geticoftheplanets,Mar s .Thenumer -
ationofAPBAais153,thesameasPGAa - 'meetwith,appr oach' ;
bymultiplication15becomesappar entpr ovidingZCh - 'hewho
impels,tfor ce' .Theseindicatediffer entfor cesor beings
comingintocontact,withonedominatingor exer tingitswill
over theother .Connectedwiththeaboveideas,allofthis
occur swithinadefinedspher eofaction .Ther ootwor dsar e
AP(f) 'meanstoanend'plusBAa - 'har sher ,basemovement',
indicatingadefinitebutlower pur posetowhatisbeingdone .
Tz
TheeighteenthtableistitledATzBP,theideasaccompanying
itar e : expansiontonatur alvisionofcosmos,higher visionsor
lear ningscommunicated,motivationofbeingor for cetobecome
familiar withsomething,alongwiththefixed air y signof
Aquar ius .Thefir stofthetwovaluesofATzBP(f) - 893.,by
multiplicationbecomes216,thatofDBYR - 'or acle',thesecond
is 173,whichtur nsupGLAaYNY - 'lightenmineeyes',expr essing
asour ceofwisdomanditsr esult .Ther ootwor dsar eAT_ 'to
ur ge,hasten'andBP(f) - withtheseletter snotfor mingany
Associated
Bethis'house'andtoPeh'mouth',theover allbackgr ound
pictur ethatofasour ceofgr owththr oughcommunication,
1
r
1
1
r
motivated by a higher entity or for ce .
titititi~
19 .
Ch

V
20.
T

L
The nineteenth table has atitle of .AQBTz(f) . The ideas
for ming its key concept ar e : sensitive inter action, the pr ocess
of full identificationwithanother objector entity,andthe
water ysignofPisces .ThetwovaluesofAQBTz(f)ar e1003&193,
thefir stisthatofGRP(f) - 'wr apor r olltogether ',thesecond
pr ovidesnowor dstoassociate,soTheosophicr eductionisused
G Th Sh
toyieldawor kablefigur e - thatof15and
L6/pg17
B
fr omitZBD - 'to
endowwith' .Sowehavesomethingexter nalpr ovidingfor
unifyingoftwo(or possiblymor e)entitiesor objects,withthe
intimationofaspecialcapabilitygifted,asanecessitytosuch
aninter minglingoccur r ing .Ther ootwor dsar eAQ - 'empty,
lacking' plus BTz(f) ofasoftbody' t thusasunder lying
factor sar eavacuumfor theinflownecessar y,andr eceptivity
thr oughbeingpliable,or beingabletocausethatinanother .
tititititi
ChZ

G
K

Aa

R
Th Sh B

A
the
The twentiethtableistitled1fBQ,theideasfor mingits
cr eatingatitsor iginatingcentr ea
higher for ces . One could r efer these ideas to thoseofthesixth
tableofAVBH .
21 .
issue
T
for th .
Ch

Z
These
tititititi
H

D
K

P
vacuumwhichwouldattr act
Th
Lb/pgI S
key concept ar e: of a r adiant
flowoutwar dsfr omasour ce,self-
gener ationofener gy,alongwiththeplanetoftheSun
.Fur ther
this20isthevalueofYVD - Yod,theletter oftheFather
(asaKabbalisticr efer ence)
.ARMhasanumer icalvalueof303,
equatingitwithShAB - 'induceflowofwater ',ther eisalso
thr oughTheosophicr eductionthevalueof6,andfr omthat,GG -
'toexpand,dr awout'
.Thesecanbeinter pr etedinlightofWater
beingtheelementofthesoul(akintotheflowoflifeor Divine
essence),alongwithexpansionandextr actionr elatingtheener gy
for mationandmovement .Ther ootwor dsar eAR'toflow'plusBQ
-
'makeemptyor void',henceabackgr oundofanoutwar dflow,
B
Sh
Thetitleofthetwenty-fir sttableisAShBR .I tskey
conceptisfor medfr omideasof : ascendancyor downfallthr ough
sever etr ial,bur ninganditspur ification,judgementof,along
withtheelementofFir e .AShBRhasanumer icalvalue

0
associatingitwithGRSh - 'r eject,for ceout'andShGR - 'emit,
clear lyr elatetovar iousaspects of judge-
ment,aswellasthemovementoffir e(mor einahigher sense)in
actionplusthecleansingeffectofitsnatur e .Ther ootwor ds of
1
I
r
10
M
I
t
22 .
Y Ch
Aa
tititititi
D
ThetwentysecondandlasttableoftheCombinations
Tzir uphistitledAThBSh,anditskeyconceptis
L6/pg19
AShBR ar e ASh - 'fir e, wr ath'and BR - 'to clear ,pur ify', such
as the Gods in their most author itativer oll .
ShTh
intheHebr ewalphabetandPathsontheTr eeofLife,theidea
of
der ivedfr om
ideasof : oneextr emeasitwor ksinwiththeother ,limitations
encounter edintheouter par tofaspher e,andtheplanetof
Satur n .

Fur ther tothis,withtwentytwothenumber ofletter s


of
finalitycomesthr ough .Thenumer ationofAThBShis703,asso-
ciatingitwithABRK(f) - 'Father ofBlessings'andGN(f )
'defended,shielded',whichar er efer encestother ewar din(and
of)r eachingtheendofthepathway,alongwith an emphasison
defendingthewellbeing
theinner .

Ther ootwor dsofAThBShar eATh

'essence,
(the)'plusBSh - 'becomeweak,inactive,spir itless'basically
foundationofoneextr emeor theother ,attainmentor utter
failur e .
tititititi
Ther ear esever alother tablesuseful in ther ightcontext,
thefir stisinasensethemostbasicoftheTemur ahstr uctur es,
consisting

thealphabetfoldedexactlyinhalfwithnor e-
thepr otectivenatur eofouter r egions,
ar r angements . This is the table of ALBM(f) :
Y

Ch

G
Th

Sh

Tz
P Aa S

N
motion,and unfoldment- as with Kether to Chokmah .
element, applying its natur easthekeyconcept .Fir e-,
L6/pg2C)
M L
Thekeyconcepttousewithitisder ivedfr omideasof
:
exactr eflections,a
pair or positiveandnegativeinequal
Thetitlehas
twonumer icalvalues,633&73
;thefir standmor especific
thesepr ovidesGLM(f)-
'wr appeduptogether ,embr yo',thesecond
pr ovidesGML - 'r ecur r ing,positiver etr ibution' .73isalsothe
valueofAMBLwhichis
: thetitleofthethir teenthtable,hence
ther eisaconnectioninmeaningwiththat .TheGematr iaindi-
catesnewgr owthfor medbycyclicalimpr essions,or stimulatedby
helpfulinfluxes .Ther ootwor dsar eAL - 'tointer vene'plus
BM(f) - 'themostelevated,sacr ed - thr oughunion' .Soher ewe
haveabackgr oundofexter nalinvolvement,likelyfor ming
centr alpointfor manifesting,withtheDivinestagingthewhole
pr ocess .Ther efer enceisnotsomuchtounionoccur r ing,but
.unfoldmentthr oughunionr etr aced .
ALBM(f)couldber egar dedasthetableofSpir itRelativeto
the following four tables . These have a gener al application in
usage,eachoneassociatedtooneofthefour elements .Thesear e
applicablewhenonewishestoanalyseacer tainwor dor phr ase
(Beqitzar methodofNotar igonishelpfulinr educingasentence
or gr oupofwor dstoawor kablesize)inconsider ationofan
Water ,Air
I
46
t
M
I
B
L
A

G
Th R
H
Ch Y

H
R Th
wr ^r tihnr
This is MBSD, the table of Water :
L

Tz

Th Sh

S
Aa
T
K

Ch

D
nr ~r h~r N
This is ShBQD, thetable of Air :
L M
Sh P
Lb/pg 21
and Ear th have manyassociations esoter ically, all which
r elate back to a ver y simple cor e ofdefinition for each . One
significant association, based on the Four Wor lds of the Kabbalah,
attr ibutes to Fir e the Ar chetypal, to Water the Cr eative, to Air
the, For mative and to ear th the Mater ial . Add to these numer ous
other four fold str uctur es availing, concentr ating on those which
have been dir ectly linked to the Elements .
This is AMGS, the table of Fir e :
S M
P

Sh
Ch V

B
4 .

Sh
This isThBRD, the table of Ear th :
Q
H
..-%, -11%.-1
Aa Tz
Ch
L6/pg 22
GAaSh - 'shake, as in an ear thquake' becomes RZB,
Th
Her e ar e some examples, beginning with wor dsanalysed
thr oughAMGS,theWater table
.Tostar twith,ther eisAPS -
'fail,ceasetobe',whichisconver tedtoMGH,aslightr ear -
r angementofwhichpr ovidesGMH- 'for cesopposedto' .Especially
consider ingFir etobethemostintenseoftheElements,this
comesacr ossas : beingover whelmed,obliter atedor evenabsor bed
byastr onger opponentor for ce .ANChNV - 'sever alper sonspr e-
senttogether 'conver tstoMDTzDAa,whichyieldsthewor dsTzMD -
'jointogether ,einpair s'andAaD - 'beingbeyond,fur ther ,
beside'
.Soisdescr ibedagather ingor cer emonywhichisdevoted
totr anscendance,withactiver itualasitscor e .
UsingtheWater tableofMBSD,thewor dGBH
obelofty,
exalted'conver tstoNMAa-'
towithhold,r estr ain',intimating
theholdingbackofemotions,toallowthesoultor iseup
.GYA -
'r isinggr ound'isconver tedtoNShL - 'r emovedbyfor ce',sug-
gestingavolcanoanditsoutpour ings,or acompar ativeoccur -
r enceinother r ealms . - Thr oughtheAir tableofShBQDthewor d
nothingin
itselfbutasBZRmeaning'tdissipate'Thisdescr ibesener gyor
for cespr eadingwithoutr estr aintthr oughsolidmass,indicating
M
i
t
r
t
in GAaSh an extr emeflexibilityofmovement .Thr oughuse
ThBRD,theEar thtable,AaQSh - 'tper ver t'conver tstoChGA -
'tur naboutinter r or ',r elatingtothecor r uptionoffor minthe
senseofspir allingdownintothedar ksolidityoftheunder -
wor ld,agonythr oughapr ovokingofDiviner etr ibution .This
shouldmakeclear enoughyour useofthefour Elementsinstudy-
ingtextsKabbalistically,simplyr emember t

consider your
r esultscar efully,theanswer sgainedar eimpenetr abletosuper -
ficialviewing .
Ther ear eanumber ofesser methodsusedfor analysis,the
fir stisThShRQ(Thashr aq),whichsimplyinvolveswr itingawor d
backwar ds .Ther esultingwor d(ifitdoesactuallyexistasone)
canbeusedtostudyther eflectedor r ever seaspect,anexample
ofther eflectedliesinAaZ -'str engthor vigour ' ZAa -
'ar ouse,causetr embling',showingcauseandeffect .Anexample
ofther ever seaspectisTBAa -'tosinkinto',wr ittenbackwar ds
itbecomesAaBT - 'tur naside,diver t' .

Thashr aqcanalso
usedinconjunctionwithGematr iatoexpandonawor dsmeaning,
by wor kingwithachangeinitsnumer ationcausedby finals which
havebeenmoved .ThuswithFQCh(188),whenr ever seditbecomes
908,andsoisassociated

other wor dsofthatvalue .


Another methodsometimesofuseisTzaloh(TzLAa -'tobeor
tooneside),itconsistsofswappingeachletter ofawor d,or
onlyoneor sever al,withtheletter toitsleftor r ight,
go
the
alphabetbeingusedinitsnor malor der .Ther esultofthis
r elatestoouter aspectsofthewor dsmeaning,separ atefr omits
cor eessence .Her e ar eafewexamples : GHSh - 'pear lor cr ystal'
whenalter edtotheleftbecomesBAR - 'toopen,aswithapit
or holeinthegr ound',the-connection
L6/pg 4
isindir ect,r efer r ingnot
totheobjectsthemselvesbuttothemeansofdiscover y .POD -
'tovisit,over see'whenalter edtother ightbecomesTzRH - 'to
flow - aswithbloodor gum',indir ectlyr elatingassociation
withother stothelifefor cefunctioning .AswithThashr aqthe
Tzalohmethodquiteoftentur nsupnoactualwor dstowor kwith,
henceitisusuallybetter toconcentr ateonthenumer icalside,
stillanalysinginlightoftheouter aspectsofthewor ds
meaning,awayfr omitsessence .
AiqBekar isasystemofmuchvalueandapplication,
pr imar ilymathematical,itbeginswith
alphabet(finalsincluded)intoninegr oups
dividingthe Hebr ew
thr ee,thus :
Thebasicideaofitistoutilisetheconnectionbetween
letter soflinkedvalue, i .e . inthesequenceofsingle,double
and tr iple digitednumber s .Dependingonthecontextofuse,
1
is
f
f
T Ch
7 6
D
4
B
2 1
90 80 70 60 50 40
L
30
K
20 10
Tz(f)
900
P(f)
800
N(f)
700
M(f)
600
K(f)
500
Th
400
Sh
300 200
O
100
M
upper ,middleor lower count-r par ts,accor dingtowhichwayyou
wantedtolookatit .For instance,whentotallyr educedR(200)
alter stothesingledigitof B(2), P(60)alter stoCh(8),A(1)
r emainsasis,andL(30)alter sto G(3) . Oneofthefir stthings
youwillnoticeisthatwhenTheosophicr eductionisappliedall
thesewor dshavethesametotal - 5;this
L6/pg5
letter value can be incr eased or decr eased, ther eby changing the
letter (or letter s) and numer ation of the wor d . This technique is
expandable in all manner of dir ections,taking the basic methods
of Gematr ia and Temur ahinto a whole newr ealm .Fur ther tothis,
ther eistheuseoftheAiqBekar tableintheconstr uctionif
sigilsandtalismans,whentheletter valuesofawor dneedtobe
br oughtdowntoawor kablesize .
Her ear esomeexamplesofhowtousethistable
.For the
fir stthenameoftheAr changelattr ibutedtoTiphar ethandEast
willbeused,thatofRaphael(R=200+P=80+A=1+L=30=311)
.
Thisnamecanbealter edinfivebasicways,for thepur poseof
fur ther analysingitfor meaning,seekingconnectionswithother
namesor wor ds,unfoldingitsbackgr oundandcor econtent,or
simplytodisguisethewor dinvolved,ashasbeendoneinvar ious
older texts .Thesewaysar e(utilisingfPAL) :
Par tr educed- KPAL=131
Totallyr educed- BChAG=14
Par texpanded - RPYL=320
Totallyexpanded - RP(f)QSh=1400
Midway - KPYL=140
Themeansissimpleenough,inchanging theletter stotheir
showsthever y
L6/pg 26
dir ect association between all thats involved in this wor king .
you canpr oceed to examine the wor ds thesenumber slink
-suchaswithNAaR(320)-
'agitate,
or examineinvar iouswaysthenumber itself,
ofthepar tr educedandthepar texpanded - 131+320=451,
whenr aisingatr ipledigitr ever tstoasingledigit,
ver safor lower ing .Amor egener al
Ther eisthepr ocessofusing
movewithliveliness' ;
likewith14via
Theosophicaddition
.I tcomesto105andthatr educesto6,
Tiphar eth,

the

Sephir atowhichRaphael

is

attr ibuted .
Takenoteofthelinesofthoughtbehindthenumber movement
inAiqBekar ,withthesingledigithavingideasakintoKether ,
thedoubledigitamid-pointinexpansionandthetr ipledigit
thebr oadestdevelopment
;whether r educingor expandingthis
applies .
Another possibilityistocombine(for instance)ther esults
i .e .
one
thewor dswiththisnumber isShNANYM - 'angelsofTiphar eth' .
connectionindicatedwhichcouldbedeveloped .Alsother e
A
is
r aisingor lower ingtheletter sofawor dinsequence,for in-
stanceAaQDtoNAM,thoughwiththispar ticular methodnotethat
andvice
pointconcer nstheapplication
offinals,whichwithinAiqBekar paynor egar dtotheir standar d
placement .
themethodofcr eatingsever al
differ entspellingsfr omakeywor d,thenexamining these for
existingwor ds .fr omwhattur nsupasentencecanbeconstr ucted,
J
a
i
il
0
L6/pg 27
clar ifying in some waythesubjectmatter .
TheAiqBekar tableissometimesusedasacipher ,withnine
figur esofsomesor taccompaniedbyone,twoor thr eedots
distinguishtheletter .For instanceI .I I I : I X . . . would
inter pr etedasthewor dALTz(f) .
Besidesallofthis , ther ear ehiddenmeaningsinall
manner

oddplacementsoftheHebr ewletter s,
finalsinthemidstofawor dor notr ecognised

itsend,
letter swr ittenlar ger (nor mallyincr easesAlephto1000,etc)or
smaller thantheir companions,aletter wr ittenupsidedownor
evensideways,plusvar iationsinspelling - notalways
pr inter ser r or .Lookoutalsofor number sequencesinasentence
or gr oupofwor ds,thesecanindicateadefinitedir ectionor
opening .
Soendsabasicelabor ationofTemur ah,itisindeedagr oup
ofmethodsopentoendlessexplor ationviathecombiningofone
pr ocesswithanother ,or evenbuildingupsequencesofmethods
for analysingwithinapatter nedfor mat .Takeyour time!
for example :
b
1
I
t
LESSON 7
THREE VEI LS OF NEGATI VE EXI STENCE
THE BANI SHI NG RI TUAL OF THE PENTAGRAM
YHVH - THE FORMULAE OF TETRAGRAMMATON
PART ONE
THREE VEI LS i i F NEGATI VE EXI STENCE
The di agram below shows t he Three Vei ls of Negat i ve Exi st ence
grouped around Ket her, t he fi rst of t he Sephi rot h .
A

~~
: ~R

. , . ~

S O PH
r

VR
i
~. I N S O PH
P
AT/
t Y

N :
I

I
1

1
I
1
%

" . k

i STENL-"

11

i
I

yf.

C7
-

/ ;
` \ ~ `
A

1 M 1 T t i -~,74 --

/
~~

/ MI TL-ESS L\ G
i
L7/ pg
L7/ pg
Before one should st udy t he st ruct ure of t he Kabbalah i n
det ai l i t i s i mport ant t hat t he forces t hat emanat e i nt o t he Tree
of Li fe be st udi ed as well . The forces t hat t aper t hi s i ncomi ng
energy

fi t t he Kabbali st i c bluepri nt are called t he Three


Vei ls of Negat i ve Exi st ence whi ch are t hree successi ve forms
energy t hat mani fest around Ket her .

The
analogy i s t hat of t he Tet rad, for t hi s i s a complet e uni t whi ch
i ncorporat es st ages of emanat i ons whi ch can be brok en down t o an
element al form i n t he et heri c (unmani fest ed) .
MacGregor Mat hers, former head of t he Golden Dawn wrot e t he
followi ng on t he Vei ls of Negat i ve Exi st ence .
'There are t hree qabali st i cal vei ls of t he negat i ve
exi st ence, and i n t hemselves t hey formulat e t he hi dden
i deas of t he Sephi rot h not yet called i nt o bei ng,
ent i re concept i n
and
t hey are concent rat ed i n Ket her, whi ch i n t hi s sense i s
t he Malk ut h of t he hi dden i deas of t he Sephi rot h . I
wi ll explai n t hi s . The fi rst vei l of t he negat i ve
exi st ence i s t he AI N, Ai n = Negat i vi t y . Thi s word
consi st s of t hree let t ers, whi ch t hus shadow fort h t he
fi rst t hree Sephi rot h or numbers . The second vei l i s
t he AI N SVP, Ai n Soph = t he Li mi t less . Thi s t i t le
consi st s of si x let t ers, and shadows fort h t he i dea of
t he fi rst si x Sephi rot h or numbers . The t hi rd vei l i s
t he AI N SVP AVR, Ai n Soph Aur = The Li mi t less Li ght .
Thi s agai n consi st s of ni ne let t ers, and symboli zes t he
fi rst ni ne Sephi rot h, but of course i n t hei r hi dden
1
t
I
t
i
r
a
I
t
0
r
t
t
I
L7/ pg 3
i dea only . But when we reach t he number ni ne we cannot
progress fart her wi t hout ret urni ng t o t he uni t y, or t he
number one, for t he number t en i s but a repet i t i on of
uni t y freshly deri ved from t he negat i ve, as i s evi dent
from a glance at i t s ordi nary represent at i on i n Arabi c
numerals, where t he ci rcle 0 represent s t he Negat i ve,
and t he I t he Uni t y . Thus, t hen, t he li mi t less ocean
of negat i ve li ght does not proceed from t he cent re, for
i t i s cent reless, but i t concent rat es a cent re, whi ch
i s t he number one of t he mani fest ed Sephi rot h, Ket her,
t he Crown, t he Fi rst Sephi ra ; whi ch t herefore may be
sai d be t he Malk ut h or number t en of t he hi dden
Sephi rot h . t hus, " Ket her i s i n Malk ut h, and Malk ut h i s
i n Ket her" . '
Usi ng a moderni st i c approach, one could say t hat beyond t he
Three Vei ls of Negat i ve Exi st ence i s a parallel uni verse and t hat
t he Ai n, Ai n Soph and Ai n Soph Aur are merely a seri es of door-
ways from anot her uni verse t o our own (as t he Tree of Li fe) . I f
t he Three Vei ls of Negat i ve Exi st ence i s a doorway (or doorways)
i t must be bui lt so t hat anyt hi ng from anot her plane of exi st ence
t ryi ng t o ent er our envi ronment i s t apered t o sui t our current
level of exi st ence i n much t he same manner as a doorway i s, bui lt
t o sui t t he average i ndi vi dual . Though placed out si de t he Tree
of Li fe t he Vei ls of Negat i ve Exi st ence are i n fact an i mport ant
r

part f

I t i s t hei r job t o at t ract and t ransform energi es


from anot her plane so t hat i t can be i nject ed i nt o t he Tree on
somet hi ng ak i n t o perpet ual mot i on .
The Ai n Soph Aur for example, (whi ch i s out si de t he vei l)
at t ract s t hi s energy and i nject s i n i t or rat her obt ai ns from i t
t he di vi ne spark of i nt erest . Thi s, i n rat i onal t erms, i s some-
t hi ng li k e a'spark and as such ext ract s i t s fi ery essence from
t he energy whi ch i s t he fi rst st age of t ransformat i on ( . or ext rac-
t i on) for i n di scovery of t he element s fi re i s always t he fi rst .
Though t he Ai n Soph Aur does not have any
L7/ pg 4
associ at ed i t , i t could b li k ened (for vi suali sat i on
purposes) li k e an elect ri c net . I t at t ract s only aspect s of
energy t hat i t can cont rol as anyt hi ng uncont rollable wi ll not
ent er t he net . Ai n Soph Aur, i n very loose t erms, i s associ at ed
t o fi re and at t ract s and ext ract s t hat port i on of energy, as li k e
at t ract s li k e . The energy t hat i s caught by Ai n Soph Aur i s t o a
cert ai n ext ent abst ract i n concept and conforms t o Ai n Soph Aur
because i t wi shes t o joi n i t . The element s of t hi s abst ract
force or energy t hat i s not compat i ble wi t h Ai n Soph Aur are left
out si de i t s boundari es .
The next vei l i s Ai n Soph : I t pulls t he energy i n Ai n Soph
Aur t oward i t and t apers t he energy furt her by ext ract i ng only
what i s compat i ble t o i t . The energy resi due left i n Ai n Soph
Aur i s t hen absorbed by t for Ai n Soph has ext ract ed even
furt her t han Ai n Soph Aur could, leavi ng Ai n wi t h previ ously
unaccessable energy t o absorb .
The last vei l i s Ai n whi ch draws from Ai n Soph along t he
same li nes t hat Ai n Soph draws from Ai n Soph Aur .
defi ni t e symboli sm
J
1 1
a
t
4 6
t
f
4 1
0
I
t
t
PART TWO
THE BANI SHI NG RI TUAL OF THE PENTAGRAM
A t ape by I srael Regardi e, i s recommended for use wi t h
t hi s lect ure
. THE BANI SHI NG RI TUAL OF THE PENTAGRAM i s avai lable
at a di scount ed pri ce of $1 0 . 0 0 , whi ch i ncludes post al charges .
Thi s t ape gi ves full i nst ruct i ons on how t o perform t he Bani shi ng
ri t ual and should be memori sed by t he st udent .
T underst and correct ly t he fundament al " Bani shi ng" aspect s
of t he pent agram, we wi ll t ak e, as an example, t he " Lesser
Bani shi ng Ri t ual of t he Pent agram" as t aught i n t he Neophyt e
grade of t he Golden Dawn .
L7/ pg 5
)Pi rk
The basi c concept behi nd t hi s pent agram i s t o ri d ourselves
of unwant ed ast ral aspect s. We k now what i t does, but t hen
vari ous quest i ons such as how, and why, come t o mi nd .
When performi ng t he " Bani shi ng Ri t ual of t he Pent agram"
usi ng, of course, t he pent agram of eart h only - what you are
act ually doi ng i s drawi ng power from t he eart h (element ) of t hi s
planet .

Si nce eart h i s our densi t y element , we are bri ngi ng t o


our area of work i ng i ncreasi ng densi t y, whi ch forces t he li ght er
element als t o depart , as t hey cannot exi st out of t hei r realm .
element , i . e .
element bani shi ng you
i mbalance i s a by-product of t he element cont act bei ng
t oo soon .

As t he effect of t he eart h pent agram wears off, t he


di st urbance would become more pronounced .
The correct procedure i s t hat i f one i nvok es a part i cular
element , for example ai r, t hen t hey bani sh
L7/ pg 6
Thi s i s i n part an explanat i on of why a great many hi gh areas
were used, i n anci ent t i mes for magi cal purposes - t he ai r bei ng
less denser . Vari ous element als, whet her for " good" or " evi l"
purposes, usually cont act us bet t er i n t hese hi gher places .
I f we bani sh, say wi t h t he fi re element , i t should only be
i f we have i nvok ed t he element of fi re, or as our t rai ni ng
t eaches us, t he area we are i n has - for one reason or anot her -
an element al i mbalance of fi re and t o rect i fy i t a t ype of purg-
i ng i s needed, t hi s rule holds good for all t he element s . (Not e:
. The i nvok i ng pent agrams wi ll be explai ned i n a lat er lesson . )
As anot her example ; i f one deci ded t o i nvok e t he element
wat er but used only t he eart h pent agram t o bani sh, t hi s would
have t he desi red effect , but t he result would only be t emporary .
To go from one st ep t o anot her - i n t hi s manner - leaves what one
would call a di st urbance or i mbalance i n t he at mosphere .

Thi s
severed
wi t h t hat same
use t he i nvok i ng pent agram of ai r t o i nvok e, and
use t he bani shi ng pent agram of ai r t o bani sh .

I f aft er t he
fi nd t hat t he area st i ll needs cleari ng,
t hen you can use t he bani shi ng of eart h pent agram as i n t he
" lesser bani shi ng ri t ual of t he pent agram

All of t hi s has t he
1
f
a
t
A
t
t
I
t
effect of harmoni ously seali ng off t he ast ral li nk .
Generally t he power of t he pent agram last s for only few
hours (i t i s drai ned at dusk and dawn) and only gai ns great er
st rengt h i f rei nforced dai ly .
PART THREE
YHVH - THE FORMULEA OF TETRAGRAMMATON
Tet ragrammat on i s expressed i n YHVH and i s a complex
formulea . I f one wi shed t o express t hese four let t ers i n arche-
t ypal t erms YOD i s t he young man who marri es HEH (a woman) who
produces VAU (a son) . The FI NAL HEH can ei t her be anot her young
woman who marri es VAU (t he son), or hi s si st er . The followi ng
t able shows some associ at i on appli ed t o t et ragrammat on .
World

Element

Numeri cal

Ti t le
YOD

At zi lut h

Fi re

1 0

Uni t y
HEH

Bri ah

Wat er

Duali t y
VAU

Yet zi rah

Ai r

Relat i onshi p
HEH(F)

Assi ah

Eart h

Transi t i on
Accordi ng t o t radi t i on YHVH i s a word, whi ch, i f t he t rue
pronunci at i on be di scovered womuld gi ve t he sayer di vi ne power .
MacGregor Mat hers wrot e t he followi ng on YHVH .
L7/ pg 7
'The name of t he di et y whi ch we call Yehovah i s i n
Hebrew, a name of 4 let t ers YHVH (I HVH) -
t he same meani ng) : The t rue pronunci at i on of i t i s
k nown t o very few ; I myself k now some score of
di fferent myst i cal pronunci at i ons of i t . The t rue
pronunci at i on i s a most secret arcanum, and i s a secret
of secret s - t herefore when a devout Jew comes upon i t
L7/ pg 8
(I & Y have
t
1 1
A
4 6
t
t
t
i n readi ng t he scri pt ure, he ei t her, does not at t empt
pronounce i t , but i nst ead mak es a short pause or
else subst i t ut es i t for t he word ADNI , Lord (Adonai ) .
The radi cal meani ng of t he word i s " t o be" and i s t hus
li k e AHI H, a glyph of exi st ence .

I t i s capable
" t o
are
t welve t ransposi t i ons whi ch all convey t he meani ng of
t ransposi t i ons
be" .

I t i s t he only
wi t hout i t s
word t hat wi ll bear
meani ng bei ng alt ered .
so many
t hey
called t he 1 2 banners of t he mi ght y name and sai d
t o rule t he 1 2 si gns of t he zodi ac . '
Holy Name_ Zodi ac Tri be o I srael_ An- gel
YHVH
YHHV
YVHH
HVHY
1
b
o-M
GAD
EPHRAI M
MANASSEH
I SSACHAR
MELCHI DAEL
ASMODEL
AMBRI EL
MURI EL
HVYH
HHVY
VHYH
o2 JUDAH
NAPHTHLI
ASSHUR
VERCHI EL
HAMALI EL
ZURI EL
WHY
VYHH
HYHV
~~
l~
DAN
BENJAMI N
ZEBULUN
BARCHI EL
AOVACHI EL
HANAEL
1
I
r
t
I
t
r
L7/ pg 9
HYVH

~~

REUBEN

CAMBRI EL
HHYV

> F

SI MEON

AMNI TZI EL
For t hose of you who have done t he Bani shi ng Ri t ual of -t he
Pent agram have you ever wondered what t he names i nscri bed i n t he
pent agrams mean .

YHVH, whi ch has been at t ri but ed t o t he quart er


f t he east i s explai ned above but t here are also t hree
names at t ri but ed t o t et ragrammat on whi ch are used i n t he pent a-
gram ri t ual . ADNI also has been explai ned, leavi ng only AGLA and
AHI H .
AGLA st ands for t he fi rst let t ers of t he sent ence " AThH GBVR
LOVLM ADNI " whi ch means " Though art mi ght y forever, O'Lord
MacGregor Mat hers furt her explai ns t he format i on of AHI H :
'The fi rst t hi ng we not i ce i s t hat bot h AHI H and YHVH
convey t he i dea of Exi st ence ; t hi s i s
analogy .

The second i s, t hat i n each t he let t er


comes second and fort h ;
t hei r fi rst
and t he t hi rd i s t hat by
gemat ri a AHI H equals I HV wi t hout t he H (whi ch we shall
see present ly i s t he symbol Malk ut h, t he 1 0 t h
Sephi ra) . But now, i f t hey be wri t t en above t he
ot hers, t hus, wi t hi n t he arms of a cross :
A H

Y H
Y H

V H
They read downwards as well as across, AHI H, YHVH
ot her
SEPHI ROTH
O O
0 0
0
0 0
0
HOLY NAME
L7/ pg 1 0
Now i f we exami ne t hem qabali st i cally we shall fi nd t he
reason for t hese analogi es . For AHI H i s called 't he
vast count enance, t he anci ent one, macroprosopus'
(whi ch i s at t ri but ed t o Ket her, t he fi rst Sephi ra) . "
I n t hi s i nst ance we now consi der one t ree brok en up i nt o t he
di vi si ons of t he four worlds .
1
r
1
4 4
I
r
I
0
t
r
0
LESSON 8
THE FOUR WORLDS
When st udyi ng t he Kabbalah one wi ll i nvari ably come across
t he doct ri ne of t he four Kabbali st i c worlds . Because t here i s
some confusi on i nt o t hei r exact appli cat i on t o t he Tree of Li fe
i t would be best consi dered i f one accept ed t hei r dual appli ca-
t i on . I n t he fi rst i nst ance t he di agram below shows t he di vi si on
of t he four worlds as appli ed t o a si ngle t ree . The ot her
approach i s t o use four separat e t rees t one on t op of anot her) t o
i llust rat e each world .
ATZI LUTH
BRI AR
YETZI RAH
ASSI AH
LB/ pg 1
ATZI LUTH
The Creat i ve World of At zi lut h i s t he fi rst emanat i on i nt o
t he Kabbali st i c framework and as such i s t he world
The i nhabi t ant s of t hi s level are what could
LB/ pg 2
Spi ri t .
descri bed as
archet ypal and are expressed i n t erms of t hought as t he vari ous
God associ at i ons t o t he Tree . Thei r domai n i s vast and every-
t hi ng t hey t ouch i s on
a macrocosmi c-mi crocosmi c aspect . These
bei ngs are mani fest at i ons of t he Kabbali st i c concept i n t erms of
human underst andi ng . Thi s world i s t he one t hat i ssues t he
di rect i ons t o t he ot her worlds and as such expect s devot i on from
i t s subject s whi ch i s gi ven by prayer and medi t at i on and i s t hen
carri ed up t o t hi s level from t he lower worlds . Di vi si ons and
fut ure pat t erns for growt h are fi rst est abli shed here on a grand
scale, and t he lower worlds are left t o work out t he deli cat e
k armi c balances percei ved from t hi s world . The associ at i ons of
t he numerous godf orms from t he vari ous cult ures i s a way of
descri bi ng t hi s world, but i t must be underst ood t hat t he
godform associ at i ons t o At zi lut h are only i n t he t erms of grand
st ages of development of cult ures and not on a personal level for
t hi s i s left t o t he lower t rees .
I n t erms of " Cosmi c Creat i on" as i n At zi lut h, i t comes i n
t hree fundament al t erms of development .

The fi rst i s mani fest a-


t i on or est abli shment of archet ypal energy levels . The second i s
t he conversi on of t hese energi es i nt o levels human comprehensi on
can accept whi ch i s t he st andard archet ypal godform . The t hi rd
i s t he roundi ng off of t hese di et i es by associ at i ng a st ri ng
I
a
4
r
1 1
t
i
r
1
1
t
I
1
r
at t ri but i ons t o t hem,
These fi gures are are t o a cert ai n ext ent shadows whi ch have been
t hrust i nt o t he li ght and have t ak en a more sui t able form
survi ve .

At zi lut h i s t he collect i ve area


development from whi ch all t hi ngs come and ret urn t o .
NAMES OF ATZI LUTH

Ket her
2.

Chok mah
3.

Bi nah

Chesed

Geburah
Ti pharet h
Net zach
Hod
9 .

Yesod
1 0 . Malk ut h
BRI AN
4
6 .
7 .
i n relat i on t o t he Sephi rot h and t he Tree .
EHEI EH
YEHOVAH
YEHOVAH ELOHI M
EL
ELOHI M GI BOR
ELOAH VADAATH
YEHOVAH TZABAOTH
ELOHI M TZABAOTH
SHADDAI EL CHAI
ADONAI HA-ARETZ
L8/ pg
subconsci ous
Bri ah i s t he Creat i ve World and i s deri ved from t he Hebrew
root BRA (t o beget or creat e) .

Thi s i s t he world of t he
archangel, t he essence
At zi lut h world before
government but are
of God depi ct ed as a bei ng who serves
di rect ly under hi m and over t he angels . I t i s here i n t hi s world
t hat polari t i es and hi erachi es are est abli shed .

Li k e t he
i t t hey are very

general i n t hei r
more speci fi c t han t he Gods At zi lut h .
L8/ pg 4
They cont rol t he element s and count ri es and t hei r ent i re concept
i s one of vast ness i n t he plan of man and cont i nually cont rol hi s
di rect i on and scope .
Whi le t he Gods of At zi lut h si t as
a st abi li si ng force t he archangels creat e
. The God forms wi ll
have a rough draught of a plan for man i n general and t hi s i s
passed on t o t he archangel who li st s t he development s out i n
t erms of t i me and place . I t i s t hey who are t he balancers and
cont rol t he chess li k e game of world k armi c pat t erns .
I f you wi sh t o learn of t he Bri at i c World si mply consi der i t
li k e t he four element s i n bot h nat ure and ast rology . Draw up a
li st of associ at i on t o t hese element s and you wi ll have t he areas
of t he four major archangels .

Below t hem are t he seven


. archangels who cont rol t hi ngs even furt her .
NAMES OF BRI AH
1 .

Ket her
2.

Chok mah
3.

Bi nah
4 .

Chesed
5 .

Geburah
6 .

Ti pharet h
7 .

Net zach
8 .

Hod
9 .

Yesod
1 0 . Mal t rut h
METATRON
RAZI EL
TZAPHOI EL
TZADQI EL
KAMAEL
RAPHAEL
HANI EL
MI CHAEL
GABRI EL
SANDALPHON
I n some i nst ances
t hese names overlap but t hey cont rol t he foundat i on of t he world
as we k now i t t oday .
1
t
I
4 1
1
0
1
f
r
YETZI RAH
Yet zi rah comes from t he Chaldee I TzR meani ng 't o form' or
'mak e' . The angeli c bei ngs of t hi s world are desi gnat ed as
choi rs and act on t he t ask s consi dered t oo meni al for archangels .
Thi s world i s one where form mani fest s on all mi nor- levels . I t
i s t he det ai led aspect of t he k armi c pat t erns t hat are t ak en care
of here . Thi s effect uat es a roundi ng off of k armi c pat t erns
where all loose ends are cleared up . I t i s here t hat souls of
previ ous -i ncarnat i ons assume t he di vi ne funct i on and t ak e t hei r
places as angels or t eachers once t hei r eart hly confi nes have
fi ni shed .
The Yet zi rac World i s t he one t hat man somet i mes vent ures
i nt o duri ng unconsci ous or self i nduced dream st at es, where one
reaches t he very pi nnacle of ones core essence whi ch i s called
t he Hi gher Self who i ssues out i nst ruct i ons t o us .

The Hi gher
Self or H . G . A .
furt her ext ensi on of t he 'I D' .
medi ums .

I t i s t he world of
LB/ pg 5
(Holy Guardi an Angel) as i t i s somet i mes referred
dwells i n t hi s world and i s consi dered an angeli c bei ng,
nat i on, clai rvoyance and vi si onary experi ences .
I t i s he who work s i n wi t h t he
angeli c choi rs and work s on our day t o day act i vi t y for our
bet t er good
. Also t hi s i s t he area where t he souls who have di ed
and rest bet ween i ncarnat i ons, and i s t he area oft en t apped by
dream consci ousness memory, i magi -
NAMES OF YETZI RAH
1 .

Ket her

CHAYOTH HA-QADESH
2.

Chok mah

AUPHANI M
3 .

Bi nah

ARALI M
Chesed

CHASHMALI N
5 .

Geburah

SERAPHI M
6 .

Ti pharet h

MELEKI M
7 .

Net zach

ELOHI M
8 .

Hod

BENI ELOHI M
9 .

Yesod

ASHI M
1 0 . Malk ut h

KERUBI M
ASSI AH
Assi ah, t he world we li ve i n, i s i nfluenced not only by t he
forces of li ght but also of dark ness and i t appears t hat t hi s i s
t he neut ral ground where t hey meet and do bat t le hence t he dual
associ at i on t o t hi s world .
LS/ pg 6
1
t
I
a
t
4 1
v
1
L
1
M
1
(Li li t h)
The above t ables are but one example of t he names at t ri but ed
t o t he Ql i ppot hi c forces . Many of t hese Sephi rot h have i n fact
dual associ at i ons t o t hem and t hey must be st udi ed wi t h t hi s i n
mi nd . Li li t h i s a pri me example appeari ng as a demon i n Malk ut h
and as an arch-devi l i n Yesod . Though some of t hese names are i n
fact more appli cable t o pat hs rat her t han t he Sephi rot h, t hey
have been so grouped so t hat a general concept of t hei r nat ure
can be underst ood .
Mat hers says: " The demons are t he grossest and most defi -
ci ent of all forms . Thei r 1 0 degrees answer t o t he decad of t he
Sephi rot h but i n t he i nverse rat i o, as dark ness and i mpuri t y
i ncrease wi t h t he descent of each degree . The t wo fi rst s are
not hi ng but absence of vi si ble form and organi sat i on . The t hi rd
i s t he abode of dark ness .

Next follow seven hells occupi ed by


L8/ pg 7
Planet ary Forces Demons Arch-Devi ls
Ket her Nept une Keret hi el Moloch (Sat an)
Chok mah Uranus Zogi el Beezlebub
Bi nah Sat urn Sat ori al Luci f uge
Chesed Jupi t er Gagh Shek elah Asht arot h
Geburah Mars Gal ahab Asmodeus
Ti pharet h Sun Zomi el Belphegor
Net zach Venus Ghoreb-Zereq Baal
Hod Mercury Samael Adrammelech
Yesod Moon Gamali el Li li t h
Malk ut h Eart h Nahemot h Nahema
L8/ pg 8
t hose demons whi ch represent i ncarnat e human vi ces, and t ort ure
t hose who have gi ven t hemselves up t o such vi ces i n eart h li fe .
Thei r pri nce i s Samael (SMAL), t he angel of poi son and deat h .
Hi s wi fe i s t he harlot or woman of whoredom, AShTh ZNVNI M,
(I shet h Zenuni m) and uni t ed t hey are called The Beast , Chi va,
Chi oa . Thus t he i nfernal t ri ni t y i s complet ed, whi ch i s, so t o
speak , t he averse and cari cat ure of t he Supernal Creat i ve One .
Samael i s consi dered t o be i dent i cal wi t h Sat an. "
The Kabbali st i c associ at i ons here t o bot h t he forces
li ght and dark ness go i nt o ext raordi nary det ai l (of whi ch wi ll be
compounded on i n lat er lessons) so t hat not only t he posi t i ve
aspect s of our psyches are placed i n some sort of order but t he
negat i ve i nfluences as well .

Aft er some st udy and pract i ce we


wi ll

able t o easi ly i dent i fy not only t he posi t i ve areas


energy but negat i ve ones also . The object of t hi s i s when one i s
pursued by negat i ve i nfluences t o look at i t s count erpart on t he
upper Tree and draw from i t (t hrough prayer and i nvocat i on) t o
nulli fy t he negat i ve force. For example, i f we are i nflamed wi t h
hat e, dest ruct i on or anger, t he negat i ve force of t he Sephi ra of
Geburah would be t he Golahab and Asmodeus . By prayi ng or drawi ng
from Kamael and t he Seraphi m one bri ngs i n a count eract i ve force
t o nulli fy t he evi l effect .
1
1 1
1
1 1
4 1
1
I
The addi t i ons t o t he book " Seoh~r Y~+~i r~~" =+=+== *k -
_-_. -- .

--,~

. -- .

~^~~ . ~~

^. . . ~
followi ng : followi ng : " The fi rst pat h (Ket her) i s called Admi rable or
Hi dden I nt elli gence (t he Hi ghest Crown) :

For ~+ i s~ + h" "


'i " h+ - ~~
---

_ . - .

^^
W
. . ^
~~ gi vi ng power of comprehensi on of t hat fi rst pri nci ple whi ch has
no begi nni ng
; and i t i s t he Pri mal Glory, for no creat ed bei ng
can at t ai n i t s essence~"
1 1
1 1
1 1
1 1
1 1
1 1
`
si mple t erms t hi s descri bes t he mani fest at i on of li fe
`
i t self i n our own level of exi st ence or a plane t hat we can
least underst and .

Si nce li fe i t self, i n i t s di vi ne spark merely


mani fest s (from a di fferent level of t he concept of li fe as we
~
k now i t ) i n t hi s plane i t has i n essence no begi nni ng for i t
i s merely a t ransmut at i on of energy i n i t s purest form
. I f we
ut i li se our concept s of Hermet i c Phi losophy we fi nd t hat i t i s
merely a cont i nual flux and t hroughout et erni t y i t cont i nually
changes and i s refi ned .

No creat ed bei ng can at t ai n i t s essence


LESSON 9
NETHER
-
THE CROWN
`
because i t i s t he pure essence of li fe i t self
L9
/ pg 1
whi ch dri ves
creat i on (i n human t erms) .

We are i n fact a product of t he


Di vi ne Essence, not t he ot her Way round *.
Ket her bei ng t he fi rst spark , li k e Adam (from whom eve was
deri ved) i s androgonous i n charact eri st i cs and as such i s placed
at t he head of t he Mi ddle Pi llar,

t he ut most
equi li bri um .

Though i t i s mani fest ed i n t erms of


poi nt
i nfluence,
I f we apply Ket her t o t he body of man (somet i mes called Adam
Kadmon - t he Heavenly Man) we can, t o a lesser ext ent obt ai n an
i dea of i t s funct i on i n t erms we can underst and .

Ket her i s t he
Sephi ra, t hat i n part , t ouches t he t op of t he head
ever, have consi dered t hat
L9/ pg
Ket her has not yet mani fest ed i n t erms of appearance . I n general
t erms t he Supernal of t he Tree of Li fe (above t he abyss) does not
mak e t hei r appearance (unt i l t hei r i nfluence passes t hrough t he
abyss) unt i l t he Sephi ra of Chesed, for beyond t hat i t i s not hi ng
but unmani fest ed forms of i nfluence . A si mple t erm t o descri be
Ket her i s t he moment or poi nt of concept i on .
wi t h t he
remai nder of t he Sephi ra sli ght ly above i t (about t he si ze of
di nner plat e) and i s generally vi suali sed as bei ng a bri ght li ght
because i t s essence defi es descri pt i on .

Some Kabbali st s, how-


t he Magi cal I mage of F(et her i s t hat of
a bearded man i n profi le . Thi s of course fi t s i n wi t h some old
Rabbi ni cal t ext s whi ch refer t o Ket her i n such t erms as : Vast
Count enance ; Whi t e Head, (due t o i t s lumi nosi t y) ; The Head whi ch
i s not ; Macroprosopus .
When we vi ew Ket her t here are t wo mai n forms t hought
regardi ng i t s mak eup . The fi rst i s t o consi der Ket her as an
ent i re Sephi ra encompassi ng all t he ot her Sephi rot h and as such
i s gi ven t he t i t le of t et ragrammat on . The second consi derat i on
i s t hi nk of a Ket her t hat compli es t o t he doct ri nes of t he
four Kabbali st i c worlds .

I f we consi der t he lat t er t hen we have


t underst and t he God names appli ed t o Ket her i n each of t hese
four worlds . I n At zi lut h t he God name i s AHI H (pronounced AY-
1
1 1
r
1
1
M
and from havi ng at hi s command a human experi ence of one or t wo
'

mi lli on years, almost i mmort alHe would have li ved count -


less t i mes over t he li fe of t he i ndi vi dual, of t he fami ly, t ri be
and people, and he would possess t he li vi ng sense of t he rhyt hm
of growt h, floweri ng and decay" .
Of course access t o t hi s t i meless voi d would enable man
reach t he realm of super-consci ousness and all k nowledge, past ,
present and fut ure .
1
r
L9/ pg'3
HER-YAY) whi ch i s anot her t i t le for t he let t ers of Tet ragrammat on
(t he word AHI H i s obt ai ned t hrough t he process of Temurah) . t he
li t eral t ranslat i on of AHI H i s 'I wi ll be' . By reci t i ng t hi s
correct ly a number of t i mes an i ndi vi dual wi ll open doors
wi t hi n t he self t hat can t ak e one back t o t he poi nt of concept i on
i t self .
Anot her Kabbali st i c associ at i on t o Ket her i s t he Yechi dah
(pronounced YAK-I -DAH) whi ch i s t he di vi ne spark of t he
Kabbali st i c Soul . Si nce t he Yechi dah i s t he pri mal si ngular
poi nt of t he percept i on of consci ousness i t i s associ at ed t o t hat
level whi ch t he psychologi st s refer t o as t he Collect i ve
Unconsci ous . To explai n t hi s pri nci ple t he followi ng quot e from
'Modern Man i n Search of a Soul' by Carl Jung, gi ves us some
i nsi ght i nt o i t s mechani sm .
" I f i t were permi ssi ble t o personi fy t he unconsci ous, we
mi ght call i t a collect i ve human bei ng combi ni ng t he charact eri s-
t i cs of bot h sexes, t ranscendi ng yout h and age, bi rt h and deat h,
L9/ pg 4 .
t
MacGregor Mat hers consi dered t he real self lay i n t he
Yechi dah .

" Thus Yechi dah i s called Di vi ne Consci ousness


'Consci re' means 't o k now wi t h' and 't o be i n t ouch wi t h'
bei ng k nown as t he H . G . A .
- and
only your Ket her can do t hi s as regards t he di vi ne and your
Ket her i s t hen Di vi ne Consci ousness" . Also i n Yechi dah i s t he
Di vi ne Wi ll, t hat whi ch funct i ons under t he gui di ng li ght of t he
(Holy Guardi an Angel or i n ot her t erms
ones Hi gher Self, somet i mes called HVA by t he Kabbali st s) .
Di vi ne Wi ll i s of course t he hi gher aspect s of human wi ll whi ch
i s classed under anot her aspect of t he Kabbali st i c Soul.
I f we exami ne t he name Yechi dah, i t s numerat i on t ot als 37
whi ch when vi ewed wi t h ot her Hebrew root words gi ves t he
followi ng :
By carefully st udyi ng t hese meani ngs one can gai n an i nsi ght
i nt o t he funct i ons of t he Yechi dah and i t s relat i onshi p t
Ket her .
The emanat i ons of At zi lut h on Ket her i s li t erally t o become
one of t he godforms one has work ed so hard at emulat i ng .

Though
1
1
r
ALV i nt erpose, supposi ng

I
GDL great ness i n somet hi ng
DGL banner or beacon for di vi ne t ravel
LHB i nflame
LZ

t o t urn away from


D
1
t
L9/ pg 5
one may aspi re t o reach t hi s realm i t i s unli k ely t hat i t i s i n
t he sphere of human comprehensi on, for t o do so one would i n fact
have t o become bodi less and exi st i n t erms of pure energy . How-
ever i t st i ll does not st op us from t ryi ng by usi ng our i nt el-
lect . The bi bli cal at t est at i on t o t hi s concept i s t he ascent i on,
i n whi ch Chri st ascended t o heaven, bot h body and soul .
The vi brat i ons of t he Bri at i c World on Ket her are shown by
Met at ron, t he Archangel whose name one must vi brat e i n at t ai ni ng
t hi s level . Somet i mes called t he 'Ki ng of Angels', Met at ron was
t he angel who lead t he Exodus of t he Chi ldren of I srael t hrough
t he wi lderness . I n t he 'Abodah Zarah' t ext of t he Talmud,
Met at ron i s descri bed as t he 'Teacher of t he premat urely dead
chi ldren i n paradi se' . I n modern concept s t he vi brat i on of t hi s
archangel's name wi ll t ry t o get t he i ndi vi dual back t o God or
t he pure st at e of Ket her . He i s our gui de or aspi rat i on t o
hi gher levels of t he self . By vi brat i ng hi s name we draw down
t hat part of hi m t o help gui de us .
The Yet zi rat i c i nfluence on Ket her i s t hrough t he Order
Angels called t he 'Chayot h ha-Qadesh' (Holy Li vi ng Creat ures) .
These t ak e t he element s, i n t hei r corporeal form and t ransmut e
t hem t hrough four radi cal processes i nt o a common form whi ch i s
ready for ent ry i nt o t he next level .

Ot her t i t les t hey have are


'Movers of Wheels' whi ch i s li nk ed t o anot her t i t le of Ket her
called 'rashi sh ha-Gi lgoli m' (whi rli ng forces) . Si nce Yet zi rah
i s t he World of Format i on t he act i ons of t hese angels li t erally
form t he cell st ruct ure (i n man) and t he bluepri nt of hi s li fe on
L9/ pg 6
eart h . I t i s here t hat t he Karmi c web has already begun t o weave
a pat h for t he i ndi vi dual t o follow .
and mult i facet ed . Thi s i s because Assi ah i s a world of overlaps,
not only wi t h t he i nfluence of t he planet s but also wi t h emana-
t i ons of t he Qli ppot h as well . Si nce t he anci ent Kabbali st s di d
not apply more t han seven planet s t o t he Tree of Li fe, t he modern
concept i s t o apply ei t her Nept une or Uranus t o t hi s Sephi ra
(dependi ng on t he syst em one uses) . Out of t hese t wo planet s
Nept une fi t s Ket her more t han Uranus does, i f bot h are consi dered
from t hei r esot eri c st andpoi nt and not t hei r mundane meani ngs .
1
The effect s of t he World of Assi ah on Ket her i s very complex
4 1
The planet Nept une i s a fundament al force t hat i s almost
beyond t he scope of reason and cont rol . Because of t hi s i t i s an
ext remely di ffi cult planet t o underst and as i t goes beyond t he
boundari es of normali t y .

fi ght agai nst t he i nfluence i s


fut i le and i t i s best t o channel i t s energi es i nt o a creat i ve
project .

I n t hi s way one wi ll go wi t h i t s emanat i ons and whi ch


i n t urn wi ll t ak e us t o newer hei ght s and hori zons we never
dreamed exi st ed before . Words li k e i llusi on and i mmagi nat i on are
good ones t o descri be i t s pot ency as Nept une i s t he planet of t he
ast ral voyager, li mi t ed only by t he cont rols he or she set s on
t hemselves .
Assi ah i s t he World of Act i on (our expressi on) where we
current ly exi st . I t i s here t he Karmi c i nfluences merge t hrough
Yet zi rah and we act out our carefully chosen part s .

Wi t hi n
I
1
t
Ket her of Assi ah we have t o consi der t he effect of t he World of
shells (or Oli ppot h) has on us as well . Si nce t hese are t he
negat i ve phases of t he Tree t hey must also be exami ned, for t hei r
i nfluence over us on eart h i s qui t e subst ant i al .
Thaumi el (Twi ns of ,God) i s t he Demon of k et her of t he lower
Tree . MacGregor Mat hers says of Thaumi el :
" The Bi cephalous Ones ; and t hei r forms are t hose of dual
gi ant heads, wi t h bat li k e wi ngs ; t hey have not bodi es for t hey
are t hose t hat seek cont i nually t o uni t e t hemselves t o ot her
bei ngs and forces" .
L9/ pg 7
I t must also be poi nt ed out t hat Thaumi el i s part
Keret hi el (accordi ng t o an unpubli shed Golden Dawn paper on t he
Oli ppot h) .

The large gi ant -li k e aspect of Thaumi el i s repre-


sent ed by t he mat eri al value of t he Oli ppot h as opposed t o t he
mi st y ast ral of t he upper Tree .

Here, i n t he World of Shells,


consoli dat i on of form i s of pri me i mport ance . Keret hi el i s KRT
and means t o 'Cut Off' whi le YAL means 'Wi ll t o Resolve' . Thi s
can mean- i t s effect on man i s 'To cut off t he Wi ll t o resolve
t hi ngs' . By usi ng gemat ri a on t he name Thaumi el (whi ch i s 4 88)
i t s meani ng i s 't o di g and cut ' and 'unbi nd', all of whi ch are
part of t hi s demon's nat ure .
Ket her, i n Hi ndu concept s, i s associ at ed t o t he At ma t he
supreme st at e of i llumi nat i on .

I n t erms of t he subt le body


cent res or chak ras as t hey are more commonly k nown Ket her i s
reach and upon reachi ng i t one has t o ret ai n i t , wi t hout burni ng
oneself out . Ket her i s t he poi nt of uni on of bot h Purusha and
Prak i t i and also i s t he st at e of Advai t a (non duali t y) . Thi s i s
t he meet i ng of t he Kundali ni energy wi t h t he essence of pure
consci ousness . Mook erjee and Khanna consi der t hat t hi s cent re i s
t he qui nt essence of consci ousness, where t he synt hesi zat i on of
all polari t i es i s experi enced . I t i s a cent re whi ch neut rali zes
all t he major senses, yet i nt egrat es all cogni t i ve and conat i ve
funct i ons and embraces t he st at i c and dynami c energi es t he
vari ous cent res i nt o all-pervasi ve uni t y . I t i s here at t hi s
poi nt t hat t he Kundali ni energy complet es her journey aft er
havi ng passed t hrough t he si x lower chak ras .
One Egypt i an God associ at ed t o Ket her i s Pt ah, meani ng
'Opener' . As a god Pt ah was t he one t hat fashi oned new bodi es
and was consi dered t he grand archi t ect of everyt hi ng t hat was
fashi oned i n t he world . So powerful a god was he t hat he made
t he support s whi ch held t he sk y i n place . From t he Greek Epoch
we have Zeus, fat her of t he Gods . Zeus was i n hi s fi rst form a
sk y god who cont rolled t he . element s and lat er became omni pot ent
and was t he prot ect or of all t he gods i n t he Greek St at es .

I n
t he Roman pant heon Jupi t er i s t he god associ at ed here .
god who hurled t hunderbolt s (hi s name
L9/ pg 8
Sahasarai s t he t opmost Chak ra cent ered above t he head whi ch has
been called t he t housand pet alled lot us . The cent re of t hi s
lot us i s a bri lli ant whi t e wi t h golden flashes at i t s mi dst whi ch
can be seen as whi rls .

Thi s cent re i s t he most di ffi cult t o


He was a
i s deri ved from a root t hat
means 'bri lli ance') and was a warri or god who emulat ed hi s Greek :
4 1
1
t
1
w
i
t
count erpart .
t hi s Sephi ra as i t was he who commanded t he gi ant s
Valhalla where he could rule t he world .
L9 : pg 9
Wot on, a Germani c form of Odi n, i s also associ at ed
bui ld
One i mport ant symbol associ at ed t o Ket her i s t he Fylfot
whi ch i s most recogni sable by i t s German name, Swast i k a
. I t i s
present i n one form or anot her i n just about every ci vi li sat i on
on eart h and a vari et y of meani ngs are associ at ed t o i t . For
example, t he Buddhi st s consi der i t a symbol of t he Wheel of Li fe .
The Hi ndu concept i s one of li fe and good fort une . To t he Romans
i t was a symbol of Jupi t er whi le i n early chri st i an t i mes i t was
a symbol of Chri st s power .
The Di amond i s t he gem of Ket her and i n Hi ndu phi losophy i s
also t he jewel of t he t housand pet alled lot us . I t i s oft en
called t he 'Ki ng Gem' and i s symboli c of bot h modest y and puri t y .
t hi s refers di rect ly t o i t s propert i es of unconquerable resi l-
i ence and i t s t ransparency whi ch i s relat ed t o puri t y . When worn
as a t ali sman i t i s sai d t o bri ng vi ct ori ous result s (t o
wearer) and gi ves superi or st rengt h and courage .

n t he book '
Lapi di bus' by Marbodus, t he di amond i s supposed t o k eep
t he
away
ghost ly vi si ons of t he ni ght . I t should be set i n gold and worn
on t he left hand . Rueus, i n 'De Gemmi s' consi dered t hat t he
di amond had powers of reconci li at i on bet ween lovers .
Anot her associ at i on t o t hi s Sephi ra i s t he Crown whi ch, i s
more of a root symbol t han ot hers . Jung consi dered t hat t he
Crown was a symbol of par excellence and of at t ai ni ng t he hei ght
t he evolut i onary scale . The Budhi st s say t he Crown i s a
symbol of reali sat i on whi le t he Chi nese consi der i t a symbol of
t he supreme ruler . The Chri st i an concept of a Crown shows vi c-
t ory over deat h whi le t he Romans used t he Crown as a symbol of
Vi ct ory . The Hi ndu i deali sm of t he Crown i s t hat i t i s a symbol
of t he Celest i al Heavens .
The Tarot cards at t ri but ed t o F: et her are t he four Aces and
t he followi ng ext ract from Golden Dawn Tarot papers adequat ely
explai n t hi s .
" Fi rst i n order of i mport ance are t he four Aces, represent -

I
i ng t he force of spi ri t , act i ng i n and bi ndi ng t oget her, t he four
scales of each element ; and answeri ng t o t he domi ni on of t he
let t ers of t he name i n Ket her of each . They represent t he radi -
cal forces . The four Aces are sai d t o be placed on t he Nort h
Pole of t he Uni verse wherei n t hey revolve, governi ng i t s revolu-
t i on ; and ruli ng as t he connect i ng li nk bet ween Yet zi rah and t he
mat eri al plane of t he Uni verse . "
Ambergri s i s t he perfume of t et her and i s processed from t he
i nt est i nes of a whale . I n i t s i ni t i al st at e i t i s black but on
exposure t o t he sun and ai r i t s colour changes t o li ght gray and
i t s odour t hen develops . I n Europe Ambergri s i s sai d t have
speci al rejuvenat i on powers .
The Rosi cruci an grade allot t ed t o t hi s Sephi ra i s t hat of
I psi ssi mus whi ch i s symboli sed by t he numbers 1 0 =1 .
L9/ pg 1 0
The fi nal
I
4 4
M
pat h leadi ng t o t hi s grade i s Aleph whi ch shows t hat t o
t hi s level one must become li k e a chi ld i n all i t s i nnocence and
puri t y . Thi s part i cular grade shows t hat one has at t ai ned t he
hi ghest levels possi ble i n t he Rosi cruci an Order .

From a t ech-
ni cal vi ewpoi nt t hi s grade i s i ncluded i n t he grade st ruct ure
only as a poi nt of reference for at t ai nment as i t would be i mpos-
si ble for a normal human t o reach i t . Some t emples who follow
t he Rosi cruci an phi losophy have act ually gi ven out t hi s grade t o
Order Heads . Si nce t he Sephi rot h of t he supernal are i n fact
unmani fest ed poi nt s of reference, t he hi ghest grade one should be
able t o obt ai n t hrough a Rosi cruci an Order i s 7=4 whi ch
ponds t o t he Sephi ra of Chesed .
L9/ pg 1 1
approach
corres-
From a numeri cal vi ewpoi nt Ket her i s t he Monad (whi ch means
Uni t y) and i s t he sum t ot al expressed . I t i s a number unable t o
be di vi ded and when mult i pli ed (by i t self) can go on i nt o i nfi n-
i t y wi t hout alt eri ng i t s value .
i
I
I
I
I
T I TLE :
TI TLE I N MI CROCOSM:
KABBALI STI C SOUL :
ATZI LUTH NAME :
BRI ATI C NAME :
YETZI RI ATI C NAME :
ASSI AH - PLANET NAME :
QLI PPOTH :
HI NDU DI ETY:
EGYPTI AN DI ETY :
GREEK DI ETY:
ROMAN DI ETY:
GEMSTONE :
MAGI CAL WEAPON :
AROMATI C :
TAROT ASSOCI ATI ON :
VI RTUE :
CHAKRA :
ROSI CRUCI AN GRADE :
MAGI CAL POWER :
L9/ pg 1 2
ASSOCI ATI ONS
KETHER, THE CROWN
THE CRANI UM
YECHI DAH
AHI H
METATRON
CHAYOTH HA-QADESH
NEPTUNE
THAUMI EL AND KERETHI EL
ATMA
PTAH
ZEUS
JUPI TER
DI AMOND
FYLFOT
AMBERGRI S
FOUR ACES
ACCOMPLI SHMENT OF THE GREAT WORK
SAHASARAI S
EPSI SSI MUS
UNI ON WI TH GOD
1
4 4
I
I
M
E ON 10
HO AH - W DO
'The

second

Path ( ephira

is that
I ntelligence :

I t is the Crown of Creation, the Splendour


Unity,equalling it, and it is exalted above every head,
named by the Kabbalists theSecond Glory . '
From a simplistic
point of llumination hence its title Wisdom

This type
illumination is not to be confused with that of ether which is a
point of departure into another level Being exalted above every
other head refers to its station above the abyss

The reference
the rown f reation alludes to hokmah being the first
separation from the hub of tether and the first venture into
polarity hence the creation from the rown of ether
viewpointthismeansthatChokmahis
hokmah is the first of the ephiroth to develop polarity
and as such sits on the top of the Pillar of ercy ince the
point is associated to ether to illustrate its beginning we in
fact take this further by the point extending t

the straight
line one of the symbols of hokmah

The force flowing into


hokmah from ether is predominantly masculine and it must
assumed that this ephira is an active one as well and uses the
new creative energy to its fullest The definition of wisdom
according to the Oxford dictionary is being wise possession of
experience and knowledge together with the power of applying them
L . 1too/ pg
I lluminating
and
the
critically or practically
upernal ather
convey the father image and it is no accident that it is
similar to that of ether for though it is androgynous` it still
appears to convey the masculine concept

Where it differs from


`
hokmah is that it attempts to show the power behind the ather
by use of the principle of luminosity hence such titles as White
Head etc
One of the rabbinical titles of hokmah is the reat or
`
This archetype concept is in fact an ideal one
pg
2
rom this it can
be
deduced that the archetype concept
ether is to use the masculine head of hokmah with a
Restored") that AB as the potential sign united to that
interior activity produces a root whence come all ideas
productive cause
this root is applied especially
bright
light shining through it AB is also a title of hokmah of which
abre D Olivet makes the conclusions ( in his "The Hebraic Tongue
of
efficient will determining movement creative
force

n many ancient idioms and particularly in the Persian


to the aqueous element as prin
ciple of universal fructification He then goes on to say AB
all ideas of Paternity

Desire to havethis is of course


the personification of the masculine principle in nature
n one application of the formulea of Tetragrammaton to the
Tree of ife Yod is hokmah Heh for Binah Vau for the next six
ephiroth and Heh ( final) to alkuth n the Zohar the Book of
esser Holy Assembly further states And all things are created
in Yod VD and therefore is the ather of all the ather of
athers!

The beginning is called the home of all

Whence Yob
44
t
cluded as a part but a whole

Yod
energy cannot help be anything but the
tO pg 3
VD is the beginning and end of all ; like it is written Ps
V 24 "All things in hokmah thou hast made" n his place he
is not manifested neither is he known When he is associated
with the other ( Binah) then he is made known This quotation
may appear cryptic to some at first glance but in reality is
very clear statement

irstly as Tetragrammaton applies as a


whole to ether Yod the first and masculine principle will go
to hokmah who epitomises it Heh being feminine goes to Binah
Vau covers the central theme while Heh ( ) can only be YHVH yet
is not to be confused with the application of YHVH to the four
Worlds

n this particular analysis of YHVH ether is not in


as masculine procreative
beginning and the end
a force in its own right Yod has no beginning because there is no
eminine polarity to establish it as asculine for without
Negative there can be no Positive
hiah ( pronounced A YAH) is part of the abbalistic soul
associated to hokmah ac regor athers says n hiah is the
beginnings of the self of man The real elf is in Yechidah and
its presentment is in hiah n Hebrew h AH means "living
reatures" and has a numerical value of 23 which when taken back
to its root form means "being vigorous strong and living"
Another title for hiah is "Animal oul" which of course is
reference to the base motivation of man hiah in Jungian
psychology corresponds to the Animus the masculine essence of
the human psyche
means "He who impels ; to force" it also means
of the nature of Yah as applied to hokmah
O pg 4
t must not be forgotten that hokmah as a ephira is in
fact a receptor for the dynamic principles it receives from
ether and its function is to stimulate that creative aspect of
it which can only be considered as masculine Though Binah is a
ephira created from hokmah ( by extending its feminine aspect)
"overflowing
abounding" and "exalted"

All these are of course attributions


Here we have
hokmah as an initiator of explosive force but directed in a
it helps to associate one with the other for they are both the
essence of polarity that shapes the Tree of ife

hokmah in
fact merely expresses the masculine concept of tether

As
creative force it personifies energy powerful and creative but
as yet still only the form the impetus that makes the initial
start of the project The blueprint within is still underdeve
loped enough to weld together the two forms of polarity which is
finally united in alkuth Because of this partly blind force of
hokmah it is equated with living creatures and animal soul
( considering the process of descent on the Tree) it is not deve
loped enough ts title of "Wisdom ( and ntellect)" refers to
just that it is a quasi form of part energy and matter co
existing in the same time continuum before it has fully pro
jected into matter to act out its form of karma
The influence of the world of Atziluth on hokmah is shown
in the vibration of the Holy Name attributed to this level This
is the mantra of the great od Jehovah shown in simple terms as
Yah ( a derivative of YHVH)

By ematria this equates to and


4
i
t
P
Angels called the Auphanim
O pg 5
positive format
The Briatic influence is in the name of the archangel Raziel
( sometimes called Ratziel) who was the author of the book
Raziel Wherein all celestial and earthly knowledge is stored
The purpose of Raziel s influence is to provide us with the means
obtain knowledge and wisdom His book as an example is
symbolic of a framework blueprint or terms of reference that one
can express oneself through based on macrocosmic and microcosmic
principles The numeration of Raziel is 248 and means "exchange
one thing for another" two other meanings can also be used
"spread" and "spear" The latter has certain phallic ramifica
tions connected with the masculine creative force of hokmah
The Yetziratic effect on hokmah is through the hoir
which when translated means "wheels"
and "many eyed ones"

The Auphanim literally stir one into


action by initiating the whirls of karma through the
There are in fact two ways of spelling Auphanim in Hebrew
intellect
with
one valuation of 87 meaning to leap or parry at their prey
The other numerical value is 747 which is from the Hebrew root
Z N( f) meaning "To appoint an appointed time" The former shows
the swiftness of their action while the latter relates to timely
application of it A good association to these two principles is
shown in the space time curve
The influence of the world of Assiah on hokmah is firstly
through the effect of the planet Uranus This brings about great
u pg 6
and sudden fluctuations with electric rapidity The destructive
aspect of Uranus is only when there is a blockage and its power
ful forces cannot be expressed The effect on us is sudden
awareness realisation and drastic changes in consciousness The
keyword f Uranus is "new" as it brings forth new ideas and
concepts in such a manner it is often termed " iberator" Dane
Rudhyar considers that Uranus is the creative power of the
Universal pirit
bashan)

They attach themselves unto lying and material appear


ance and their form is like that of black evil giants with loath
some serpents twined around them " The
ephira of the unholy tree is Beelzebub
evi chief thi s
Another title for this
arch demon is " ord of the lies" n the " ospel of Nicodemus"
hrist gave Beelzebub presidency of the Underworld ( making him
second only to atan in hierarchy) for allowing hrist to take
Adam and the saints from Hell to Heaven against atan s wishes
The virtue of hokmah i s Devotion This i s formed from the
piritual Experience of hokmah which is "meeting of od face to
face" By the process of ascent on the Tree if one gets to the
level of hokmah they in fact meet an aspect of their Higher elf
( which is a reflection from ether) which strips away barriers
and allows them to see their true selves and the motive for their
continued existence on this planet as such their devotion to
J
The Qlippothic Demons associated to hokmah from the World
of shells are the Zogiel ac regor athers says Unto hokmah
are referred the Dukes of Edom and the Zogiel ( from O ing of

44
b
in the godhead
pg 7
this cause is then revealed to them When one descends the Tree
it is the devotion of the Higher elf ( to man) which is the
stimulus for his continued existence
The vice of this ephira is "obsession" and is when the
conception of devotion is overtaxed and devoid of any love
Though the allegiance is still there its perspective has shifted
and the reason for devotion is lost One is going through the
motions with no idea of why other than it is an obsession
The agical Weapon for hokmah is the " nner Robe of lory"
part of nostic terminology showing the pathway to conception
ether

Brought down to simple terms it is the


female doorway to fertilisation the uterus On its own it
cannot produce conception without the masculine power of hokmah
n short it is the entrance way or framework in which the
energies can express themselves The framework in this instance
clearly shows that it is a way to a new level of existence
The Tarot has two sets of symbolism associated to hokmah
The first are the ings described by ac regor athers in the
olden Dawn papers as

The four ings or figures mounted on


steads represent the Yod forces of the name YHVH in each suite
The radix ather and commencement of material forces a force in
which all others are implied and of which they form the develop
ment and the completion A force swift and violent in its
action but whose effect soon passes away and therefore symbo
lised by a figure on a steed riding swiftly clothed in complete
armour
The second set of tarot associations to hokmah are
four two s symbolise the powers of the ing and Queen just
uniting and initiating force but before the Prince and Princess
are thoroughly brought into action Therefore do they generally
imply the initiation and fecundation of a thing
pg 8
The
The Hindu association of subtle body centres to hokmah is
the Ajna hakra This is situated between the eyes and is des
cribed a two petalled lotus white in colour eadbeater who
did some clairvoyant studies on this centre described it as
either a rose colour or a purplish blue n Tibetan scripture
the Ajna hakra is included as part of the petalled lotus
which is centered at the crown Overall the actions this
centre seemed to be agreed by all as controlling the mental
faculties of the individual
sis is one of the Egyptian godforms attributed to hokmah
because of her faculty of Wisdom Though sis i s a woman i t i s
what she represents that is important and in this instance it is
a certain aspect of her nature t must be considered that there
are a number of versions of sis throughout the various Egyptian
dynasties that illustrate this quality One such example is sis
the orceress

Two early reek ods of this ephira are Athena


and Uranus Athena was considered to be the oddess of Wisdom
who sprang fully armed from the brain of Zeus Uranus i s the
personification

f man s ideal of Heaven

He united with his


r
i
t
t
r
pg 9
mother aea to produce the twelve Titans the first race n the
was the
guardian the gates of heaven and was the Alpha Omega
associated with the beginning and the end of the day
Roman pantheon we have Janus
The precious stones

hokmah are the Ruby and the


Turquoise

The
the two faced god who
magical influence of the Ruby was to give peace
and harmony to the owner and protect his belongings against the
tempests The Burmese thought that the Ruby made the wearer
invincible The Turquoise was also a stone of protection ( mainly
against falling) and was also an amulet for horses The Persians
thought that when the reflection of the new moon fell on this gem
one would attain good fortune and escape evil happenings
Phosphorus is one of the ineral Drugs of this ephira

t
aids in general growth and repair
fats and starches
work by helping to break down
The Amaranth is the plant of this ephira and is formed from
the reek word which means "unwithering"

t is said to
plant of immortality ( due to its healing properties) and was used
to decorate the tombs of the dead Another magical influence of
this plant is that it is said to make the wearer invisible ( when
woven into a wreath) The perfume here is usk and is considered
an aphrodisiac

t is said to stimulate the male sex hormones


and make him more virile
The ross is a symbol of hokmah and is about the most used
pg
symbol we have today rom a psychological viewpoint the ross
shows stability and the union o opposites ( in balanced
format) The Egyptians had the ross as a symbol of immortality
and health
universal concepts
perfect harmony and balance
Broken down into its etymological meaning

the Ak
or Os ( light of the great fire) one can try to obtain its
n the nostic doctrines it is a symbol of
while the Hindus say that the two
intersecting lines are mans higher and lower natures merging
slam the ross stands for expansion and exaltation and relates
to a high level of spiritual development in which one identifies
with od or complete rapport with the higher self for a more
simpler definition
The Rosicrucian grade of hokmah is that of agus and is
illustrated by the numbers 9=2 f one attains this level he or
she would in fact transcend the influence of the planets and
karma and would be an adept with access to "Divine Wisdom" He
would in fact be able to control the elements and transcend the
laws of nature as well

ike all the grades above the Abyss the


agus transcends existing framework but continues work
essence of self which has been expressed by the lower grades
The rench Occultist Eliphas evi sums up the epitomy of the
agus best agic is the divinity of man achieved in union with
faith ; The true agi are men gods in virtue of their intimate
union with the Divine Principle They are without fears and
without desires dominated by no falsehood sharing no error
loving without illusion suffering without impatience for magic
on the
t
4
r
O pg
implies superiority

mastership

and

majority

signifies
emancipation by knowledge

The man god has neither rights nor


duties he has science will and power He is more than free h
is a aster ; he does not command he creates ; he does not obey
for no one can possibly command him What others term duty he
names his good pleasure ; he does good because he wishes to and
never wills anything else he cooperates freely in everything
that forwards the cause of justice and for him sacrifice is the
luxury of the moral life and the magnificence of the heart
is implacable towards evil for he is without a trace of hatred for
the wicked
The dyad is the number of hokmah and it is sometimes called
"The nterval between multitude and the monad" as it has not
reached perfection though it is part of it Proclus says The
Dyad is the medium between unity and number for unity by addi
tion produces more than by multiplication ; whilst the dyad
whether added to itself or multiplied by itself produces the
same

Other titles of the Dyad are " ountain

ympathy"
"Harmony" and " ntelligible ntellect"
n the terminology of Jungian Psychology hokmah is the
Animus the male or masculine essence of self expressed through a
feminine framework in this instance the Pillar of ercy The
Animus is something that can not really be confined to a single
individual but can also manifest in groups as well and in this
instance the wording groupings would be more appropriate t
also must be considered that the Animus in terms of development
O pg
is still more or less a frontier state with a further need for
transformation and development with the ultimate aim of unifica
tion with the Anima
4
r
r
T T E
T T E N RO O
ABBA T OU
ATZ UTH NA E
BR AT NA E
YETZ R AT NA E
A AH P ANET NA E
Q PPOTH
E YPT AN D ETY
REE D ETY
RO AN D ETY
E TONE
A A WEAPON
A A EXPER EN E
ARO AT
VE ETAB E DRU
NERA DRU
P ANT
AN A
TAROT A O AT ON
V E
V RTUE
HA RA
RO RU AN RADE
A O AT ON
c; O pg
HO AH W DO
REAT UPERNA ATHER
H AH
YAH
RAZ E
AUPHAN
URANU
THE ZO E AND BEE ZEBUB
ATHENE AND URANU
JANU
RUBY AND TURQUO E
NNER ROBE O ORY
V ON O OD A E TO A E
U
HA H H
PHO PHORU
A ARANTH
AN
OUR N AND THE 4 TWO
OB E ON
DEVOT ON
AJNA
A U
r
t
into manifestation

A N means faithful and is

title of
E ON
B NAH UNDER TAND N
The third Path ( Binah) is the sanctifying ntelligence and
is the foundation of Primordial Wisdom which is called the
reator of aith and its roots are A N and it is the Parent of
aith from which doth aith emanate
The above statement from the epher Y etzirah tells us that
the ntelligence f Binah is still in the state of holiness
because it is still an unmanifested point before it is expressed
in hesed t is the Primordial Wisdom because it is the first
order of development now that a definite polarity has been estab
lished on the Tree The title reator of aith has many hidden
meanings to it

aith is not only devotion and belief but is


when one follows a chosen path in life
pgl
As such we have the
creation of a following of the idea expressed by both Binah and
hokmah now that their influence is ready to cross the Abyss
ether hence the reference to its roots which merely further
expresses the idea of faith which is considered the ideal truth
of the universe
Binah is the essence of female polarity and is the di ect
opposite of hokmah ts English meaning is Understanding whi h
is intended to show the receptive quality of its nature ome
have associated the idea of form to Binah but it must be
to the
pg2
remembered that Binah is the opposite in polarity to hokmah and
as such form is not yet developed only polarity This is
formed from the pent up passive energy expelled from hokmah
The key word to describe this ephira is " eminine" and is asso
ciated to the great mother principle of nature ts entire
concept is one of acceptance to any force that comes to it
One of the titles of Binah is hekinah which is described
Hebrew texts as the feminine side of od s nature ( as opposed
martial powers of Jehovah who destroyed armies) and
reside"

cholem
derives from the Hebrew word chachan "to
reported to lead hekinah back to od and unite her with him is
the true purpose of the Torah This is purely abbalistic in
concept and means that to unite Binah and hokmah one then forms
ether the odhead
the terminology of Jungian psychology the Anima is
applied to Binah Joan orrie author of A B of Jung s
Psychology says The Anima is in contact with the objects of
inner reality the images of the ollective Unconscious as the
Persona is in contact with the objects of External reality
precipitate of mans age long impressions of a woman

not
The
Anima is an archetypal figure that might also be described as the
his
conscious reasoned ideas but the unconscious inherited mould
into which she is cast
The Neshamah is the part of the abbalistic oul associated
to Binah

einingen considers that the Neshamah as the third


a
P
The virtue of Binah is said to be ilence while its vice is
Avarice As opposites these are very unsatisfactory as a cor
rect opposite to Avarice would be more like Unselfishness This
slightly disjointed association between the sins and the virtues
of the ephiroth is because both these associations are taken
from completely different contexts An example of this is that
the virtues of the ephiroth are taken from the Ten Pythagorian
Virtues

Dion ortune used part of a planets influence to des


cribe the attribute of Binah while areth night related it t
occult secrecy
i pg3
part of the soul can be designated by the word pirit in the New
Testament concept the passive sensitivity in it relating to the
external nature is no longer present Activity dominates recep
tivity and the spirit lives off its own lifer existence for the
piritual world with which it maintains a constant relation
However like Ruach the Neshamah with its own concept of ideal
nature has no more need of more than absolute general or divine
emanations for its nature is real and calls for some relation
ship with the reality of the material world which exists below
it
yet both these concepts could apply equally to
any other planet or ephiroth n its correct context relating
to its reek origins ilence stands for the virtue of the
individual who knows not to push himself forward until others
might have their say and thus have a chance to develop
The agical Weapon of the Outer Robe

oncealment in
simple terms i s the vagina for i t i s the gateway to the uterus
the female opening which conceals the inner passages This
turn relates back to the concept of fertilisation taken back
its base roots
can

likened to the circumference of the circle while the


centre is receptive to the penetrating masculine force
The agical Experience of Binah is said to be one of orrow
By association it can be shown that within the feminine archetype
of the other her functions are to give birth and watch her
children through life Though motherhood is linked to other
ephiroth when applied to Binah it gains a special significance
but here it is the parting aspect we are concerned with There
are many analogies we can associate here such as the mourning of
sis the suffering of the blessed virgin at the cross etc or
in nature motherhood gives birth then separation occurs which
shows the sorrows of the self as applied to development
Two titles given to Binah are of particular nterest the
first is Ama the dark sterile mother and Aima the bright
fertile mother

The former is derived from the Hebrew root A


meaning " other origin
pg4
ts relationship to Binah is a primal one in symbolism showing
in
The Outer Robe is in fact the passive state and
source family measure and matrix"
This in turn was derived from the Arabic which ( whether as a noun
or a verb) has much the same meaning Aima is taken from Al
which means the essence of fixation of the Will Aima was origi
nally Be Aima which in the esoteric sense shows the mother
impregnated with the son

The Zohar says

n His place He is
not manifested neither is He known when He is associated with
44
r
and go

or here Binah is the reat other aea


Tzaphkiel ( which means contemplation of od)
i pg5
the mother Be A A then is He made known ( otherwise symbolised)
in the mother BA A This concept is more easily grasped in
terms of polarity for in descent on the Tree Binah is impreg
nated with the sperm from hokmah A A n terms of A A the
sterile other she has yet to merge with hokmah for the reuni
fication of the Anima and Animus
The influence Atziluth on Binah is YHVH E OH which
stands for ord my od The ephira of Binah according to the
Zohar is BN H which is Ben Yah on of H which is an amalgama
tion of hokmah and Binah n this instance the son redeems the
mother through regression This takes the essence back to the
womb the matrix mother of us all from which all things come
The thing to
remember is here Binah absorbs and revitalises all who come to
her but not without complete change
The Briatic world of Binah is governed by the Archangel
and indicates that
nothing escapes Tzaphkiels scrutiny this meaning further
strengthened by the application of ematria to Tzaphkiel = 3
which means to extend view attentively and make equal All
these are of course differing aspects of Tzaphkiels nature As
the Watcher Tzaphkiel uses the Briatic influence to observe and
record He is in effect a balancer or equaliser for these
energies by presenting both sides for consideration t is his
job to present the total case not to decide the outcome n
simple terms the Briatic influence of Binah is to make visible or
pg6
bring into manifestation so that other forces of this ephira can
act upon them
Binah the Yetziratic influence is through the angelic
hoir called the Aralim which when translated is "The Valiant
Ones" and i sometimes called "the Order of Thrones" The
Aralim utilise the principle of Heroics relating to the defence
of the throne of Bi nah i nah i s a eph i ra of new life and
formation for those that come throught he Abyss The Aralim
patrol the boundaries of their world and hold back the dark
forces of the Abyss that try to escape into the higher realms as
well as rescuing the souls that make it through the Abyss on
their upward journey The Aralim are protectors of the womb the
place of growth it is their duty to allow growth to eventuate so
that the evolutionary should continue its journey back to its
source
The World

Assiah brings the planetary influences


aturn into Binah When applying planets to ephiroth like Binah
it is extremely important to utilise their esoteric meanings as
well as the mundane

The astrological influence of aturn


that of a teacher who brings the student through to reach
rity and takes on the father image One of the earlier archetype
images showed the apparently evil aspect of aturn as a giant who
devoured his own children which typified the self destructive
forces that can be unleashed by this planet

Now aturn in one


instance is the concept of analytical and rational thought

The
dark aspect of aturn however is a deep undercurrent that often
matu
t
t
r
pg7
surfaces and hence a certain fearful association is given to this
planet

With discipline on the positive side and fearfulness


the negative aturn is indeed a planet of vast changes
The Qlippothic element associated to Binah are the atorial
and are known as the oncealers or the Destroyers whose form and
appearance are as gigantic black veiled heads with
hideous eyes they are followed by evil centaurs which are called
the eiriel because of their hairiness nterference is a good
word describe the Qlippothic influence of this ephira on
human kind The energy here reaches out and tries to interfere
as much as possible with the development of man on the evolution
ary scale The atorial try to keep man in Assiah by making him
appear dull stupid and a slave to his senses so that he cannot
reason that there is a godhead in ether in the upper Tree that
must aspire to The atorial prevent any form of education
that exists in a systematic format n short they try to pre
vent the esoteric orders from establishing themselves Also the
atorial give energy and direction to those who establish
esoteric schools that constantly adore and bring forth the energy
of the adverse Tree
The first set of Tarot r embolism attributed to Binah is the
4 threes which show realisation of action owing to the Prince
being produced the central symbol of each card t shows
action definitely commenced for good or evil The second set of
on
horns and
the
tarot symbolism associated to this ephira are the four Queens
who are depicted as seated on Thrones representing the forces of
forth
of the divine name in each suit ; the mother and the bringer
f aterial orces ;
pg8
a force which develops and realises
that of the ing ; force steady and unshaken but not rapid
though enduring t is therefore symbolised by a figure seated
upon a throne but also clothed in armour
Nephthys is one of the Egyptian godforms associated
Binah

he is the sister of sis and a personification of the


The mother barren aunt which is shown by her love for Horus
instinct and rebirth principle are polarised in the myths
Nephthys and the corpions

n relation to this
Horus was bitten by a corpion and killed The lamentations of
sorrow and grief f sis and the love for her nephew moved
Nephthys to contact the oddess of corpions who in turn urged
her to pray to Ra for help On hearing her prayers Ra stopped
his celestial boat and sent down Thoth who brought Horus back to
life Hence the concept of both rebirth and sorrow associated in
one myth

sis is of course another association here and her


grief is epitomised by the grieving mother concept Nephthys
through her actions brings in another association to Binah that
of compassion
The hristian concept of the blessed Virgin ary is one
association to Binah as are the Roman ods and oddesses Juno
is one such example wife of Jupiter ing of the ods Because
of this Juno took the titles of Queen of Heaven and The Ox eyed
other Her specialities were the protection of women and
marriages

Hecate is another such example and was one f the


her nephew
t
44
r
t
r
di ety Demeter is another reek diety ( who protected marriages)
that can also be associated to Binah as can Hera ( daughter
Rhea and ronus and sister to Zeus)
The precious stone of Binah is the apphire which was
originally worn by royalty as a protective talisman and was
generally set in bracelets and necklaces The oral tradition of
this stone is traced back to oses
word of god enscribed on tablets of
pg9
mighty Titans he was the daughter of Perseus and Asteria and
taught the esoteric arts of sorcery and witchcraft and was the
goddess of the Underworld Binah is also ybele mother of the
Olympic gods and wife of ronus and became the supreme mother
whom it is said received the
apphire n later years the
Ecclesiastical aspects of this stone became evident when it was
worn by high officials of the hurch The stone in fact was used
( in ring form) as a symbol of other hurch Also legend has
it that it can be used as an antidote against poison Albert
agnus cites the apphire as being able to remove all impurities
from the body The apphire as a curing gem worked more on eye
diseases boils and tumours than any other afflicted illness
The method utilised was simply one of just rubbing the stone over
the troublesome area
The plants of Binah are many but generally speaking the
ypress and the Opium Poppy are two of particular interest
ypress means Death or ourning while the Opium Poppy governs
dreams Just about any narcotic plant though can be associated
to Binah

A further list of some of these is as follows


pg O
Agrimony Amaranth Asafortida Beech Belladonna Birch
Bloodroot inquefoil omfrey opal Dragons Wort Elder ern
laxseed outwort Hemlock Hemp ( ndian) Horse Tail andrake
onkshood ugwort ullein ushroom Nightshade Onion
Parsnip Patchouli Plantain Poplar Rue t Johns Wort
olomons eal Tansey Tobacco Vervain and Wintergreen
iquid ilver is the mineral drug of Binah and is associated
renewed energy like a child a state synonomous with the
rebirth principle both physically and psychologically ilver
as a drug helps the digestive tract and the nervous system
ike all drugs ilver must be given in moderate doses or poison
will set in ( causing such things as sensitivity to light
Applied externally the ilver drug can remove skin encrustations
and also works as an equilibrium restorer helping those who
daydream too much or those individuals who are affected by the
unar influence which is sometimes called oon sickness ilver
can remove the adverse affects by stabilising both mental and
emotional health during the crucial period of ull oon
A vegetable drug associated with Binah is Belladonna t is
composed of Hyoscyamine Aropine copolamine Belladonna along
with other ingredients The effects of this drug in herbal terms
are Narcotic Nervine Diuretic edative ydriatic ebrifuge
and Tonic The drug has a bitter taste is odourless and is
"obtained from the root of the plant

The name Belladonna


derived from the reek which roughly translated means to b
inflexible

A herbal tincture can be made from the leaf to help


is
4
r
A
t
ii pg
get rid of ulcers though it is stressed that the drug is danger
ous and must be administered carefully
yrrh as a perfume was extremely important in ancient times
and its uses are said to have originated in Ethiopia ts sacred
value was for annointing the dead at funeral ceremonies n the
biblical sense yrrh was one of the gifts brought to the infant
Jesus by the three wise men yrrh was known to be used in Egypt
around 2 B though it is speculated that this was a perfume
of Atlantis The magical effects of its aroma on the body of the
anointed was to keep the auric residue in empathy with the planet
aturn the planet of death so that the transition would go over
smoothly This prevents an elemental from trying to take over
the dead body Another perfume of Binah is ivet which was used
to overcome impotence This is obtained from the puch ( near the
sexual organs) of a member of the cat
tions used by this animal is one of
family
commercial use it must be aged to attain its full odour
The Triangle is the geometric figure of Binah and epitomises
the threefold nature of the universe The three lines are from
three polarised vibrations positive negative and neutral which
is the central influence between the two and produces the stabi
lising effect The actual direction of the triangles apex though
is extremely important for if the apex is placed facing any of
The ivet secre
territorial markings
the four cardinal points the entire meaning of the triangle
altered

or example if the apex is pointing outh the triangle


takes on a feminine outlook a passive nature while if pointing
is
pg 2
the North it is exactly the opposite acing East the Apex
indicates the direction of renewal and growth while if the Apex
is pointing to the West it indicates darkness and the completion
of full cycle The hinese use the triangle as a symbol of
life while the hristian concept equates it with the mysteries of
the Blessed Trinity The reeks used it as the letter Delta the
entrance to life
The Vishuddha chakra center ( at the Throat) is associated to
Binah ts colouring has been described as a smokey purple and
its geometric symbol is a downward pointing triangle in a circle
within 6 petals On each petal a vowel is written which in turn
relates to a specific diety

Within the triangle of Vishuddha


there is also an elephant which is a symbol of the strength
this centre The spiritual influence of Vishuddha speech
( sound or vibration) This chakra can free man of his destiny or
karmic ties by shifting the entire life forces to the spiritual
editation on this chakra will release the cosmic knowledge of
past present and future On the physical level once the correct
vibration this centre is attained one can be free from the
diseases of the body because the negative influences ( of the
spiritual which cause these diseases) are understood and held in
check The gland this chakra covers is the Thyroid
The Egyptian concept of the Anima undi ( oul of the World)
was the Ba The Anima undi is also one association of Binah
but its Egyptian counterpart is of particular interest Because
the Ba represented such a vast association a multitude of dieties
4
r
where masters meet
level to guide and change the econd Order within the scale
the evolutionary process
pg 3
were associated to it Nevertheless the principle of Anima undi
( as it is called today) is deply manifested in Ba While the
World Body was Osiris the World oul was the force that mani
fested behind it The Platonic conept of Ba was called Anima
edia Natura abbalistic concepts the Ba is Adam admon
while to the hristian it is the osmic hrist
The Alchemical application to Binah is alt This is the
divine essence of material substance which is laid bare through
the process decay ome have called this the process of
Understanding through suffering The relationship of salt to
the material is through the earth element the feminine fixed
process t is also important to note there is a strong una
affinity as well alt in alchemical terms is part of the first
matter which is the stabilising factor in the unification of the
two principles of ulphur and ercury
The Rosicrucian grade associated to Binah is called agister
Templi aster of the Temple and is signified by the numbers
8=3 The signification of this grade is reflected in the title
especially the term aster which means that one has in fact
mastered the technical matters of the econd Order which is the
structural confines of the Rosicrucian philosophy The Third
Order is one that in fact transcends structures and is the plane
t is the function of one who attains this
T T E
T T E N RO O
ABBA T OU
ATZ UTH NA E
BR AT NA E
YETZ RAT NA E
A AH P ANET NA E
Q PPOTH
H NDU ON EPT
E YPT AN D ETY
REE D ETY
RO AN D ETY
E TONE
A A WEAPON
A A EXPER EN E
ARO AT
VE ETAB E DRU
NERA DRU
A HE A A O AT ON
P ANT
AN A
TAROT A O AT ON
V E
V RTUE
EO ETR A O AT ON
RO RU AN RADE
A O AT ON
B NAH UNDER TAND N
R HT DE O THE A E
NE HA AH
YHVH E OH
TZAPH E
ARA
ATURN
THE ATOR A
V HUDDHA HA RA
NEPHTHY
DE ETER
JUNO
APPH RE
THE OUTER ROBE O ON EA ENT
ORROW
YRRH & VET
BE ADONNA
QU D VER
A T
YPRE & OP U POPPY
WO AN
THE QUEEN THE 4 THREE
AVAR E
EN E
TR AN E
A TER TE P
pg 4
a
ft
L
1
0
I
t
r
f
L.1 ^/pg 1 .
LESSON 1
CHESED - MERCY
'The f our t h Pat h (Sephir a) is called Cohesive or Recept ive
I nt elligencebecauseit cont ainsallt heHolyPower s,andf r omit
emanat ealt heSpir it ualVir t ueswit ht hemost exalt edessences .
Theyemanat eonef r omanot her byvir t uet ot hePr imor dialemana-
t ion,t hehighest Cr own,Ket her .'
ThisSephir aiscalledCohesiveI nt elligencebecausewhen
ascendingt heTr eef r omMalkut ht oKet her it ist hehighest level
of development int er msof manif est at ion(showingt heunif icat ion
t hemasculineGebur ahwit ht hef eminineChesed)f or whent he
Abyssiscr ossed,manif est at ionislost t oemanat ion .I nt er ms
descent ,ChesedisRecept iveI nt elligencebecauseit ist he
manif est edpoint of Binah -t heMot her - andassuch,r epr esent s
t hat r ecept ivit yassociat edwit hit sf emininenat ur e,henceit s
t it leof Mer cy .
Chesedisnot onlyt heSephir aof Mer cybut t heDaught er
Binahaswell .

Sinceit isf or medf r omt her ecept ivepar t


Binahit t akest hat par t of it snat ur ewhichis ext r emeand
st r ongest ,gr ant ingclemencyandhopet oallwhoent er or dr aw
f r omit sr ealm
.Byvir t ueof it s ext r emismit scent r eist hen
consider edmasculinet houghit sout er shellshows st r ong
emphat hywit ht hewat er element
.Chesedisinf act t hest ar t or
f inish(dependingonascent or descent )of t hesecondTr iadof
suchwisht oembr aceallwit ht heet er nalloveof
cr eat ur es,f or it iswr it t eninPsXXV1 0 :

'Allt hepat hsof


Tet r agr ammat onar eChesedandAemet h,Mer cyandTr ut h .'
TheMagicalweaponof Chesedist heWandof t heChief Adept
of t heR.R.et A.C . nt her it ualof t he5=6t hef ollowing
descr ipt ion is given : 'My Wand is sur mount ed by t he Winged globe,
ar oundwhicht het winser pent sf oEgypt t wine .I t symbolizest he
equilibr iat edf or ceof t hespir it andt hef our element sbeneat h
t heever last ingwingsof t heHolyOne
.'
f or t hbyaGoldenDawnmember showsadif f er ent aspect
r epr esent at ivef eat ur esof t heWand :
L1 2/pg2
t he Sephir ot h and it s Rabbinical t it le is t he Micr opr osopus (t he
Lesser Count enance) which in simplif iedt er msist hemanif est ed
univer se,t hemat er ialisat ionof t heMacr oposopuswhichist he
gr andschemeof emanat ionsf r omt hehigher planes .
Oneof t hemagicalexper iencesof Chesedist he'Visionof
Love' .Thisr ef er st ot hef r at er nalloveof onesf ellowmanand
t his is amply illust r at edint heYet zir at icText whichst at es
t hat Chesed'cont ainsallt heHolyPower s,andf r omit emanat e
allt heSpir it ualVir t ueswit ht hemost exalt edessences' .These
ar e.of cour sedir ect edf r omt hehighest sour ce(wit hint heindi-
vidual)
.Themot ivesf or suchf eelingsar ebeyond .r epr oach
becauset heycomef r omt hedeepest year ningsof t hesoulandas
allliving
Anot her viewpoint put
t he
'Thewingeddiskalso
st andsf or t hedi
.vineeggof I sismount edonaphalluswhilet he
t winser pent sshowt hebalancedener giesof union - t hehighest
point of r eligiousideals
.Ast heequalisingf or cebalancingt he
1
1
t
1
i
40
1
f
1
f
0
i
L1 2/pg
t wocur r ent sr elat est ot heandr ogynusconcept wecannot helpbut
associat eit t oPhilosophicalMer cur y .'
TheGeomet r icassociat iont oChesedist hesquar eina
cir cle .Mat her sinaGoldenDawnKnowledgeLect ur e(r elat edt o
Chesed)wr ot et hef ollowing : 'Thesquar eisanimpor t ant lineal
f igur ewhichnat ur allyr epr esent sst abilit yandequilibr ium .I t
includest heideaof sur f aceandsuper f icialmeasur ement .I t
r ef er st ot heQuar t er nar yinallt hingsandt ot heTet r ad of t he
let t er of t heHolyNameTet r agr ammat onoper at ingt hr ought hef our
element sof f ir e,wat er ,air ,andear t h .I t isallot t edt o
Chesedt hef our t hSephir aandamongt heplanet sit isr ef er r ed
.
t oasJupit er .Asr epr esent ingt hef our element sit r epr esent s
t heir ult imat ionwit ht hemat er ialf or m .Thef our anglesalso
includet heideaof t het woext r emet iesof t hehor izon, and t he
t woext r emet iesof t heMedian,whichlat t er ar eusuallycalled
Zenit handNadir ,alsot hef our car dinalpoint s .Thenumber of
degr ees of agr eat cir clecut of f bet weenit sangleswillbe90
degr ees,t henumber f or mingt heast r ologicalQuar t ileor Squar e
aspect ,pot ent andevil .Ther eisonlyonewayof inscr ibinga
squar einacir cle,t hat is,r ef lect edf r omever ysecondpoint ' .
TheVir t ue of ChesedisObedienceandt hemeaningof t his
wor dist osubmit t ot hecont r olof or t ocomplyt ot hecommands
of .Whenappliedt oGr eekor Hebr ewphilosophyt hisvir t ueleans
ver yheavilyint hedir ect ionof t hewif eobeyingt hehusband
whichf it t edint ot hewr it t enandor alt r adit ionsof t het henlaw
of bot hmanandGod .However ,whent akenf r omanesot er icst and-
L1 2/pg4
point r elat ingt ot hisSephir at hat t het r uecour seof act ionof
lif ehasbeenout linedbyt heemanat ionsof Chesedandt heindi-
vidualmust obeyt heseguidelinesor pr inciplesset downbyKar ma
if t het r uevalueof lif eist obediscover edandut ilised .
TheViceof ChesedissimplyDisobedienceandt yplif iest he
act ions ,of a r ampant f or ce which shat t er s t he boundar ies of our
designsandf or t hemost par t goesagainst t hecommongood .This
showst helust f or power ast hef eminineinst inct sof Chesedar e
r epr oducedandmult ipliedt hent akent oanext r eme .
The Miner al dr ug associat ed t o Chesed is called St annum (a
homeopat hicmedicinemadef r omt in)andact smainlyont he - liver
t hough it s psychological benef it s ar e said t o br ing people out of
t hemselvesbymakingt heir nat ur emor ejovial .St annumhasa
def inedef f ect ondiseasessuchasar t hr it ist houghover allwhen
usedmedicinallyit alt er st hecellst r uct ur eandenr ichest he
bloodwhichwhensimplif ied - iscalledmolecular nut r it ion .The
ent ir econcept of t hisminer aldr ugisoneof pr eser vat ionf or if
cor r ect lypr epar edit canbeadminist er edbot hext er nallyand
int er nally.
TheGodnamef or ChesedinAt zilut hisALwhichwhent r ans-
lat ed simply means God . The Hebr aic r oot s of t his wor d show
signsof power andext ensivemovement .Asahier oglyphicsymbol
it showsbot hconcent r icandexcent r icf or ce .Ont hejour neyup
t he Tr ee ALhas t he ef f ect of loosening t he bonds of physical
exist enceandpr epar ingt hesoulf or it sjour neyt hr ought he
1
t
1 1
r t
1
i
1
1 1
I
abyss t ot he pr emat er ial st at e .
t o cr oss, Mer cy is t hen given by AL t o let
but t he success or f ailur e of t he cr ossing
individual will of t he soul . I f t hesoul is unpr epar ed f or t he
cr ossing AL will help by inst r uct ion in loosening t he Kar mic t ies
by pr oviding a lif e or ser iesof lives on ear t h t hat if t he soul
exper iences can pr ovide t he cor r ect cr it er ia f or a saf e cr ossing .
TheBr iat ic emanat ion of Chesed is r ef lect ed in t he Ar ch
Angelic name of Tzadkiel which means "Right eous of God"
ver sion of t his name is Zadkiel and when t r anslat ed

"Gods
Just ice") .

The moder n implicat ion is t hat a cer t ain


bonds of mat er ialism .
L1 2/pg 5
I f t hesoult hinksit isr eady
it depar t f r omChesed
isr eallyupt ot he
(anot her
st at eof
pur it y'(f or t hewant of abet t er wor d)hasbeenachieved .
Tzadkielwor ksdir ect lyunder t heinf luenceof ALandest ablishes
Kar micpat t er nsf or ust oobser veandwhichar einf act our last
Tzadkielinf act est ablishesalawor
pat t er nf or us't of ollowt hat isconsider edMer cif ulf or it is
hisjobt omakesur et hewheelof causeandef f ect isevenly
balanced .Tr adit ionst at est hat Tzadkielassist shisf ellow
Ar changelMichaelinholdingt heHolySt andar ddur ingt hebat t les
wit hevil .I t ist hisAr changelt hat st oppedAbr ahamf r omsacr i-
f icinghissonandassuchisof t enassociat edwit hMer cy .
TheYet zir acinf luencear et heChasmalimwhoar ecalled
"LivingCr eat ur es"andsomet imescalled"Dominat ions" .Theor al
t r adit ionassociat edwit ht hisangelicchoir is"Todominat e ;
pr ocur eliber t y ; vanquishenemies ; givet heaut hor it yof Pr inces
over allkindsof per sons - evenEcclesiast ics" .

TheChasmalim
commondevelopment of t heindividualsoulsconcer ned .

I t
t hey,onadayt odaybasis,whocont r olt heKar mic
Law of
Chesed .
Jupit er ist heAssiat icinf luenceof Chesedandhas
t het it leof "Thegr eat benef ic"becauseit sgener almeaningsar e
associat edt ogoodhealt h,wealt handhappiness .Thisist r uely
:
t heguidingplanet of t hebeaut if ulpeople .
L1 2/pg* 6
in f act have t he t ask,
dur ingour livesonear t h(whileunder t he
r eign
Chesed)of manipulat ingt heKar micpat t er ns,or in
simplet er ms,discr iminat et headver seinf luencesof t heot her
Sephir ot h .

Theybr ingt oget her andsepar at epeoplef or t he


ar eat t r ibut edt oexpansionandgr owt hinallaspect s
ones
lif e
.Theesot er icconcept of Jupit er sef f ect ivenessist o
consider gr owt hint heuniver salconsciousnessbot hinanindivi-
dualaswellasagr oupor evenonanat ionalf or mat
.The
magicalimageof Jupit er is t hat of amight yt hr onedkingwhich
isalsot heimageof t heSephir a .
TheQlippot hicelement of Chesediscalledt heGaghShekelah
andt heyar esomet imescalledt he"Dist ur bingOnes"
.Theyhave
of t enbeenseenasblackcat headedgiant s .Thechief angelsof
t heGaghShekelahar eAziel,Chat aeielandAgniel
.Their dut ies
ar evar iedbut it issaidt hat t heyat t acht hemselves weak
member sof t hehumanr acesot hat t heycandr aint heir power .I
r et ur nt heygiveinst r uct ionint heevilsciencesandt eachhow
t ousesuchar t sasast r ologyf or t hebenef it of t heQlippot hic
f or ces .

Theener gyher eisoneof gener alweaknessinmost


is
ear ned
I t sbasemeanings
1
I
1
i
44
1 1
i
L
t
f
M
r
I
L1 2/pg7
f ieldsof endeavour f r ompsychologicalt ot hephysical .
TheTar ot car dsassociat edt oChesedar et hef our f our s
whichshowt hebeginningof manif est at ion.Theemanat ionsabove
t heabysshavecomedownand
cr yst al-iced .
TheFour of Wandsas
Lor dof Per f ect edWor kshowst hehar monisingt r ansit iont hr ough
t heAbysswhilet heFiveof Cupsshowst heBlendedPleasur e
br ought about byamor et hor oughunif icat ionwit ht helower Tr ee .
TheFour of Swor dsshowsRest f r omSt r if ewhicht henewgr owt h
neededaf t er t heper iliousjour neyf r omBinah,aper iodof conva-
lescence .TheFour of DisksasLor dof t heEar t hlyPower shows
t hecomplet ionof acycle - Per f ect ion .
I nEgypt ianmyt hologyAmpnwasKingof t heGodsandwas
ident if iedbyt wolongplumes
Abyssof Wat er ,
t hisSephir a .
sur mount inghisheaddr ess .

The
hidden" .
This
wor dAmenmeans"somet hingwhichcannot bseen,
Anot her r oot f or mof AmenisMen -
.
"t oabide,per manent " .
r ef er st ot hecr eat ivepower beyondt hehor izon,t her enewer
lif e .

Hewast heGodof HeliopolisandThebes . Themainpoint


of obser vat ionher eist hat Amenisnot onlyknownf or hiscr ea-
t ivepower sbut f or hisexpansiveonesaswell(suchasgover ning
t womajor civilisat ions - at t hat t ime) .I sisisyet anot her
associat iont oChesedand'inher ear lier per iodshewascon-
sider edawat er goddess .

Thisisbecauseshespr angf r omt he


t hesour ceof lif eandhenceher associat iont o
AGr eekassociat ionher eisPoseidon,t heGr eekdivinit yof
L1 2/pg8
t heOcean,lakesandr iver s .

Hewast hesonof RheaandCr onus


andbr ot her t obot hZeusandPlut o .

Hewasagodof possessions
andwealt handwent af t er bot hgr eedily . TheRomangodof Chesed
Jupit er whichisder ivedf r omt heLat in'JovisPat er - Fat her
Jove' .TheRomanJupit er wasagodof light aswellasawar r ior
godof just ice .I t must beconsider edt hat inear lyRomeJupit er
t ookanumber of dif f er ent f or msandf unct ions,especiallyasan
agr icult ur algod,lat er t hesewer eamalgamat edint oonediet y .
TheHindugodof ChesedisBr ahamaandisadiet yof t en
depict edwit hf our f aces(whichar eassociat edt ot hef our Vedas)
showingt hedoct r ineof 'AllKnowledge' .Healsohasf our ar ms
(t hef our aspect sof inner development )andisof t enshownseat ed
onalot us,holdingalot us(higher consciousnessgr owingf r om
t hemur kyswampswher et helot usof t engr ows,higher int ellect
f r omt heclayof man) .Br ahama,asadivinit y,ist hecr eat or t o
t hewor ldandt hest ar s .Toachievet hest at eof consciousness
(inYoga)r epr esent edbyBr ahamaist oper ceivet hedivine
essencef r om which all t hings come . Cr eat ivit y and divine
inspir at ionar et wokeywor dsassociat edt ot hisdivinit y .
Anot her Hindudiet yt hat couldbeassociat edt oChesedisI ndr a .
HisaGod(of t endepict edr idingachar iot andholdingbow)
I ndr a whoisbot hanagr icult ur alaswellasawar r ior godf or m .
wast hebr ot her of Agniandandisof t encalledt heLor dof
Heaven .
Thepr eciousst oneof Chesedist heAmet hyst .I nt heancient
t ext "SpeculumLapidum(byLeonar di)"consider edt hat t hisst one
1
1
I
41
i
r
i
1
t
1
vict or yandpr ot ect edt hewear er f r omdiseases .
f par t icular impor t ancet obot hChr ist ians
L1 2/pg9
could cont r ol mens t hought s and enhance t he int ellect ual
qualit ies . As a char mit wassaidt ocur edr unkennessandpr o-
mot esobr iet y.Thisalsoext endsint omor eamor ousar eassuchas
.
quellingonespassions .

I nwar t heAmet hyst wasachar mof


I t wasast one
andRosicr ucians
shown
because it scolour r elat est ot heaspect of self sacr if ice
inbot hr eligiousdoct r ines .
TheOliveisassociat edt oChesedandwasusedinr eligious
. .f est ivalsf or anoint ingaswellasbeingusedmedicinallyasan
ast r ingent .Fr omasymbolicalviewpoint t heOliveisassociat ed
wit hsaf epassageswhichisepit omisedbyt hedover et ur ningt o
NoahsAr cwit hanOliveLeaf .Theoilof t heOliveisr epor t ed
t ohavehelpedanumber of illnesseswhenusedasademulcent ,a
laxat ive andhasalsohelpedindissolvinggallst ones
.
Accor dingt oGr eekmyt hologyt heOlivewaschosenasasymbolof
peace,andagr icult ur ewhenit waschosenover Poseidon'shor se
t or epr esent At t ica .
Themagicalanimalof Chesedist heUnicor n,usually
depict edasawhit eanimal(esot er icphilosophyconsider st hough
t hat t heUnicor nismult icolour ed)wit hasinglecur vedhor n
pr oject ingf r omit sf or ehead .Thissinglehor ninf act showst he
unif icat ionpr incipleandissaidt oabsor ballpoisons
.I t is
alsoasymbolof f er t ilit yandlegendhasit t hat t heonlywayt o
capt ur eaUnicor nisf or it t obeappr oachedbyavir ginwher eit
willlaydowndef enceless .

I t salchemical .meaningsar emanybut


gener ally it is consider edt obeacat alyst f or unif icat ion .
Opiumisoneof t heveget abledr ugs Chesed .I t is
obt ainedbybleedingt heOpiumPoppyandhar vest ingt heSap(when
it hasdr ied)
.Fr omaphysicalviewpoint ,t akingt hisdr ug
pr oduces det er ior at ionint hecellst r uct ur e
.I t smedical
ef f ect ist hat of asedat ive,anodyne,nar cot icandt oxic
.I t s
pr oper t ies
cont aincodein,nar cot ine,papaver ine,t hebaineand
nar ceine .
Themyst icalor magicaluseof t hisdr ugseemst o
elevat et hevar iouslayer sof consciousnesst hr ought t hedr eam
st at e .Aleist er Cr owleypublishedapoemint heEquinox,called
"Opium-Smoker "andisof int er est becauseit wasbasedon
per sonalexper ience .
Cedar ist he per f umeof Chesedandisanar omat icwoodt hat
hasbeenknowninBiblicalt imes
.Theper f umeext r act edf r omit
issaidt opr omot elongevit yandgoodhealt h .Themagicalasso-
ciat iont hisper f umeisoneof at t r act ingt heopposit esexandit
isalsosaidt ogivet hewear er ashr ewedbusinessinor der t o
obt ainwealt h
.Alsoit isaper f umeof just iceandpower t ot he
wear er .
TheRosicr uciangr adeassociat edt ot hisSephir aist he
Adept usExempt us(Exempt Adept )andisdepict edbyt hesymbols
7=4 . PaulFost er Caseinhisbook"Tr ueandI nvisible
Rosicr ucianOr der "askswhendescr ibingt hisgr ade'Exempt f r om
what 'andspeculat est hat it isf r eedomf r omper sonnelpar t icipa-
t ioninanyt hing .

DionFor t uneinher "Myst icalQabalah"isof


L1 2/pg1 0
r
41
1
1
1
M
r
f
t
f r omKar mict ies .
L1 2/pg1 1
-t he opinion t hat when one r eachest hislevelheor sheisf r ee
Yet anot her view of lookingat t hisgr adeis
t hat t heAdept isExempt f r omt henor malr est r ict ionst hat ar e
placedont helesser r ankswit hint heOr der .

I t ishisjob
f or geaheadnewlinksandt r ynewar easof st udysinceheisat
t het opof t heSecondOr der .

BeingExempt f r omt he r est r ict ion


of limit at ionalsoallowsper sonalexper iment at ionint of r ont ier
st at esof consciousness .TheAdept ,at t hislevel,isnot yet
f r eef r omKar maast hisoccur sonlywhent heabysshasbeen
cr ossedandt hechainsof mat er ialisat ionar eshat t er ed .
Chesedist helevelont heTr eewher eMast er sar emet and
t heir t eachingsopenupnewmyst er iesschools .

Esot er ict r adi-


t ionhasr epeat edlyst at edt hat Mast er s,(at er m t oequat et hose
beingsabovet heAbysst hat haver et ur nedt ohumanit yf or mt ime
t ot imet ohelpit ),haveappear edint hef lesh(Mat her s,Felkin
andCasehavingasser t edt heyhavemet t hem),andnot just f ig-
ment sof t hemist yAst r alplanes .Wit ht heexcept ionof Felkin
(whoclaimedt her ankof 9=2)Mat her sandCaser eachedt hegr ade
of 7=4int heR.R.et A.C .whicht heyconsider edt helimit of t he
gr adesonecouldat t ainint hislif et houghbot hst illallowed
plent yof scopef or development ont hislevel .DionFor t unemade
t hevalidpoint inher "Myst icalOabalah"whenshesaid : 'The
t it leof -Mast er shouldt her ef or ebegivenonlyt ot hosewhoar e
f r eef r omt hewheelof bir t handdeat h .'Thought hisisnot t he
GoldenDawnconcept of what amast er is(at 7=4level),

must
concur wit hher ,it hasbeenaf act t hat t ooof t enpr est ige
givent oOr der r ankswhichhumannat ur eisnot f it t edt obear .
is
level

f exper ience
Chesed i
modes of t hought . This necessit at esopeninguponeself t ocom-
plet elynewconcept s,most of t hembeyondt hepr esent compr e-
hension,,weknow .t hat wehaveachangebut ar enot exact lysur e
what t hechangewillbe .At t hispoint t heinvolunt ar yact ionof
our psychest akeover andpr opelust hr ought heAbyss .Though
t hisisbasicevolut ionandt heKar miclivesandcur r ent sdo
pr epar eus,accident sdohappenandindividualsar et hr ust ahead
of t heir t imesandit isusuallyt heywhoar ecaught int he
f ilt er sof t heAbyss .Thoughont hewhole,an'Adept whohas
r eachedt het opof Chesed,inr elat ionshipt ot heconcept sof t eh
var iousesot er icOr der s,wouldbepr of icient at t het echnicali-
t iesof t hislevelbut not t hosebeyondt hem .For it isonly
whent heAdept hasbeent akenout of t hislevel(excludingacci-
dent alcr ossings)t hat hecanbeconsider edaMast er of it .
Ar abot hist heSevent hHeavenassociat edt oChesed .I t s
meaningsar evar iedbut t her oot ARBmeaningamixt ur ehasbeen
cit edasonesour ceof it sor igin .

Alsot heHebr iacr oot sof AR


L1 2/pg1 2
Whenonef ir st ent er sChesed(inAssiah)onef indst henew
isalmost limit lessbut whent het opof
r eachedinAt zilut ht helimit at ionst henbecomejust
power andmovement whencombinedwit hBTH=
r eacht hr oughpr ayer ,medit at ion,
inner dwelling
placeisjust asvalidanassociat ion .Thet womainangelsof
t hisPalacear eZebur ialandTut r bebial .Thisheavenassur esus
of asaf eplacet hat r emainssot hr oughout et er nit yt hat onecan
andhumanact ions,ont he
ear t hlyplane .

ARBTH=603whichequat es

aplaceof
r
1
I
i
f
44,
r
t
i
A
1
I
r
r
w
I
has t o leap int o t hevoid and t r ust ing on ones past act ions f or
salvat ion . I t is * a t ime of changein ever y senseof t he wor d and
r
.abundance, in t he posit ivesense .
L1 2/pg1 3
TheKingof Edomassociat edt oChesedisJobab(YUBB=20) .
Thiswor disf or medf r omt her oot YUwhichr oughlyt r anslat ed
meansever yint elligent (luminous)manif est at ion .Thear abicand
Copt icr oot smeanbot hSunandMoonr espect ively .Thesecond
r oot BBr elat est oint er ior expansionor hollow .Whenplaced
t oget her wef indanluminousint elligenceinahollowvoid .The
r oot ChZH(20)canber elat edher eandmeansset t ledor f ixed
int oplace.Thisr ef er st oJobabbeinginaposit iont hat is
f ixedandcannot bealt er ed .Anot her r oot TATA(20)whichsigni-
f iesadeepholeor t hecr eat ionof one .
TheHellassociat edt oChesediscalledGihebemandmeans
'silence' .Thisascr ibest ot heper iodof lonelinesswher eone
showst hat if onehaspassedt het est t heywillleavet he
behindbut if not t heywillr emaint her ef or ever .I t ist het ime
wher eonespunishment isloneliness,beingf ar awayf r omt he
divinesour ceof nour ishment .
Hell
TI TLE :
TI TLE I N MI CROCOSM:
ATZI LUTH NAME :
BRI ATI CNAME :
YETZI RATI C NAME :
ASSI AH - PLANET NAME:
QLI PPOTH:
HI NDU CONCEPT :
EGYPTI AN DI ETY:
GREEK DI ETY:
ROMAN DI ETY:
GEMSTONE:
MAGI CAL WEAPON :
MAGI CAL EXPERI ENCE :
AROMATI C:
VEGETABLE DRUG:
MI NERAL DRUG:
PLANT :
ANI MAL :
TAROT ASSOCI ATI ON:
VI CE :
VI RTUE
GEOMETRI CASSOCI ATI ON :
THE HEAVENS :
KI NGOF EDOM:
HELLS :
ROSI CRUCI AN GRADE :
ASSOCI ATI ONS
CHESED - MERCY
LEFT SHOULDER
AL
TZADKI EL
CHASMALI M
JUPI TER
GASH SHEKELAH
BRAHAMA
AMEN, I SI S
POSEI DON
JUPI TER
AMETHYST
WAND OF CHI EF ADEPT
VI SI ON OFLOVE
CEDAR
OPI UM
STANNUM
OLI VE
UNI CORN
4 FOURS
DI SOBEDI ENCE
OBEDI ENCE
SQUARE
ARABOTH
JOBAB
GI HEBEM
ADEPTUS EXEMPTUS
A
t
r
1
I
f
r
because

it

r esembles

Unit y,

unit ing it self


Under st anding which emanat esf r om t he
Chokmah, Wisdom .'
The above st at ement of t he Yet zir ac Text t ells ust hat t his
Sephir a is associat ed t o Unit y and equat es t his wit h bot h Binah
and Chokmah .

f act Gebur ah and Chesed ar e mer ely t he


LESSON 1 .3
GEBURAH -STRENGTH/SEVERI TY
'The f if t h pat h (Sephir a) is called r adical I nt elligence
L_i''lpg1
Pr imor dial dept hs
manif est ed ener gies of Binah and Chokmahand hence t he
Binah,
analogy.
Theaspect f oUnit yher eisunif icat ionof Gebur ahandChesedas
asepar at epolar it y .Thet er m"Radical"meanst ouchingt hat
whichisf undament alwhichshowst heunder lyingmeaningof t he
t er m"RadicalI nt elligence" .
Gebur ahist he5t hSephir ot handhast hedualt it leof
St r engt handSever it y .

I t der ivesit spower andf or mat ionf r om


t hemasculinecent r eof Chesedwhichist heopposit eext r emef r om
Binahaboveit .

For whenMer cyandst r engt har ehar moniously


joinedt heypr oduceUnder st anding,sinceit sout er shellis
masculineandit sinner nat ur esisf eminine .

ousewor dslike
St r engt handSever it yt odescr ibeGebur ahisr eally
simplif icat ion,f or example,St r engt hwit hout
bot h
an over
applicat ionhasno
vir t ue .Byusingpolar it yonebeginst ounder st andt henat ur eof
t hisSephir aalit t lebet t er .

ChesedisMer cyandit sopposit e


is not quit eSt r engt hof Sever it ybut af or mof mar t ialaggr es-
siveness,hencet her elat ionshipof Gebur aht owar isver y
appar ent .Ther ear ecer t aindest r uct ivequalit iesassociat edt o
t hisSephir asuchashat e,anger andr evengebut allof t hemar e
based on r elat ivit yaswit hout t he
passions

Gebur ahwouldemer ge .

I nshor t ,anar myor war


cannot engagewit hout anenemy.
TheMagicalI mageof Gebur ahisamight ywar r ior inhis
char iot (ar medandcr owned) .Her ewehavet hewar r ior aspect not
onlypr epar edf or bat t lebut eager f or it as'well .

I t isf r om
t hisimaget hat t hemar t ialaspect sof Sebur ah
L1 3/pg
mer cyof Chesednoneof t he
ar eover t he
pr esent .

Wit hint hiscont ext t her eisacer t ainamount


t ensionpr esent f or her ewehavet hewar r ior const ant lyonguar d
wit halmost et er nalvigilancewhichcanbeast r ainont heemo-
1
I
i
r
4
t ionsandr esour ces .Sincet hependulumswaysbot hwaysaback-
lasht ot hist ypeof behaviour isver yr ealandshouldbewat ched
f or .
TheMagicalexper ienceof Gebur ahisavisionof power .Now
t hisr elat esdir ect lyt ot heener giesof t hisSephir a .Byt he
wayof ascent ,t hepower ist hegr owt hof t her ebir t haspect
whichisexper iencedinTiphar et h .Her et henewener gyisnow
mat ur edandhasgainedbot hinst at ur eandst r engt h .I nt er msof
descent ,Gebur ahist heSephir aUat showst heest ablishment of
t henewf oundmasculineener gywhichalsosignif iespower .
Ther ear eanumber of MagicaWeaaonsassociat edt oGebur ah,
E
1
T
M
t
but t he one of impor t ance is t he swor d .

I t is asymbol

a
guar d as well as just ice and enf or cement .
symbol of t he conjunct ion due t o it s concept of penet r at ion .

I n
t heGolden Dawn paper on t heMagical Swor d it says :

'The swor d
t o be used in all cases wher e gr eat f or ce
b used and r equir ed,
def ence against evil f or ces .

For t his r eason it isunder t he


pr esidency of Gebur ah and of Mar s, whose names and f or ces ar e t o
be invoked at it s consecr at ion' .

The spear has also much t he


same f unct ion as t he swor d while t he scour ge is a symbol
sever it y and punishment .

The chain is t he chain of mour ning,


symbol of t he heavinessof binding obligat ions .
One of t he geomet r ic symbols of ,Gebur ah is t he Pent agon and
anot her is t he Pent agr am, of t his Mat her s wr ot e : The Pent agon,
f ir st f or m, r ef lect ed f r om ever ysecond point . ThePent anglecan
bet r acedint woways ; r ef lect edf r omever ysecondpoint ,whenit
is calledt hePent agon ;

andr ef lect edf r om ever y t hir dpoint ,


whenit iscalledt hePent agr am .
L1 3/pg
I nalchemyit isa
andst r engt har et o
but pr incipallyf or banishingandf or
ThePent agr amasawholeis
r ef er r edt ot hef if t hSephir aGebur ah .

ThePent agonnat ur ally


I
r epr esent st hepower of t hePent aboper at inginnat ur ebyt he

disper salof t hespir it andf our element st hr oughit .Thenumber


of t hedegr eesof agr eat cir clecut of f bet weenit sanglesis72
degr ees,t henumber f or mingt heast r ologicalQuint ileAspect ,
goodinnat ur eandinoper at ion .I t alsoanswer st ot hedisper -
salf or ceof t hef ivelet t er sYEHESHUAH .
The Vir t ue of Gebur ah is ener gy whichr elat esnot only t o
alsoshowingt heabilit yt ocompet ewit hot her s,
inst ancesnewendeavour sf inancedbyGebur ahar ebuilt onold
oneswhichwillhavebeent or ndownasar esult of cont act
t hisdynamicf or ce .

Asavir t ueit ist heabilit yt of ight evil


andwin,t henconver t it t ogood .
Whilet heVir t ueof Gebur ahisener gy,it sviceisself
dest r uct ionwhichiscausedbyt her ampant f or ceof Gebur ahover
ext endingit self .Thisdest r uct ivequalit y is int heself andis
t hepoint wher esomet hinghasover r eact edit sboundar ies .The
f or cet hat it hast r iedt oconquer t hen,int ur n,conquer sit .
Her et hef or ceof t hisSephir ahasut ilisedavehiclet hat is
unpr epar edt ohandleit sener gies .
Thet woaddit ionalt it lesof Gebur ahar eJust iceandFear .
Theseact ualyr elat emor et ot hemar t ialconst ancyof Gebur ah's
war likeat t it ude .

Bot ht heset it lesr elat ebackt oGebur ah's


imageof awar r ior inachar iot .Just iceshowst hat t hewar r ior
willcomet ot heaidof t hoseinhisdomainwhilef ear showst he
r eact ionswhenhislawshavebeenbr oken .
blood,,
L1 3/pg4
t he dr ive of complet ingpr oject sbut alsot hecour age hold
f ast ont oonesconvict ionsint hef ace adver sit y.Those
individualswhocomeunder t heinf luenceof Gebur ahwillhavet o
goout andbuild,cr eat ingnewsit uat ionsinplaceof oldbut
asinmany
wit h
aminer aldr ugof Sebur ah,I r ondir ect lyef f ect st he
especiallyt heHaemoglobin .Thisint ur nmakesour blood
supplyoxygenr ichwhichpr oducesmor eener gy .Thet er musedf or
1
1
41
t
M
r
r
Tr eeweappr oachGebur ahwit hacer t ainamount
L1 s/pgS
which miner al subst ancest hat ar et akenint ot hebodyiscalled
Chelat ion and if absor bed have a pot ency of up t o t en t imes
gr eat er assimilat ion .Theesot er icaspect of I r onasaminer al
dr ugbr ingsout ast abilisingef f ect of holdingf ir mt oones
kar micpat t er n .
Gebur ahinAt zilut hcomesunder t henameof ElohimGibor
whichmeans"Godswar sor bat t les" .Byt hewayof descent ont he
0 caut ionas
t hought hequalit iesof Mer cyinChesedhavemadeusr ecept ivet o
change,it isnowbr ingingint hepower of t hesenses
.I nascent
weviewElohimGibor wit halongingf or just ice .Thisisbecause
wehavecomeupt hr ought hehellof war andnowwishf or peace .
Ther oot of Gibor isGBR(205)="t obepower f ul"whichalso
equat eswit hanot her r oot DRA="t or epel" .ElohimGibor pur ges
us of our aggr essions bymakingusact out t hekar mic play wear e
allinbut dir ect sust ot heself ishsideof our nat ur esot hat
wecanunder st andt hef ullnecessit yof it andgr owanddevelop
_f r omt hisexper ience .
TheBr iat icemanat ionof Gebur ahist hr ought heAr changel
Khamaelwhileot her s(suchasLevi)sayit per sonif iesdivine
just ice
.I t isKhamaelt hat appear edt oJesus(t ogivehim
st r engt h)int hegar denof Get hsemane .ThisAr changelist heone
t hat givesust hest r engt ht oper f or mt hemar t ialdut iesof t his
Sephir a
.I t isher et hat hemust inject inusdesir e,hat e,r age
andf ear sot hat wecanexper iencet hesef or t hegr eat er good
.
Whilehedoesnot cr eat et heseevilf or ceshedoesper mit t hemt o
L1 3/pg 6
manif est in us by st anding slight lyasideasweexper iencet his
aspect of evil .For Khamealisat est er of our nat ur e .
TheYezir at icinf luenceof Gebur ahisint heangelicchoir
called t heSer aphim(whichmeansf ier yser pent s) .I t ist heywho
gover nt hekar micinf luenceof our livesunder t hisSephir a .
Theyar et heangelsof Love,light andf ir eandpr oduceinus
t hesequalit iest hr oughmanipulat ion .Theyt r yt ogiveust he
chancet ohaveour f illof exper iencesunder t heir guidance .
Thoughmost of t hese will beunpleasant t heyar ef or t hedevelop-
ment of self andt hispoint must never beover looked .
TheAssiat icinf luenceof Gebur ahist heplanet Mar s .I t s
mundaneef f ect sar et hat of ener gy,const r uct ion,compet it ive-
ness,,f or ce, war ,suddenimpulseset c .I t isimpor t ant t or ea-
liset hat wit ht hisplanet wehaveaf or ce,at r emendouspower
t hat ist oacer t ainext endblindinit sdir ect ion .
Hebr ewwor df or Mar sisMadim(Mad=f or ceor might )whichis
namet hat r ef lect st hisplanet 'snat ur e . I nMar s we havet he
war r ior ,r eadyf or act ionbut t heappr oacher must decidehowhe
comest ohim,asf r iendor f oe .I t isher ewemust examineour
mot ivesf or if t heybecor r ect hewillnot har musbut if t heybe
t heopposit ewear et henint r ouble .
TheQlippot hicener gies Gebur ahar et heGolahabor
Bur ner swit hFir east heyar esomet imesr ef er r edt o .Their f or ms
ar esaidt obet hoseof cr eat ur eswit henor mousblackheadswhich
ar esomet imesdescr ibedlikevolcanoesiner upt ion .Their ener gy
Theesot er ic
1
1
1 1
t
1 1
44
I
1
1
1 0
1
t
st r if e (Deimos, Phobos and Er is) .

Ever yevilill of war was


associat ed t o t his god .

Anot her associat ion of int er est is t hat


of Hades, Kingof t heUnder wor ld .
L1 3/pg7
is one of immense f or ce which man picks up and dir ect s t owar ds
ot her s in violent act ion and aggr essive behaviour .However t he
ener gy dr awn f r om t heir sigil is shor t lived, like most of t he
ener gy coming f r om t he lower Tr ee . Passions, vice andimmor alit y
ar e all t he r esult of t he negat ive aspect s of t his Sephir a and
it s ef f ect on man .
Hor us is t he Egypt iangodf or m associat ed t o Gebur ah . Since
Hor us isa god of many par t st he one t hat has t he most signif i-
cance her e is Her u-Behut et and he is usually depict ed wit h a
spear and a headr ess sur mount ed wit h a solar disk . Behut et dr ove
away dar kness (and night ) and t he t hr eat ening element s such as
r ain clouds,st or ms,winds et c ., whichlef t t he br illiance of t he
sun shine t hr ough .This is of cour se symbolic of t he vict or y of
light over dar k f or ces . The bat t le bet ween Hor usand Set was a
bat t le bet ween Her u-Behut et and Set . Anot her t it le of Her u
Behut et was Lor d of t he For ge Cit y wher e he was consider ed t he
mast er blacksmit h .
Ar es is t he Gr eek god of war and wast he son of Jupit er and
Juno . As a god who or iginat ed in Thr ace he was of t en shown asan
ar med war r ior but was mor e not ed f or his r ages t han anyt hing
else . I n bat t le, his weaponwas t he spear and was always said t o
accompaniedby t he t hr ee comr ades - war , f ear , f r ight and
TheScandanaviangodalso
at t r ibut edt oGebur ahwasThor ,sonof OdinandEar t h,hwas
also called t he god of t hunder and possessed t he
hammer which could be ut ilised as a weapon of t er r or .
L1 3/pg 9
f or midable
One of t he impor t ant Hindu associat ionst oGebur ahist hat
Vishnu . Alt houghhe is a war r ior god he is opposit e t o t he
Gr eekGodAr esbecausehef ight sagainst evil
.Theimagef
Vishnu,wit hhisf our ar ms(holdingt hemace,shellandlot us)is
inr ealit yablendingof bot hconcept sof Thor andAr esint ot he
godof pr eser vat ionbut onewhowillgot obat t let odef endit
.
Ther ear emanyst or iesassociat edt oVishnuasadef ender of t he
Right eous .Onesuchexampleof t hisisVishnusavingt her oyal
elephant f r omacr ocidile .
TheRomangodof Gebur ahisMar sandhisnameist akenf r om
t her oot MARwhichmeansgener at ivef or ce .Hewast hef at her of
bot hRomulusandRemus,t het winswhof oundedRome
.Likealot
of ot her godf or mshewasf ir st agodof agr icult ur e .Asagodof
Spr inghewascalledMar sGr adiuus(f r om"gr owt h")whileasagod
of war hewasalwaysseenwit hhiscompanionswhoinst illednot
onlyf ear (t ot heenemy)but honour andcour aget ot hef or ces
under hispr ot ect ion .
TheTar ot associat iont ot hef our f ivesshowsopposit ion,
st r if eandst r uggle,war ,obst aclest ot hequest ioninhand
ult imat ef ailur eor successasalsoshown .

TheFiveof Wandsis
called"Lor dof St r if e"andshowsswif t boldact ion
.TheFiveof
Cupsis"Lor dof LossinPleasur ewhichsignif iespleasur e
comingt oanend - dissappoint ment andLoss .

TheFiveof Swor ds
0
1
41
t
M
1
t
L1 3/pg 9
i "Lor d of Def eat " and also showsloss but af t er a st r uggle -a
bat t le lost . The Five of Pent acles i "Lor d of Mat er ial Tr ouble"
which showspayment f or r ewar d(of amat er ialnat ur e) - somet imes
wealt hgainedat abit t er expense .
Theveget abledr ugof Gebur ahisat inct ur emadef r omt he
r oot sandleavesof Net t le .

Thisdr ugcont ainsagooddeal


I r on,Tannin,Phosphat es,For micAcidet c .
ast r ingent ,diur et ic,pur gat ive,bloodbuilder ,st imulant and
t onic .I nancient t imesNet t lewasgat her ed(bef or esunr ise)and
f edt ocat t let opr ot ect t hef ar mer against night demons .
TheRedJasper isoneof t hepr eciousst onesof t hispat h .
I t isnot edasagemf r omwhichimper ialsealswer emade .Asan
amulet it couldhealoneinjur edinanyt ypeof hunt ingaccident
aswellaskeeponef r ombeingpossessed .Amongit smedicinal
qualit iesapar t f r ombr inginggoodhealt hwasacur ingof blood
diseases .ThoughJasper scomeinavar iet yof colour st heRed
Jasper r elat esmor et ocur ingoneof diseasesor ailment s
ciat edwit ht hef ir eelement andt hemar t ianinf luence .
I t isusedasan
asso-
Thesixt hheavenisr elat edt oGebur ahandiscalledMakhon
whichmeansplaceor base .TheTalmudsays'Makhoncont ainst he
r eser vesof snow,hail,har mf uldew,r ounddr opsf at alt o
veget a-
t ion
andit sdoor sar einf lame' .I t goesont oquot eDeut ; 28; 1 2
'YHVHwillopenunt ot heehisgoodt r easur e' .Thisshowst hat
t hewayt oat t ainment ist hr ought hepalaceof t r ialandt r ibula-
t ion .

I f oneaccept st hechallengeit canonlybenef it t hem,t o


Sinceear lydayswhent hisplant wasusedinincense
L1 _/pg1 0
deny it one will f all t o t he f at alismt hat t hisheavenlyPalace
r epr esent s .Makhonisalsocalled'Palaceof Will'f or willis
t heonlywayonecansur vivet heor deal .Theangels t his
Palacear e Rumial,Kat mial,Gehegial,Ar sabr sbial,Egr umial,
Machkial andTuf r ial .
Thesixt hinf er nalmansionof Ret zelt ot hmeansgat esof
deat h ..Thisr elat est ot hear eawher eoneexper iencesdeat h,yet
again,onlyt hist imeit isr elat edt oGebur ah .Theconcept
t eachesust hat wear eont het hr esholdof bur ningour br idges
complet elywit ht heupper Tr eeandhavinglit t leor nochanceof
r edempt ion.Thisisasever ingpoint wit ht heupper Tr eebut it
isst illult imat ely up t ouswhet her or not we canr econnect t he
sever ed link .
Themagicalper f umeor ar omat icof Gebur ahisTobacco .
f or mit
cr eat edapungent ar omaandwasusedint heAmer icasasapr elude
t o a sacr if icialr it ual .Alsoit isusedbot hasast imulant and
ar elaxat ivebef or ebat t le .TheMexicansusedt obaccot oiden-
t if ywit ht her aingoddesswhilet heMayansusedit t oappease
t hef our element s .
TheEdomit eDukeassociat edt oGebur ahisElahandt heKing
iscalledHusham(HShM=905or 345) .Byt heuseof Gemat r iawe
f indt hat 345equat est o'Ext r act 'or 'dr awf or t h'while905
r elat es t o'Pr eciousSt one'
.Toget her t heyr elat et ot heemer g-
ingof cr yst alisedmat t er .

Ther oot of HushamisHShwhichisa


1
M
M
t
r
L1 3/pg1 1
violent or disor der ed movement .Anot her r oot of possible or igin
is HUSh meaning"bar r enness" .Ther oot AMshowsapassivef or ce
whichwhenmer gedwit hHShr eleasesit sbar r enpr inciplesand
givesbir t ht

amat er ialsubst anceandt akeson

posit ive
movement .
TheI mmaginer yanimalof Gebur ahist heBasilisk .Thisis
ananimalwit ht hebodyof asnakeandt heheadandclawsof a
bir dof pr ey.Thisisr epr esent at iveinChr ist ianit yas a symbol
of t hedevilof Ant i-Chr ist .I t smainweaponsar et heeyeswhich
couldkillat aglanceandlikeint hef ight bet weenPer suesand
t heGor gon,t heonlywayt okillit ist oseeit f ir st t hr ougha
r ef lect ion . .
simplif iedexplanat ionof t he6=5gr adeof Adept usMajor
t hat int he5=6levelhelear nshowt oapplyhist r adein
pr act icalmanner ,whileint he6=5hemust not onlyknowhowt o,
but hemust becomegoodat it .

I t isher et hat t hepower f ul


magicianisbr ought t hr ough,aper sont ober econnedwit hon all
levelsof occult ism .
TI TLE:
TI TLEI N MI CROCOSM:
ATZI LUTH NAME :
BRI ATI CNAME :
YETZI RATI C NAME :
ASSI AH- PLANET NAME :
QLI PPOTH:
EGYPTI AN DI ETY:
GREEK DI ETY:
ROMAN DI ETY:
HI NDU ASSOCI ATI ON :
GEMSTONE:
MAGI CAL WEAPON :
MAGI CALEXPERI ENCE :
AROMATI C:
VEGETABLE DRUG:
MI NERAL DRUG:
PLANT :
GEOMETRI C SYMBOL :
ANI MAL :
TAROT ASSOCI ATI ON :
VI CE :
VI RTUE :
KI NG OFEDOM:
HELLS :
THE HEAVENS :
ROSI CRUCI AN GRADE:
L1 3/pg 1 2
AS- SO-C1 ATI O- NS
GEBURAH- STRENGTH/SEVERI TY
RI GHT SHOULDER - JUSTI CE, FEAR
ELOHI M GI BOR
KHAMAEL
SERAPHI M
MARS
THE GOLAHAB
HORUS- HERU BEHUTET
ARES, HADES
MARS
VI SHNU
RED JASPER
SWORD
VI SI ON OF POWER
TOBACCO
TI NTURE OF NETTLE
I RON
NETTLE
PENTAGON - PENTANGLE
BASI LI SK
4 FI VES
SELFDESTRUCTI ON
ENERGY
HUSHAM
RETZELTOTH
MAKHON
ADEPTUS MAJOR
4
M
the eye of the hurricane, aplace of calm and safety amongst
turmoil and upheavel .
f
mingle, expand and grow .
LESSON 14
TIPHARETH - BEAUTY
'The sixth path (Sephira) is called Mediating Intelligence
because in it are multiplied the influxesoftheEmanations ;for
itcausesthatinfluencetoflowintoallthereservoirsofthe
blessingswithwhichtheythemselvesareunited . '
ThetermMediatingIntelligencereferstothefactthatthis
SephiraistransposedontheMiddlePillar,betweenthetwo
extremes . Theinfluxesaremultipliedbecausetheyfindthem-
selvesinasafeareaofnonpolarityandsincetherestrictions
ofthetwointerposingforcesarelifted,theyhaveachance
L14/pg I
Thisconceptisverymuchinlinewith
TipharethistheSephirathatstandsforBeautyandisthe
first

apartfromKethertostandonthemiddlepillarofequi-
librium .

By drawing from the two extremes of Chesed and Geburah


aharmoniousbalanceisformed . Byvirtueofitspositiononthe
Tree,directlybelowKether

itreflectsmuchofthepurityof
itsoriginbutonamoredeeplymanifestedscale .

Byvirtue
ascent,TipharethisaSephiroththathasnotyetmanifestedinto
the extreme of Geburah . In terms of descent, Tipharethhas half
thepassionsofGeburahandrestsatavitalpointbetweenlove
andhate(the twoextremesof Geburah'stemperament)whichis
severeness, andappreciationofthingsforitsownsakewhichis
beauty . ThisSephiraisintheshadowofKetherand is theapex
ofthesecondtriad,thedoorwaytothenextlevelofexistence .
TheRuach is partoftheKabbalisticSoulassociated
Tiphareth,thoughinactualfactitslocationontheTreecovers
theSephirothofChesed(asmemory),Geburah(aswill),Tiphareth
(as imagination),Netzach(asdesire)andHod(asreason) .

All
ofthesefacultiesarepartofthemysteriesofRuachwithmemory
andwillalongwithimaginationaretheactivepartsRuachplays
intheSecondOrder .

Desireandreasonarethetwostagesthat
theRuachmustgothrough in theOuterOrder .

Leiningensays
thatRuachconsistsofaninteriorbutidealisticbeing
manifeststheexteriorshell . Ithastheabilitytodistinguish
itselffromotherpartsofthebody .
whichhastokeepapartfromtheprotoplasmofthebodyandthe
pureenergyaboveit,thebodyinfactprocessesthestimuliback
totheRuachsothatitcanfeedit(throughpenetration) .
RegardieconsideredtheRuachasthe'falseormpirical
ego'whichweconsiderthe'I'whichisafluxofchanging
concepts . TheRuachisthehumansoulwhichcoversthearea
aboveandbelowtheveil . Theaspectofocculttrainingisto
linkthisRuachwiththeNephesh(ourLowerSelf)sothatthe
Ruachassuchnolongerexists
L14/pg
which
Itisthemiddlefunction
andassuchthefalsemanifesta-
tionsoftheegoarethenshatteredandtheNeshamah,thecore
essenceofSelfisthenseenclearly . TherootRVChrelatesto
beingdrenchedbywater while therootRUshows

spiritual
1
M
M
t
L14/pg
emanation (also a stream) which possiblyhasArabicoriginsthat
relatetothelung . TheseArabicbeginningsalsoshowcontempla-
tion,reflectionanddeliberation(beforeaction) .
ThevirtueofTipharethis"DevotiontotheGreatWork" .
ThismeansthattoenterthisSephira onemustcommitoneself
wholeheartedlyintheWorkofstudyorteachingtheSecret
Wisdom . Insimpletermsitmeanscommitment,frombothbodyand
soul,andacceptingtheKarmicpatternsoflifethatonehasto
leadtothisend . AcceptanceoftheGreatWorkandcommitting
oneselftoitcanradicallyaltertheindividualandhislife-
style,andtheseshouldbeclearlyunderstoodbeforeentrance
intoTiphareth .
TheMagicalPowerofTipharethistheVisionoftheHarmony
ofthingsandtheMysteriesoftheCrucifixion . Intheformerwe
havetheareawherethedisjointedassociationsrevealedtousin
partsintheLowerTree,nowthesecanbeseenintheirtotality
aspartofthewholevitalplanoftheTreewhich was previously
unrevealedtouswhenbelowtheveil . AtTiphareth,thepicture,
itsscopeandsizenowisseenforthefirsttime .
TheMysteriesoftheCrucifixionaremanybutone the
mainpointsisthattogainadvantageinanotherleveloexis-
tenceonemustpayonesduesinthepresentone . Theoldsaying
of"nopain - nogain"isasimplisticbutaccuratewayofdes-
cribingthissituation . Fromapsychologicalviewpointthecru-
cifixionisdeathoftheegoandsubsequentrebirthintothe
L14/pg 4
higher states of awareness .

Much of the symbology of the cross


isalso incorporated into this analogy .
The vice of Tiphareth is egotistical pride . It is here at
the point of rebirth on the Tree that ones strengthsare rein-
forced, but also it is found that onesproblems also increase in
proportion . If'thepowerandunderstandingonereceivesatthis
levelgoestoonesheadtheegocaninflate,causingallsortsof
disruptions . Thisproducesinmanyinstancesashatteringexper-
ience as the ego will only inflate so far before itseeksnew
horizonsandpatternstotranscend .
lifegivingqualities . Itisplacedunderthehorseinthe
Chineseastrologicalsystem,isrelatedtotheseasonofsummer,
andisattributedtothecardinalpointofsouth . Oneinterest-
ingsayingattributedtothistrigramis'whatwasvegetablenow
becomesconscious'whichofcourserunsparallelwiththewestern
meaning .
ThechakraassociationtoTiphareth is theAnahataorHeart
centre . TheGeometric. symbolhereisthatofadownwardpointing
trianglewithina12petalledlotus,eachincorporatingaletter
andrepresentinganIndiandiety . Thepetalsandtrianglesare
colouredingold .

Withinthecircle(surroundingthetriangle)
arethedietiesIsaandKakiniSakti . Whenthischakrais
1
41
IntheChinesecosmostheI'Chingtrigramassociatedto
TipharethisLiwhichisfireorsun . Itrepresentsthemiddle
daughterandshowsthecharacteristicsofagitation,warmthand

I
sympathetic bond will take over his own auricemanation and rule
him .

This chakra controls the Thymus and is the transmuter, for


it is at a critical gateorentranceway .

Itproducesenormous
radiant power and shows in individuals those who have
deal of power and controlover the lives of others .
t
ID
1
elementswithagoldencross at itscentre .
tions, though it is used as
L14/pg 5
activated man becomes aware of suffering of others and relates to
themin a fraternal bond . It is here he must be cautious or this
a great
The Magicalweapon of Tiphareth is the Lamen of the Rose
Cross .

In magic the Lamen is usually worn over the Heart region


and is a symbol of the devotion of the operator .

The Lamen or
Rose Cross is made of the colours of the King Scale in the four
In medieval times
the Lamen was usuallymetalwiththesigiloftheinvokedspirit
engravedonit . Thisinfactwouldblindthespirit(initsown
reflection)toobedience . TheRoseCrossLamenhasmanyuses,
butofimportanceistotaketheenergyofdevotionsandfilter
itoutthroughtheRoseCrosssothatonespowerisincreasedand
controlledbythepetalsoftheroseintoaunifiedspectrum .
OlibanumorFrankincense(BoswelliaCarterii)ismadefroma
gumresinofanArabiantreeandwasusedinancienttimesfor
justabouteveryconceivableritualisticpurpose . Inearlydays
thePleiadesstarsystemwasassociatedtothisperfume . Aa
healer,Olibanumclearsupblooddisordersandbacterialinfec
astimulanttotoneupthesystem
wheninhaled . Ithelpscleartheauraofnegativevibrationsand
raises the level of consciousness .
L14/pg 6
Stramonium is also calledJimson Weed, and the drugfrom
this planthelpsbronchialcomplaintsaswellasbeing pain
killerandsedative . Itisapoisonousplantanddrugsfromthis
canprovefataliftoomuchistaken . Itspsychicbenefitsare
numerousbutitisbestdescribedasanhallucinogenicwhichdoes
induce(insomeinstances)statesofprophecy,aswellasbeinga
catalysttoexpelltheastralbodyandmakeittravel .
ThemineraldrugofTipharethisPotableGold . It'smedi-
cinalqualitiesaresaidtohelpboutsofdepressionandgene-
rallytoneuptheentiresystemhelpingtocuresuchdiseases
thatarebronchialandvascularinnature . Ithasbeenusedin
suchdiseasesasveneralandmultiplesclerosis .
TheAtziluthnameforTipharethisEloahVeDaath . There
area'numberoftranslationsforthiswhichcouldmean"God's
knowledge"or"becauseofknowledge" . Thisisthe"pointde
part",throughthemistsoftheveilofPokareth . Hereknowledge
isnotonlyrevealedtousbutrealised . Itisherethatwe
leavebehindouroldvaluesandbecomechildinournewrolenow
thatrealisationhascome . Itisherethatoneexperiencesthe
wholenessoftheTree,insteadoftheparts,itisthepointof
synthesization .
TheBriaticworldofTipharethisunderthepresidency
thearchangelRaphael(meaning"Godwhohashealed") . Heisalso
thePatriarchofJourneysanditishisjobtoguideonethrough
1
1
y
1
I
r
L14/pg7
the veil as the angel who teaches knowledgeofthesciences . He
willguideandinstructindividualswithknowledgesothatreali-
sationcomesandthemistoftheveilofPokarethisremoved . It
wasRaphaelwhogavethegreatSolomonthepowertocontrolevil
spirits .
TheYetziraticassociationofTipharethisthroughthechoir
ofangelscalledtheMalachim(Kingsorcontrollers)whichare
equatedtotheorderofvirtues . Asanangelicchoirangels
theirfunctionistogivestrengthwhetheritbeinpeaceorwar,
andtoreinforcethehealthofthoseplacedintheircharge . The
Malakimaretheoneswhobringoutthepatternofstudyorthe
formationonedevelopsasaresultoftheTipharethexperience .
Itistheywhodecidethereligiousormysticalpaththatthe
devotee(whohasreachedTiphareth)mustfollow . Oncerecipro-
catedtheystrengthenthewillandbodyoftheadeptsothathis
orhertaskcanbeaccomplished .
TheAssiaticexperienceisbasedontheSun,thesourceof
lifeitself . Itistheforcethatcontrolsourdestiniesand
environment. TheSunofcourserulestheheartbutunlikethe
lustofVenusitintroducesustoanewdimension universal
ecstacythatpushespastthephysicalbarrier,andopensthedoor
intercourseonalevelthatwepreviouslywouldhaveconsi-
deredcosmic . TheSunisaprimemoverinourlifeandthatmust
neverbeforgotten . Itgivesusbothharmonyanddevotionand
mergesindivineunion .
directcontradictiontothebeautytyplifiedbythehigher
Zomielbygematriaequatesto158whichrelatestostrangulation
orsuffocation . TherootZAameans"painfulmovement - fearor
trouble" . MIisarootthatmeans"waterorexpansiveness(and
also"who"ifusedasapronoun) . Theentireconceptisoneof
painful,greatandexpansivemovement .
Theabstractfiguresassociated t oTipharetharethehex-
angle,hexagonandhexagram . Mathers. said :'TheHexanglenatu-
rallyrepresentsthepowersoftheHexadoperatinginNature,by
thedispersaloftheraysoftheplanets,andofthezodiac
emanatingfromtheSun . Thenumberofdegreesofagreatcircle
cutoffbetweenitsanglesis60,formingtheastrologicalsex-
tileaspect,powerfulforgood . Itisnotsoconsonanttothe
SunnatureastheHexagram,andrememberthou,thatthe'Gon
signifiethdispersion,distribution,andradiationofaforce
butthe'Gramconcentration . Henceusethe'Sonforspreading,
andthe'Gramforconcentrationandsealingandwhenthereis
need,thoughcanstcompare,
'Soninitiateththewhirl . '
ThePhoenixisoneoftheimaginary
Itisabirdwhichslightlyresemblesan
L14/pg 8
TheOlippothicforces. ofTipharethareunderthepresidency
theZomielandaredescribedasgreatblackgiantswhowork
againsteachother
. Thisenergyshowsitselfinselfadornment,
beneficationoftheselfattheexpenseofallelse .

Itisin
Tree .
interposeandcombinethem ;butthe
animalsofTiphareth .
eaglewithredandgold
feathersandwouldkillitselfwhenexposedtothesunsrays and
r
r
1
t
through the suns rays,the renewer of life .
L14/pg 9
would

turned into ashes which would then transform into


another Phoenix . This of course is representativeoftherebirth
ThePhoenixwassaid
toappearonceevery500years .

Inmanywaysitisrepresenta-
tiveofthesoulpassingthroughthevariousincarnations .
TheBayLaurelisassociatedtoTipharethandisusedin
clairvoyancemattersofdivinationandsacrificialrites .

This
treecomesunderthepresidencyofApolloandwasusedinceremo-
nies

worshipthisdivinity .

Theleavesandberrieshave
narcoticeffectandifeatenproducevisionsofalldescriptions .
Itwasusedtokeepawayevilspiritsandcharms(byplacingit
abovethedoorway) . AlsotheBayLaurelissaid

attract
wealthandbringprosperitytothehouseholdwhoholditsacred .
ThegradeofTipharethisthatoftheAdeptusMinorandis
signifiedbythenumbers5=6 .

ThisisthestartoftheInner
Orderandisthepointwheretheadeptgoesthroughadeath in
whichhisoldvaluesvanishthengoesthroughabirthasnew
onesarefosteredinhim . Atthislevelhebecomesthefledgling
magician . hasnowbeenshownhowtoperformandduringthe
timeofhisstayinTipharethhemustlearntousethese powers
andgainstrengthinth'mbeforehegraduatestothenextlevel
of6=5 .
TopazorChrysolitewassaidtohavefirstbeen
asageminTopazos,situatedintheRedSea .
recognised
Itspsychicpro-
pertiesaresaidtopacifythenervesandprotectthewearerfrom
L14/pg 10
night demons . If worn around theneckandsetingolditcould
protecttheweareragainstevilcharmsandspells . TheTopazwas
saidtobeabletoprojectsomeofthepowerofthesunanditis
alsoasymboltoattractwealth .
AdonisistheGreekgodofTiphareth . Adoniswasthesonof
CinyrasandwastheloverofVenus . AsayouthAdoniswasnoted
forhisbeauty . Hewas p laced . i n apastosbyAphroditeatbirth,
andgiventoPersephoneforsafekeeping,butwhenshe r eturned.
t o claimthechildshefoundthatthepastoshadbeenopened,for
seeingthebeautyofAdonis,Persephonerefusedtopartwithhim .
Zeusthendecreedthathewastospendsixmonthsoftheyear
witheach .
TheRomancounterpartofAdonisisApollo,thesonof
JupiterandLatona . HornonthefloatingislandofDuus,hewas
thegodofbeauty,thearts,medicineetc . Apollowasthegod
(theonlyone)whocouldforeseethefutureandassuchwasmuch
sortafterbythoseseekingdivination . OftenApollowouldbe
seen as thesun,infactmanytimesthesunwascalled'Apollos
Chariot' .
TheEgyptiangodofTipharethisRa,theEgyptiansungod .
TheEgyptiansconsideredthathe(alongwithPtah)wasthesource
ofallnourishmentandoflifeitself .
ThefourPrincesarethefirstlotofTarotassociations
Tiphareth .

theyarefiguresseatedinchariots,andthusborne-
1
r
I
t
L
i
t
r
t
1
r
L14/pg11
forward . They represent the Vav forces of thename in each suit .
The mighty son of the King and Queen, who realises the influences
of both scales of force . A Prince, the son of a King and Queen,
yeta Prince of PrincesandaKingofKings :anEmperorwhose
effectisatoncerapid(thoughnotasswiftasthat
the
Queen) and enduring . It is therefore, symbolisedby a figure
borneinachariot,andclothedinarmour
. Yetishispowervain
andillusionary,unlesssetinmotionbyhisfatherandmother
.
Thesecondsetoftarotassociationsarethefoursixeswhich
standfordefiniteaccomplishment,somethingcarriedout .
TheHindudietyofthisSephiraisKrishna(whichmeans
dark) .

His

image

is

ofabeautiful

youth

(possibly .
hemaphrodital)whoplaysaflute .

Heisthepersonificationof
thedivinechildconcept . HealsoisknownasGovinda(whotakes
care

cows) .

Theesotericanalogywiththisphrasecan
relatedtoChristwhoisShepherdoftheflock . Krishnawasthe
dietywhowasbornwithcosmicconsciousnessandrepresentsthe
divineaspectofthoughtanddeed .
TheFifthHeaveniscalledMaon(dwelling)andissometimes
calledRahamim(divinemercy) . TheTalmudsays :'InMa'onthere
arehostsofMinisteringangelswhosingduringthenightbut
keepsilentduringthedayinhonourofIsraelandit issaid
(Psalms42:9)"Inthedaytime(hislife)YHVHwillcommandhis
lovingkindnessandintheheight(afterlife)hissongshallbe
with me" . ' Thisheavenrelatestodevotionortheheartofman -
hisaspirationswithhismakeroruniversallove .

Itishere
L14/pg1?
that the unification of bothman and god truely begin .
The King of Edom associated here is Hadad and the Duke is
Pinon and they come from the city of Avith . Hadad(HDD = 13)
comes from the root HD (or HED) which expresses power of divi-
sion, which when taken back to its arabic shows limitation,
terminating . . The Duke Pinon (PYNN = 190 or 840) is from the root
PI or PHI and relates to enhaledbreath or life giving function
confined to restricted man . The root PN also relateshere,it
standsforface,airetc . ,andrelatestoturningawayfrom,
fearfu
The5thInfernalMansionrelatestoTipharethandiscalled
Yadashchomorgatesoftheshadowofdeath,thoughinthishell
onecanstillreceivesomeofthelightoftheupperTree .
find here that one is at the gatesofaveilrelating tothe
equivalentoftheYetziraticforcesoftheseregions . Oneis
abouttogofurtherdownwhichwillaltertheirentireperspec-
tiveofthedivine . Hereinthishelloneisre-examinedtosee
iftheirvalueshavechangedorlessonlearntandifnotthey
willgthroughthegatestofurtherlevels . Iftheydoshow
signsofhavinglearntthevaluablelessonsofkarmatheymay
returntotheupperTree .
1
ASSOCIATIONS
L14/pg 1 3
I
11
TITLE :
TIPHARETH - BEAUTY
TITLE IN MICROCOSM:
HEARTAREA
11
KABBALISTICSOUL : RUACH
ATZILUTHNAME : ELOAHVEDAATH
I BRIATICNAME : RAPHAEL
11
YETZIRATICNAME : MALACHIM
ASSIAH - PLANETNAME : SUN
I
CLIPPOTH : THEZOMIEL
HINDUCONCEPT : KRISHNA
11
EGYPTIAN DIETY: RA
1111
GREEKDIETY: ADONIS
ROMANDIETY: APOLLO
11
GEMSTONE : TOPAZ
MAGICALVISION : MYSTERIESOFTHECRUCIFIXION
MAGICALWEAPON : ROSE CROSS LAMEN
11
AROMATIC : OLIBANIUM/FRANKINCENSE
VEGETABLEDRUG : STRAMONIUMEXTRACT
11
MINERALDRUG : POTABLEGOLD
TAOISMASSOCIATION : LI
11
PLANT : BAYLAUREL
I
ANIMAL : PHOENIX
TAROTASSOCIATION : 4PRINCES,4SIXES
11 VICE : EGOTISTICALPRIDE
1
if
VIRTUE : DEVOTIONTOTHEGREATWORK
GEOMETRICASSOCIATION : HEXAGRAM,HEXAGON
THEHEAVENS : MAON
KING OF EDOM:

HADAD
HELLS :

YADASHCHOM
CHAKRA :

ANAHATA
ROSICRUCIANGRADE :

ADEPTUS MINOR
L14/pg 14
r
M
t
LESSON 15
NETZACH - VICTORY
'The 7TH Path (Sephira) is called Occult Intelligence
because it is the refulgent splendour of the intellectual virtues
which areperceivedbytheeyesoftheintellectandthecontem-
plationsofthefaith . '
Themeaningoftheterm"Occult Intelligence"in this
instanceisthemannerofexpressionofourhiddennature . The
occultisnotsomethingwelearnbutsomethingwediscoverwithin
theself,inshort,itmeanstodiscoverthecauseofourignor-
ancesothatourtruenaturescanberevealed . Itistheexpres-
sionofourinnermotivesanddesires . The'refulgentsplendour
oftheintellectualvirtues'relatestothecreativeandemo-
tionalstateofthemindspurredonbytheintellect . Thecon-
templationsofthefaithisdevotion,pureandsimplewhichis
thedrivingforceofourjourneyintothemagicalexperience .
Netzachis'the7thSephiraandmeansVictory . Thisnamein
itselfhintsatthemartialaspectsofGeburahanddrawsfromit,
throughTiphareth,astrongandnobleforcewhichwhenconsidered
intermsofpolaritycouldonlybetermedVictorious . Without
Tiphareth,Netzachwouldhaveexpendeditself,butbeautybrings
harmonywhichhastemperedGeburah'sfierynaturesothatwhen
theemanationsreachtheirfullestinNetzachthediversionand
L15/pg 1
Netzach . Manatthispointhasnowbeenmadewholeagainandhe
isreadytoventuretowardsthebeauty(inTiphareth)ofhis
divineinnocencethathehasfleetingglimpsesofinNetzach .
ThevirtueofNetzachisunselfishness . Thisisbecausethe
devotionalaspectofNetzachisinstrongharmonywithmother
nature . Itisalsoaforcethatworksforthecommongoodregard-
lessofthepersonalsacrifice . . Itishereatthispointonthe
Treethattheindividualmustpropelhimselfforwardinto
higherstrataofhisbeing(tobediscoveredinTiphareth)
L1S/pg21
injection

additional force or polarity has averted sure


defeat .
The magical experienceofNetzachisthevisionofbeauty
triumphant . ThisrelatestotheTreeintermsofascentand
signifiesthattheindividualhastriumphantlypassedthroughthe
lowerSephirothandapproachestheboundaryoftheSecondOrder .
Though hasnotreachedthemyetthebeauty Tiphareth
emanatesthroughthemistoftheveilandiswarmlyreceived by
the
so
thathecanworkforthecommongoodofall . Hemustbeprepared
leavebehindthematerialinsearchofthespiritualandas
suchhisnaturemustchangeforthecommongood .
TheviceofNetzachisgreed . Itisherethattheindivi-
dualbecomesverymaterialisticwithastrongleaningtowardsthe
pleasures life . Pleasureisthekeywordhereandthis
Sephirabringsoutthepleasureseeker . Herejustaboutevery
typeofsenseofdevotionisexperiencedtothefullestbutat
1
M
1
here is the lightingofthewaysothatVenus,typifiedasmother
nature,canbefollowed .

Henceitgivesoneanilluminating
M
t
theexpenseofthetrueessenceofself .

Itistheexcess
pleasurethattakesoveronesthoughts,
makingusaslavetothem .
Out
quality .
TheI'ChingtrigramassociatedtoNetzachisKen,anaspect
oftheearthelement .

ThiscomesundertheChineseastrological
symboloftheCowandrelatestothehand(alsoarm,legthigh,
ThetwomagicalsymbolsofNetzacharetheLampandGirdle .
ofthesetwopossiblytheGirdleistheonemoreassociated
thisSephira,asitrelatestoacompleteorcyclicfunction
andisoftenrelatedtoboththezodiacandtheecliptic . Being
cyclicitrelatestochangetoallthoseitemcompasses . Italso
stronglyrelatestothemythoftheGirdleofVenus .

TheLamp
fingeretc)andrelatesto . amountainarea .
trigramisstabilityandsoliditybutalsohints

eruptive
pressurethatcouldburstforthatanygiven
clearcutdecisiononathingduetoobstaclesandprogresswill
behardgoing .
desiresand
L15/pg
emotions
Theactionofthis
moment . Itshowsno
TheChakraassociatedtoNetzachistheManipuraCentre
(solarplexus) .

Thiscentretoacertainextentisacleansing
areawhichworksonthesystemfunctioningaroundtheliver .
psychicfunctionsarenumerousbutthiscentrehasthepower
projectonesconsciousnessintotheastral.
Its
Itisthecentreof
visions and it is here that vital energy gathers and rules the
pancreas . The senseofsightbelongstthiscentre . This
Chakraisdescribedasa10petalledblueLotuswithareversed
trianglewithinitwithaRamatitsbase .
MetallicArsenic(ArsenicumMetallicum)isamineraldrugof
Netzachandworksprimarilyatliftingonesspiritsupfrom
depressedstate . Infactitisananti-depresant . Anydrugmade
fromCopperwillalsocomeunderthiscategoryandhasbeenknown
tohelpwithneuralgia,influenzaandemphysema .

Asamagical
elixerCopperwasusedtocureatadistanceandincreasethe
ethericvibrationoftheaura,sothatinorgasticritesthe
communicationduringtheceremonieswouldbemadeeasier .

Itis
usedespeciallyinfertilityrituals .
ThevegetabledrugsBenzoinandRosearerelatedtoNetzach .
Benzoin(StyraxBenzoin)canbeclassedasastimulant,
L15/pg4
diuretic,
antisepticandantipyretic,itisalsousedinthetreatment
skinconditions . Itsmagicalvaluesasanaromaticforevocation
andinvocationworkiswellknownanditisobtainedfromthe
StyraxTree .

Rosetinctureisalsoassociated . hereandisused
primarilyfor skin andmenstrualcomplaints . Inmagicalusethe
Rosetincturewasusedtoattracttheauraoftheoppositesex .
OnamoreethericnoteRoseWaterhasbeenusedinsometemples
aspartoftheingredientsoftheconsecratedwater .
TheeffectoftheworldofAtziluthanthisSephiraisin
YHVHTzabaoth,whichmeanstheLordofHosts .

InGnosticore
1
t
41
M
L15/pg 5
Tzabaoth (Hosts) was one of the seven archons who created the
universe . It is here in the first stirrings of Netzach that the
various religious ordersandmysteryschoolsarecreatedsothat
therearenumerousspiritualoutletsforthevarioussoulsrein-
carnating . Sinceeachsoulcanvaryinitsperspective,accord-
ingto its lessons,Tzabaothdecidedthatcertainlessonscould
belearnedbyavarietyofreligiousexperiences,itcatersfora
multitudeofidealsandexpressionsandwillcontinuetocreate
newschoolstofallinlinewiththedevelopmentsofeachsoul .
ThePriaticemanationisHanielandthisArchangel'name
means"HewhoseesGod(alsoGloryandGraceofGod)" . Whilethe
Atziluthemanationsrelatetoreligiousdevotionasawholethe
archangelicaspectistogivethesereligiousestablishmentsa
glimpseoftheirattainmentwhichisultimatelyunificationwith
God . Hanielinfactbringseachmysteryschoolorreligion
closer itsidealbyestablishingcontactwiththemthrough
theirownrespectivestructures . Suchinstructionisoftencon-
sidereddivine(wheninterpretedcorrectly)andisatremendous
stepforwardonthegoalofunification .
TheYetziraticinfluenceofNetzachrelatestotheElohim,
theangelicchoir . Acommontitlegiventothischoirofangels
isthePrincesorPrincipalities,whichancientlorestates"are
spiritscapableofgivingtreasureandriches,andtheyandtheir
dependentsserveinalloperations,beingamasscomposed
differentorders,andtheyaresufficientlytruthful . "
functionsaretoprotectreligiousordersandtryandguidethem
Their
the planet Venus .

The Hebrew word for Venus


show that love is shown through duty (whether
L15/pg6
on the correct path . n modernterms their duties are to inspire
religious thought and action and try to raise the level o emo-
tional consciousness, so that it can equate on a single level (at
Tiphareth) where a uniting and mergingwill take place and it
will then be restructured .
The Assiatic emanations of Netzachare typlified by the
magical image ofa naked beautiful lady, a standardarchetypefor
is Nogah .

The
influence

this planet shows in areas of love, attraction


(mental and physical) and productivity .

The esoteric concepts


it be given or
inflicted) . It shows a love of the beautiful, the arts, which
shows things from a materialistic viewpoint . It is life exper-
ienced at its finer points .
TheQlippothic beings of Netzach are the Ghoreb Zereq (dis-
persing Ravens) . Their forms are thatofhideousdemonheaded
Ravensissuingfromavolcano . TheyalsoarecalledCetzephiel .
theirinfluenceorpowercomesthroughinthewantofothers
possessions . Theqlippothicdemonsofthisregionhelptheir
humanconfederatesachievethisendthroughcollectivegroup
effort . Anyformoforganisedcrimecomesthroughthisemana-
tion . Alsotheyareresponsibleforeruptiveareasoflicen-
tiousnessonagrandscale .
TheTarotassociationtoNetzacharethefoursevenswhich
shows

forcetranscendingthematerialplane :

andislikea
1
I
M
r
1
t
bodyaura
level

mindandtheintuitivefaculties .
L15/pig7
crown which indeed is powerful but requiresonecapableofwear-
ingit
. Thesevensthenshowapossibleresultwhichisdepen-
dentontheactionthentaken
. Theydependmuchonthesymbols
thataccompanythem
. TheSevenofWandsshowsvalour,theSeven
of Cups illusory success, the Seven of Swords unstable effort and
theSevenofDiskssuccessunfulfilled .
TheesotericgradeofNetzachisthatofthePhilosophusand
isdesignatedbythenumbers4=7 .

Thecandidateshighermental
Venusandisespeciallyapplicabletohernature
ismanipulatedinthisgradeandopensupthe higher
alchemythis
correspondstothereddeningortheIsosiswhichisatype
stabiliserorunifier .

ItisherethatthePhilosophusmust
relatewithothersfromanemotionalviewpoint .

Hemustperfect
hisouterOrderknowledgesothatheispreparedtotakeonthe
mantleoftheSecondOrderinTiphareth .

Itisatimeofunifi-
cationandcompletenessofthematerial .
ThegeometricsymbolsofNetzacharetheheptangle,heptagon
andheptagram . Matherssays :'Theheptagonnaturallyrepresents
thedispersalofthepowersofthesevenplanetsthroughthedays
oftheweekandtheyear . Italludestothepowerofthesepte-
naryactingthroughallthings,asexemplifiedbytheseven
coloursoftherainbow . Theheptayramreflectedfromeverythird
pointyieldethseventrianglesattheapicesthereof ;fitly
representingtheTriadoperatingineachplanet,andtheplanets
themselvesintheweekandyear .

Theheptagramisthestarof
andasthe
L15/pg8
heptagramisthelinealfigureofthesevenplanets,soisVenus
asitweretheirgateorentrance,asthefittingsymbol
IsisofnatureandofthesevenlowerSephirothoftheBride . "
TheplantofNetzachistheRose,amultifacetedaspectof
symbolism . FluddforexampleconsideredtheeightpetalledRose
showedregeneration . Whenviewingthisflower,noteitspetals
andcolour . Atanyrateitdoessymbolisecompleteness,beauty,
andpassion . ThethornsoftheRoseshowthehardshipsand
sorrowassociatedtoit . ThewhiteRoseshowspurityandhigh
spirituality,whiletheGoldenRoseissymbolicof(Papal)
achievement . Theredroseshowsthebloodofthosespilledin
thenameofgood . TheblueRoseistheunattainableandthe
elixiroflife . TheRoseisperfectiontotheChristians,the
natureofallthingstotheKabbalistsfreefromthedesiresof
thefleshtotheEgyptiansandbeautyanddesiretotheRomans .
TheEmeraldisthepreciousstoneofNet :achandthewearer
wassupposedtopossessthegiftofprophecy . Thiswasdoneby
holdingthestoneinfrontoftheeyesandtrytoseeinit
ofthe
the
futureevents . Itissaidtoemitsuchapowerfulattractionto
thewearerthatitsealeduptheauraoftheweareranddrew
forthfromtheaurasofothers,andassuch,woulddrawthepower
outofanychargedtalismanorspellweaver,thusnullifyingit .
Thisofcourseappliesequallyaswelltothewearerifheorshe
isamagician . Ifforexampletwopeoplewereattractedtoeach
othertheEmeraldcoulddemagnetiseonesaura,thuscooling
passionsbetweenthem .
1
4
t
t
0
1
r
mother nature and was originallyconsidered
L15/pg 9
Hathoori

the Egyptian diety of Netzach and represents


headed goddesswhen associated to joy and pleasure .
anagricultural
goddess . She wasthe patron of the arts and women and linked to
thestar Sept (Sothis) . In her form of Hathoor of the Dead she
showed herself as a symbol of new life because she perfected the
new born in the underworld .

She was often depicted as

cow
She was
perfect example of a goddess whom the macrocosmandthemicrocosm
applied equally to .
AphroditewastheGreekequivalentofHathoorand one
stageshewasinfactcalledHathor-Aphrodite,
wasdroppedinfavourofthelatter . Hernamewastakenfromthe
Greek"Froth"becauseshewassupposedtohavebeenbornfromthe
frothoftheocean . ShewassaidtobethedaughterofZeusand
Dianeandwasthepersonificationofbeautyitself . Allmen,
evengods,wereinflamedwithherbeautyandshepresidesover
loveasshownbyhergirdle,whichcontainedeveryartofseduc-
tionwhichcapturestheheartsofmen .
untiltheformer
VenusistheRomangoddessofNetzachandwasacopy
Aphrodite ;assuchshehadthesamebirth .

Sheisthedaughter
fJupiterandwifeofVulcanandlikeherGreekcounterpart
possessesamagicgirdle . Asadietyshewasmoreactivethan
Aphroditeandnotasreliableexceptinmattersoflove .
TheFourthHeaveniscalledZebul .

TheTalmudsays :

'The
Herethesoulhastransmigratedtoanareaof
L15/pg10
dwelling
placeoftheheavenlyJerusalemandoftheTemplewhere
thealtariserectednearwhichstandsMichael,thegreatPrince,
offeringa-sacrificeuponit,asitiswritten(Kings8 :13) "I
havesurelybuilttheeahouseofhabitation(Zebul),aplacefor
thee to dwell in forever" . ' This Heaven is one in which man can
ruleasitisgrantedonlytothosesoulswhowillinglysacrifice
theirlivestothespiritualdirectiveoftheinnerplanes .
chiefangelofthisHeavenisPachdial(Fear)thenGuvrtial
Kzuial . TheArchangeloverthemisMichael .
The
and
The4thInfernalMansioniscalledBarSchachath(BARShChTh
911) meaning to open (a pit or hole in earth) . ShCHTh -means to
drain .

Theentireanalogyistodrainfromapitintheearth .
constantdeath
givingnohopeforredemption . Alivingdeathissufferedhere
inthisabode . Thechiefunholyangelgoverningthismansionis
calledMakatielwhichmeansplagueofGod .
TheKingofEdomforthisregionisSamlah(ShMLH=375)
whichisfromShMmeaning"thename(ofaspherewithin)"while
LHis"amovementofreproduction"(itspossibleArabicorigin
relatestocontraction) . TheDukeofEdomisKenaz(ONZ=157) .
TherootONmeans"tolament"or"wail"whileDNTzmeanstohunt .
Bygematriawefind157relatesto"leapingforth" . Theentire
conceptisoneofsurpriseattack . ThecitywhichboththeDuke
andKingbelongtoisMasrekah .
TheanimalsofNetzacharetheLynxandtheRaven(asa
1
1
40
11
r
1
L15/pg 11
Carrion Bird) .

The Lynx was originally the King of Scythia who,


jealous of Triptolemus' authority (to teach mankind agriculture),
was about to kill him when he was changed (by the gods) into an
animal of ingratitude . The Raven is another association here and
is usually a symbol of destruction . In alchemy it is a symbol of
the Nigredo (the blackening or first stage of theGreatWork) .
TheGreeksconsideredtheRavenasymboloflonglifeanda
messengerofthesungod .
DurgaistheHindudietyofthispath . Shewasthewifeof
Shivaandthesymbolforbothwisdomandmotherhood . Sheis
usuallydepictedwith10armsandridingonthebackofalionto
showhergreatstrength . Sheisalsoadietywhogivesgraces
andfavoursusingdevotion,discrimination,insightandblissas
herweapons .

Sheisalsoknownasthedestroyerofthedemons
duetoherrigorousattentiontothecorrectpath .
titlesistheUniversalMother .
Oneofher
TITLE :
TITLE IN MICROCOSM:
ATZILUTH NAME :
BRIATICNAME :
YETZIRATIC NAME :
ASSIAH - PLANET NAME :
OLIPPOTH :
HINDU DIETY:
EGYPTIAN DIETY :
GREEK DIETY :
ROMAN DIETY:
GEMSTONE :
MAGICAL WEAPON :
MAGICAL VISION :
AROMATIC :
VEGETABLE DRUG :
MINERAL DRUG:
TAOISM ASSOCIATION :
PLANT :
ANIMAL :
TAROT ASSOCIATInN :
VICE :
VIRTUE :
GEOMETRIC ASSOCIATION :
THE HEAVENS :
KING OF EDOM:
ASSOCIATIONS
NETZACH - VICTORY
LEFT HIP
YHVH TZABAOTH
HANIEL
ELOHIM
VENUS
GHOREB ZEREO
DURGA
HATHOOR
APHRODITE
VENUS
EMERALD
LAMP & GIRDLE
VISION OF BEAUTY TRIUMPHANT
ROSE ESSENCE
TINCTURE OF BENZOIN
ARSENICUM METALLICUM
KEN
ROSE
LYNX, RAVEN
4 SEVENS
GREED
UNSELFISHNESS
HEPTANGLE, HEPTAGON
ZEBUL
SAMLAH
L15/pg 1
1
1
40
I
I
I
I
I
M
I
r
HELLS :

BAR SCHACHATH
CHAKRA :

MANIPURA
ROSICRUCIAN GRADE :

PHILOSOPHUS
L15/pg 1?
1
4
r
I
1
1
M
LESSON1 6
HOD - SPLENDOUR/GLORY
'The 8th Path (Sephira) is called the absoluteorperfect
intelligencebecauseitisthemeanoftheprimordial,whichwas
norootbywhichitcancleaveorrestsaveinthehiddenplaces
ofGedulah,fromwhichemanatesitsproperessence . '
'Theabsoluteorperfectintelligence'meansinrelation
thisSephirathatithasreacheditspointofperfection,forHod
isthe Sephira oftheintellectandtheintellectisthepointof
manifestationinHod .

Itdoesnotmeanthatonewhoentersinto
thisareaknowsitallbutgivestheindividualwhoentersHod
theopportunitytocometogripswiththisfacetoftheirbeing,
andassuchanewrapportisdevelopedastheintellectandbody
starttoworkhandinhand .

Itisapointofregression,like
theotherSephiroth,eachcateringforadifferentaspectofthe
self .

Thereferencetothe'hiddenplacesofGedulah'shows
L1 6/pg 1
simplytheinfluenceoftheSephira(whichHod wasonceapart
of)holdsaspecialbalanceorrayasHod . Gedulahshowsmercy
andthisray(workingthroughTiphareth)drawsawaytheemotion
ofNetzachfromHod,leavingintellect .
Hodisthe8thSephiraandstandsforSplendour . TheOxford
DictionarydefinesSplendourasagreatbrightness,magnificence,
parade,pompandbrilliance . ThemasculinecentreofNetzach
mustnowreverttoitsfemininenatureasitentersHod,asit
niousrelationshipto truth,
L1 6/pg2
takes the essence of victoryandrefinesityetagaintoamore
stronger aspect by showing all whobearwitnessthatvictoryhas
beenwon . Hodinfactcommunicatesthenewsofvictorytall
whowilllistenandassuchanimportantkeywordinrelationt I
thisSephiraiscommunication .
ThevirtueofHodistruthfulness . Sincetheindividualwho
comesintoHodfaceshisintellectandslowlydevelopsaharmo-
itisthefirstthingthatmust
accompanythisalliance . Truthfulnesscomesthroughthecommuni-
cationaspectofHod'snature,asanyexchangeheremustbeone
inwhichthereisnodeceptionorthecommunicativefactorofHod
willnotpropelitsoccupantsintoNetzach .
TheviceofHod is selfdeceptionanddeceit . Thisalso
reliesonthecommunicativeaspectsofHod'snature . Itishere
thatoneencountersthefirstmajoraspectofegoexpansion and
selfdeception,itisthatfalseimpressionthatcanswayusoff
ourpath .

Hod,intermsofascent,isanalogoustothewater
elementandthereisarealdangerofsenseandperceptionloss

1
hereunlessonetrulydevotesoneselftothepathoftheGreat
Work . TheselfdeceptionofHodisrootedinthementalimagery
whichmustbetrainedinarchetypeassociationwhenthepsyche
beginstocomeawareoftheattemptstocorneritintosubmis-
sion,anditwillsendoutmanyfalseimpressionsthatonemust
beawareof .
ThemagicalpowerofHodisthevisionofSplendourandby
1 1
1
4 1 ,
L
1
1 1
M
r
association is shown in the vision ofEzekiel .
'AndIlooked,and,behold,awhirlwindcameoutoftheNorth,
greatcloud,andafireinfoldingitself,andabrightnesswas
aboutit,andoutofthemidstthereofasthecolourofamber,
out of the midst of fire' .
L1 6/pg3
Chapter1 Vs4 :
Forallintentsandpurposesthisis
adescriptionoftheentryintoHod,forEzekieltheProphetwas
thecommunicationofAdonai .
ThemagicalweaponofHodisthebadgeofoffice

the
ancientmysteryschools .
applicationoftheknowledgeofequilibrium,
Thiswasusednotonlyasanidentifi-
cationorprestigoussymbolasadefinitemagicalamuletthat
. awakenedcertainpowersoftheofficeofthewearer . Ifthe
officebeofaplanetary,elemental,orKabbalisticnatureit
would attract those powers to be utilised by the adept in ques-
tion. AnexampleofthisisgivenintheceremonyofthePortal
GradewherethelamenoftheHierophantisthusexplained : 'This
Hierophant'slamenisasynthesisofTiphareth,towhichthe
calvarycrossofsixsquaresformingthecubeopenedoutisfitly
referred .

Thetwocoloursofredandgreen,themostactiveand
themostpassive,whoseconjunctionpointsoutthe practical
aresymbolical
thereconciliationofthecelestialessencesoffireandwater,
forreconcilingyellowuniteswithblueingreenwhichisthe
complementary to red, and with red in orange which is the comple-
mentarycolourtoblue . Thesmallinnercircleplaceduponthe
crossalludestotheRosewhichisconjoinedtheretointhe
symbolismoftheRoseandCrossinourOrder . '
anditrepresentsthewaterelementandisdesignatedbytheMoon
aspartofitsemblem. ItisgovernedbythedietiesofSakti
andRakini . Thischakragovernsthereproductivesystem . Itis
thiscentrethatplayshavocwithsexualdesireswhenoverstimu-
lated,unlesstheseabundantenergiesaresublimatedwithinthe
otherbodysystems . Itishere,asinthecaseofEzekielthat
mysticalmanifestationfrequentlyoccurs .
ThemineraldrugofHodisMercuryorquicksilverandmust
beadministered in an extremelydilutedform . Someofthe
variousaspectsofMercuryare : MercuriusJodatus(forthroat
problems),MercuriusCyantus(Bronchial),Calomel
MercuriusCorrosivus(kidneyailments) .

Mercuryhelpsmore
specifically,withcomplaintsofthenervoussystem .
L1 6/pg4
The Chinese metaphysical association to Hod is the I'Ching
trigramSun,and is relatedtowind . Someofthecharacteristics
ofthistrigramare : indecisive,gentle,restless,yielding,
fragrant,obedientetc . Buttheabstractionisoneofpenetra-
tion . Thebodypartsitrelatestoarethethigh,breath,upper
arm,andrelatestothecompassdirectionofthesouth-west . It
isasymbolofgrowthinitsfirststagesofmanifestation . The
humanarchetypeitisassociatedtoistheeldestdaughter .
TheEasternchakracentreofHodisassociated

the
Svadishthanaandhassixpetals . Withthelettersb,bhm,
y,
(earproblems),
Itspsychic
effectsarethoseofthe prophet,inwhomitinduces state
wherebymanbelieveshehasseenandtalkedwithGod . Heinfact
considershimselftheDivineMessengerorHeraldoftheGods .
1
1
1
1
1
M
1
One of the
vegetabledrugsofHodisatincturetakenfrom
theLicoriceplant(Glycyrhiza)andwasusedsincethetimes
Egyptians .

Fromamedicalviewpointitwasusedforbronchial
complaintsandthepsychiceffecthelpedthevoyageronhis
astraljourney .

Valerianisanotherherbaltincturethatcanbe
usedhereaswell,itisanervineandantispasmodic .
TheeffectoftheworldofAtziluthonHodisthroughElohim
Tzabaoth . God Hosts(orarmies)andinasenseshowsthe
power of God's name in martial concepts . This of course reflects
powerofspiritualassociationtomundaneaspects . Atziluth
reflectsthecollectivevictory(ofhumanityasawhole)through
thepoweroftheintellecttodiscriminateandchoosethevarious
pathsofferedtous
. Itisthepathontheevolutionaryscalein
whichthepoweroftheintellectpredominatesandisthevan-
quisherovertheemotions(Yesod)andmaterial(Malkuth) . Any
exchangeinthisareaispsycho-spiritualandabovethemundane .
TheBriaticemanationsofHodareshownthroughthe
angelMichaelwhichmeans'Who(is)likeMighty'or
LikeGod' . AlsocalledSabbathiel,Michaelwasgenerallythe
forerunnerorheraldofanydivineplan . Heisoftencalledthe
Prince

Light .

Hewasaleaderofarchangelsintobattle
againsttheforcesofevil .
L1 6/pg
arch-
'Who

(is)
Michael'spresenceinHodistoshow
usenoughoftheDivinetowant andemulateitwhereverpos-
sible . SincethisarchangelistheonenexttoGodoutofall
theotherarchangelicbeingsheistheone,throughreflection,
we should try to look at by the process of example .
easilygrasp their concepts .
ually gives us new avenues or paths to traverse in order
stimu-
latestheintellectofnationsandcivilizationstocommunicate
along mystical paths and ideals .
TheYetziraticattributionisthechoirofangelscalledthe
Beni-Elohim,or"sonsofGod"or"sonsofthechiefs". The
angelicchoiraresaidtorevealalloccultmattersandsecrets
oftheologyandlaw .

Itistheywhodiscriminatethepowers
lightanddarknessforusinintellectualtermssowecanmore
Theyprovidethepatternsofour
thoughtsandmakeusutiliseourarchetypalconcepts the
fullest . Theyalsoprovidethroughthisservice, . therational
balanceoftheintellectualaswellasstimulatingmotivation .
TheAssiaticforces Hodareexpressedthroughthe
planetaryemanationsofMercury . Theseraysgoverntheintellect
andanyformofcommunication,andthesenseofsight . Itisa
planetwhichinesotericconceptsshowsusthewaytothe
UniversalMind . Itshowsushowtoapplywill,throughthe
stimulioftheintellectfor amorestrongerapplicationofthe
trueself . Herethediscriminatoriseverpresentandcontin-
toget
thebestfromtheself . Itisthecontinualsearcherorenquirer
who is always looking. fornewideasandactions .
TheOlippothicforcesofHodaretheSamielorJugglers,
whoseformisthatofdullyellowdemonheadeddoglikemonsters .
Thedisruptiveaspectoftheirnatureisbycommunicatingthe
1
1
4
1
M
over
Thothwasalsocalledthearbiterofthegodsandseldom
withany.

Hewasthecentralpivotinrecordingthelaws
causeandeffectandonlyusedhispowerswhenunfairnessdeve-
lopsbetweengods .
TheGreekcounterpartofThothisHermes,thepatrongodof
travellers .

oneofhisformsheconductedthesoulstothe
underworld .

isoftendepictedwithwingedsandalsand
helmet . Becausehewasonceguardianoftheflockheinturnnow
protectsthepossessionsofothers . Hermesisalsotheidea
youthitselfbybeingshownasahandsomeyouth . AstheRomangod
MercuryhewasthesonofMaiaandJupiterandundertookmuchthe
samedutiesashedidasHermes . HisRomannameisderivedfrom
the'Merce'becausehewasthegodofmerchandise . Hiswinged
helmetwascalledPetasusandhiswingedsandalswerecalled
L1 6/pg7
impetus to break with order in general . Their idea is to bring
forth total chaotic conditions, so that they can feedfrom the
random
energypatternsofsuchconditionswithouttheinterfer-
enceofthehigherTree .
TheEgyptiangodfarmassociatedtoHodisThoth,thescribe
ofthegodsandteacherofalltheartsandsciences . Hewasthe
personification thegodofallknowledge . Becauseallthe
sciencesofEgyptwererecordedhewasthedietywhopresided
thesebooksoflearning,aswellasthatofdivinespeech .
godhewascuriouslyapartfrommostgodsbecausehewas
selfcreatedandhispowerswereinrivalled . Hehadtheheadof
anIbisandheldtheAnkhinhismostcommonformofappearance .
sided
L1 6/pg8
TalariawhilehisswordwasknownastheHerpe . .
TheTarotassociationtoHodarethe4 eightswhichshow
solitarysuccess :
butnotleadingtomuchresultapartfromthethingitself . The8
fWandsiscalled'TheLordofSwiftness'andshowstoomuch
forceappliedtoosuddenlyresultinginaquicklyexpendedforce .
The ofCupshasatitleof'LordofAbandonedSuccess'and
showsonlytemporarysuccess . The8ofSwordsis'TheLordof
ShortenedForce'whichshowstoomuchforceappliedtotoosmall
anarea . The8ofDisksiscalled'TheLordofPrudence'and
showsovercarefullnessin
things .
successinthematterforthetimebeing :
TheabtractgeometricshapesappliedtoHodaretheOctagram
andtheOctangle . Matherssays : 'TheOctangleasawholeis
referredtothe8thSephirah,Hod . TheOctanglenaturallyrepre-
sentsthepoweroftheOgdoad,andtheOctagonshoweththeOgdoad
operatinginNaturebythedispersaloftheraysoftheElements
intheirdualaspectunderthepresidencyoftheeightlettersof
theName .

TheOctagramreflectedfromeverythirdpointyielded
eighttrianglesattheapicesthereof ;
PositiveandNegative,
orasitiswrittenboundtogetherIAHDONHI' .
HanumanistheHindudietyofHodandisusuallyshownwith
amansbodyandaMonkeylikehead .

Hewasoneofthegreatest
smallthingsattheexpenseofgreat
fitlyrepresentingthe
Triadoperatingineachelementinitsdualform,i . e . of
underthepowersofthenameYHVHADONAI
1
1
1
4
1
1 0
L1 6/pg 9
supporters of Rama and was possessed with enormousstrength .

He
is

diety of high spirituality as well as having fantastic


strength and esoteric evaluation he is one who has conquered his
earthly wants for higherspiritual union .

The Monkey aspect


his nature relates to his uncontrollableurges,buttheseare
neverunleashedandalwaysundercontrol . Hisheadisaconstant
reminderofthis . Heistriumph,victory,andinvincible .
TheOpalisoneofthepreciousstonesofHod . Itissaid
thatanOpalis, astonethatreflectsthemoodsofthewearer .
Ithasasmanycoloursattachedtoitastherearemoodsofhuman
nature . Amongitssocalledmysticalattributionwasthepower
tomakeitswearerinvisible . Henceitwasastoneoftenusedby
travellersasatalismanofprotectionagainsttheft . Alsoitis
saidtoenforcethevitalauraandguardagainstage . theOpal
wasastoneofbothgoodandbadfortune,dependingonitstype .
StoraxisoneoftheperfumesofHodandisobtainedfrom
avarietyoftrees(Myrrh)whichyieldtheresinStorax . Itis
usedinritualasanauriccondenserforitlingersintheaura
andtransmitsthewillofthewearertoanotherindividual
whetherforgoodorevil . InmedicinalworktheStoraxasanoil
is used for skinpreparations and when utilised as a compound
helpsanumberofskinproblems .
Lavender(LavendulaOfficinalis)isaplantofHodandasan
oilextractisusedinthecosmeticindustry(forsoapsetc) . It
canbeusedforbothglandularandskincomplaintsandissaidto
unwantedattentions .

It is used as arelaxant for any type


psychicwork .
TheGradeassociatedtothisSephiraisPracticuswhichis
designatedbythenumbers3=8 . Itisherethatthecandidate is
linkedwiththeKameaofMercuryandthewaterelements . While
inYesodonebecomesawareofemotionalcontrol,hereinHodthe
intellectisstimulatedthroughstudy . Theeffectoftheauraof
thelowermental,bodywhichgovernsthereasoningandthinking
processofthebrainpatternsisthatitcompletelyaltersones
mentalapproach,byproducingahighervibrationlevelwhich
createsnewpatternsofthoughtandreason .
OneoftheanimalsofHodistheJackalandisconsideredas
thePathfinder . InmythologytheJackalguidedsoulstothe
underworldintheformofAnubis . TheJackalisascavengerand
livesoff theremnantsofthekillofotheranimals . Itis
symbolicofonessensorynatureasshownbythecollaroften
depictedarounditsneck,whichshowsknowledgeobtainedbythe
senses . FromapsychologicalviewpointtheJackalisanaspect
of thedarkersideoftheself,buriedintheunconscious . The
magicalimage HodistheHermaphroditewhichhasadirect
bearinginrelationshiptotheJackal .
The3rdHeavenorMansioniscalledShehakim(1 0 1 8)which
meansclouds(orgrace) .

TheTalmudsays-ofthisHeaven :
L1 6/pg1 0
get rid of wrinkles .

It is used in preserving meat (through


smoking) and in magic it is
1
r
r
L1 6/pg 1 1
'Shehakim is the place of the millstonesthatgrindtheManafor
therighteousforitissaid(Ps78 : 23)"Hecommandedtheskies
(Shehakim)above,andopenedthedoorsofHeavenandhecaused
Manatorainuponthemforfood" . ThetermManameansbrilliance
orbrightness(Nogah) . 'Theentireconceptisone light
shiningdownwhichineffectopensuphigherlevelsofconscious-
ness . ThemillstonesthatgrindtheManaareinfactthekarmic
patternsoflife .
The3rdInfernalMansioniscalledTithion - theBilge .
Thisequatesto74 9whichrelatestoTMNmeaningtocoverup,
hideintheearth . TherootTITrelatestoearthormudgushing
forth,hencetheactionofapump . Itisanareaofintense
darknessandassuchisconstantlytryingtcleanseitself
(throughtheactionsoftheBilge)sothatitcandrawdownthe
Lighttonourishit . Itisverymuchliketheactionsofthe
physicalitselfwithconstantincarnationonthisplanetto
purifytheself .
TheKingofEdomassociatedtoHodisSaul(ShAL) .

ShA
whichrelatestoanoppositiontocalmnessorpeace . TheDukeof
EdomiscalledTemanfromtherootTHOUmeaning
description'andtheircityisRehoboth .
'definitive
TITLE :
TITLE IN MICROCOSM:
ATZILUTH NAME :
BRIATIC NAME :
YETZIRATIC NAME :
ASSIAH - PLANET NAME :
OLIPPOTH :
HINDU DIETY:
EGYPTIAN DIETY:
GREEK DIETY :
ROMAN DIETY :
GEMSTONE :
MAGICAL WEAPON :
MAGICALVISION :
AROMATIC:
VEGETABLE DRUG :
MINERAL DRUG:
TAOISM ASSOCIATION :
PLANT:
ANIMAL :
TAROT ASSOCIATION :
VICE :
VIRTUE :
GEOMETRICASSOCIATION :
THE HEAVENS :
ASSOCIATIONS
HOD - SPLENDOUR/GLORY
RIGHT HIP
ELOHIMTZABAOTH
MICHAEL
BENI-ELOHIM
MERCURY
THE SAMIEL
HANUMAN
THOTH
HERMES
MERCURY
OPAL
BADGE OF OFFICE
VISION OF SPLENDOUR
STORAX
TINCTUREOF GLYCYRHIZA
QUICKSILVER
SUN
LAVENDER
JACKAL
4 EIGHTS
SELFDECEPTION AND DECEIT
TRUTHFULLNESS
OCTAGRAM,OCTANGLE.
SHEKAHIM
L1 6/pg
1
4 1
I
1
1 0
KING OF EDOM :

SAUL
HELLS:

TITHION
CHAKRA :

SVADISTHANA
ROSICRUCIAN GRADE :

PRACTICUS
L1 6/pg 1 3
1
4
M
1
LESSON 1 7
YESOD - FOUNDATION
'The 9th Path (Sephira) is called the Pure Intelligence
because it purifies the emanations . It proves and corrects the
designing of their representations, and disposes the unitywith
which they are designed without diminutionordivision . '
Theterm'PureIntelligence'relatestotheemanations -
KetherflowingstraightdowntheMiddlePillarandarerefinedby
Tiphareth,thoughtheyarestillpurenevertheless .

It ishere
theintelligence of KetheractsonYesodandshapesandformsthe
energyofbothHodandNetzach,byproducingacompatiblevehicle
ofenergyfrombothsides of theTree . Justbeforei tgives
birth(disposed)intoMalkuthwhichistheninturnreunitedwith
Kether('withoutdiminutionordivision') .
L1 7/pg 1
Yesodisthe9thSephirothandsituatedintheMiddle
Pillar,itsEnglishmeaningisFoundation . LikeTiphareth,Yesod
hasanandrogynouscentreandisaSephiraofgreatrefinement
andcontraction.

Everything in Yesodisreadytobebuilton .
TheFoundationhasbeenlaidandawaitsthebuilder .

many
waysYesodislikeachildinthemotherswomb,duringthe9th
month,justbeforebirth .

Itisfullyformedandawaitsentry
intoanewworldofexistencesothatitcangrowanddevelop .
keywordtodescribethisSephiroth(apartfromFoundation)
"Shaping" .
L1 7/pg ?
The Nephesh or Animal Soul is associated to Yesod and is
loosely termed theunconsciouswheretheautomotivereflexes
lifearestored,ithasastrongrelationshiptothenervous
system,astheNepheschisconsideredthedrivingforceforthe
humanbody.

LeiningenconsideredthattheNepheschistheprin-
cipleformofmaterialexistence,theexteriorshellofmanwhich
isrevitalisedby his communicationwithotherlikebeings,due
itspassivesensitivity .

Hecontinuallycallsforthnew t
interior,
nally . This of course shows an overspillofthe outer layer of
theNepheschbeinginMalkuth,whiletheothertwodegreesare
firmlyentrenchedinYesod .
spiritualelementoperatesandmanifestsitselfexter-
ThevirtueofYesodis ' Independence,foritisherethat
newdevelopmentorgrowthisformulatedfromthetwoopposite
polaritiesoftheTree .

Itisnotstrictlyindependentassuch
butitisnewlifebeingformedintheTree,onthatbasis
independencecouldbeascribedtoitasthisisindependencein
itsfirststageofmanifestation .

TheviceofHodissubser-
vienceandshowssomethingwithabsolutelynomotivationor"get
upandgo"withoutinstruction .

Itisthe'nomind'situation
andisconstantlyinastateofpassivereceptivity .
ThespiritualexperienceormagicalpowerofYesodisa
aspectsofthispartoftheselftheninturntransformsthem,
sendingthembackintohisbeing . Leiningengoesontosaythat
theNepheschitselfisinthreedegrees(1 )concrete,(2)
General, (3) created matter, which are theorgansbywhichthe

I
1
1 4
I
t
L1 7/pg
vision the machinery of the Universe . This refers to Mans
first venture - into Yesod where his perceptions of the physical
world are left behind him and he sees the higher planes and their
relationshipstomanufacturingthecosmositself . Themachinery
oftheuniversedoesnotnecessarilymeanthestarsorplanets,
ortheirmicrocosmicaspectinmanhimself,butshowshisability
totranscendthebarriersofphysicallifeintoanotherdimension
intimeandspace(intheastral) . Bydoingthisheobserves
firsthandtheworkingsofthevariousplaneswithintheastral
andhowtheyfunctiontobringforththematerialworldinwhich
. welive .
ThemagicalweaponsofYesodaretheperfumesandsandals .
ThoughwingedsandalsareoftenattributedtoMercuryandHermes,
inYesodtheytakeonanentirelydifferentmeaning . TheMoonis
oftenreferredtoas"theGoddessofGoldenorBrazenSandal",
whichdepictstheMoonatitsfullness .

Theentireconceptis
one

movementwhichwillbediscussedlaterinthislecture
undertheplanetaryheading .

Perfumesassociatedhere,in
generalsenseapplytoair,theelementofYesodandarerelated
tothesenseofsmell .
TheMagicalimageofYesodisabeautifulnakedstrongman .
ThisisinfacttakenfromtheAtziluthicconceptsofYesodfrom
thenameShDIwhichsomeancientsconsideredtobepartofthe
verb ShDD,meaning"strongandpowerful,todestroy,oppress" .
TheMasculineconceptherewiththefeminineexteriorislinked
toAdamKadmon,forthefoundationisplacedinthegenital
region showing
procreativemasculinepower .
TheChineseI'ChingtrigramassociatedtoYesodisWANand
standsforwaterraincloudsetc
. Itscharacteristicsshow
clevernessandcunning,afluxofideasandthoughts,changing
concepts . The archetypal association is that of a young man who
intheearlystagesofyouthhasnotyetsettled
. Thebodyparts
thisassociatestoaretheabdomen,kidneysandcirculatory
system .
One f the mineral drugs of Yesod is from Lead (Ph) . Some
ofthehomeopathicremediesfromLead,suchasthePlumbumtype,
areextremelyhelpfulinbothmedicinalandspiritualhealing
.
Theycanpenetratetheethericthreadsoftheauraand"groundor
earththemsothattheaurabecomesdenser . Psychological
disorderssuchasphobias,canbecuredbyuseofLeadextracts
.
Plumb(Lead)canalsohealdiseasesofthenervoussystem,such
asmusculardystrophy,andmultiplesclerosis .

Onemust
extremelycarefulthoughinuseofthePlumbumremediesasthey
mustalwaysbetakenunderadoctor'ssupervisionandnever
experimentedwithononesown .
TheAtziluthnameofYesodisShaddaiElChai,whichmeans
"MightyLivingOne" .

Theinfluenceofthisworldisthat
fertilisation . It is an area of uniting forces into a harmonious
unit,itisthecreationandformationofanewlife . Thevibra-
L1 7/pg-4
tionsatthislevelutiliseaprinciplecommonlyreferred toas
"SoulMating"whichisthekarmicdestiniesofthosetomeetand
4 4
1
4
1
r
I
t
1
r
L1 7/pg5
live together for some important event . In Atziluth, individuals
as such are not its concern herebutratherabirthofanewera
orgeneration
. Itismarriageandunificationonthegrandscale
ofmankind .
TheBriaticemanationsofYesodareshown in thearchangel
Gabriel,whichmeans"PowerofhisMightyness"or"strongoneof
God". As a rulehewastheangeloftheannunciationandhence
issometimesassociatedwithDivineCreation,andisalsothe
angeloftheresurrectionaswell . Gabrielworksintheunifica-
tionofcountriesandmajorenterprises . Thisunificationisin
factabirthofsortsfornewdevelopmentprojectsandenter-
prises .

Gabrielisthearchangelofthenewgeneration .
associationofhishornwiththemusicoftodayisameans
communicatingnewideasandconceptsoninternationalevels .
TheYetziraticinfluenceofYesodisshownintheangelic
choircalledthe - AishimorFieryOnes . Theirtaskistoconstan-
tlyarrangethenewnessineverydaylife . Itistheywhosupply
uswithdreamconsciousness,andbymanipulatingtheworldofthe
dreamerformisintroducedbywayofcreativity .

TheAshim
supplyuswithideasofhowtoconstructnewprojects
The
andthey
alsohelpwithindividualbirths . Theseangelsdonotcreateas
such(althoughtheirfunctionfirstappearsasthis),butin
effectarrangefortheenergiesoftheupperTreetobemanifes-
tedintangibleterms . Inshort,theyareconductorsand
arrangersofideassothatwecanonanindividualbasis,under-
standtheemanationsofthehigherlevelsoftheself .
L1 7/pg 6
The Lunar influence of Assiah is a very complex one .

The
this
planet . Some its main influencesarebothgenerationand
conception . EverylivingthingonearthisaffectedbytheMoon
inonewayoranother .

ThetidesoftheOcean,thespeed

f
currentsorLunartidesemanatecontinualflux on usandon
plantgrowthandeven sanityofmindareall interrelatedwith
variousMoonphases . Moonphasesaresopowerfulintheireffect
thatmagicianscheckouttoseewhichaspecttheMoonisin
beforeanyritualisticpracticesareundertaken,astheseshould
onlybedoneuptoandincludingthefullMoon .
TheOlippothicelementsofYesodarecalledtheGamalielor
obscureones,whoseformsaredescribedascorrupting,loathsome
bull-menlinkedtogether . Theyarealsoreferredtoasthe
NachashielandObriel(orevilserpentsandblinddragonforce) .
Theseforcescorruptthehumanrace in termsofadvocatingsexual
impetusasthelimitofonespower,whichrestrictsthose
individualsfromtryingtoriseontheupperTree .
ThevegetabledrugsofYesoddifferfromotherassociations
becausetheyaregaugedontheireffectasanaphrodisiacandnot
asaplantassociation . Fromamedicinalpoint viewthe
aphrodisiacdoesnotexistbutlegendpersiststhatitdoes . The
sexualstimulimustcomeexternallyfirst,whichrelatesthedrug
tstrongauriceffects . Fromanesotericviewpoint,ifa
certainherbflower,likeanOrchidroot,wereharvestedatthe
correctastrologicaltime,andcorrectalchemicalpreparations
j
A
1 4
M
The Greek association

this Sephiroth is Artemis


Ephesus .

In thisformArtemiswasdepictedasamultibreasted
figure,thoughshewasalsoafigureofvirginity .

Thecultat
EphesusweresaidtobearaceofAmazons(fromtheGreekMazos
meaningbreast) .

Thesewerethefemalewarriorswhoonlywent

withmenforthefurthercontinuationofthespecies . Theonly
L1 7/pg7
wereemployed,theauricvibrationswouldremainwhichwhen
rubbedexternallywouldaffectourownaurawhichwouldinterm
triggeroffasexualstimulantwithintheself .
The Egyptian godformofYesodisShu who couldbeconsidered
a divinityoftheAir .

Shuwasaselfbegottengodinthesense
thatnofertilisationwasrequired . Heissaidtohavesprung
fromKhephra(alongwithTefnut)throughtheactofmasturbation .
ThebirthofShualsoascribestohim'beingraisedupoutof
waterymass' .

Fromanesotericviewpointthisisanidealasso-
ciationtoYesodwhichisbothwaterbydescentandairby
ascent .

Shuingeneralisatmosphere,whichisalsocloudsand
dew. Heisusuallydepictedasaseateddietywearingtwin
plumesandholdingbothaseptreandankh . Hewasagodoflight
(SunorMoon) .
menallowedintheirkingdomwereslaves . Asaracetheywere
trained for warfrombirthandhadanexpandingempireforatime
untiltheywereeventuallyovercome . Artemiswasthepersonifi-
cationoftheAmazonwarrior .
TheRomanassociationtoYesodisDiana,ortheGallo-Roman
L1 7/pg e
Dea Artio.

She was the sister of Apollo.

Since Apollo was the


Sun she was the Moon .
The precious stone associated to Yesod is Quartz Crystal
which shows numerous colours (when cutcorrectly) . Though not
precious inthematerialsense,themutiple varieties ofcolour
ofquartzshowsmovementinanabstractandyetrestrainedsense .
ThisislikenedtothemovementoftheMoonover a fourweek
period yetitisrestrainedinorbit . Thecolours also standfor
sensuality.
TheplantsofYesodaretheMandrakeandtheDamiana . The
Mandrake(MandragoraOfficinorum)wasmainlyusedinhelping
nervous complaints and according to Hebraic folklore is used in
rites ofexorcism . Ithas propertiesofanarcotic . TheDamiana
(T . Aphrodisiaca)isbotharelaxativeandsexualstimulant . It
wasusedextensivelyinreligiousceremoniesoftheAmerican
Indiansforfertilityrites .
TheTarotasociationtoYesodarethefournineswhichshow
agreatfundamentalforce . Executivepowerforrestoration . The
NineofWandsistheLordofGreatStrengthwhiletheNineof
CupsistheLordofMaterialHappiness . TheNineofSwordsis
theLordofDespairandCrueltyandshowstheanguishthe
mind,whilsttheNineofDisksisthelordof
showingcompletetransitionthroughbirthpains .
The perfumes of Yesod are Jasmine and Ginseng .

Jasmine
MaterialGain,
I
4 4
M
1
t
Ganesha
natureandimage .
L1 7/pg 9
scent is astrong Aphrodisiacbutisalsoarelaxativeandis
saidtohelpchildbirth . JasminumOfficinaleasanoilisused
as a base for some of the most expensiveperfumesintheworld .
Ginsengisanaromaticwhichalsoinducesprocreativeabilities
N
ofasexualnatureaswellasbeingtakeninternally .
isoneoftheHindudietiesofYesod .

Hehasthe
head

anelephantandisoftendepictedduetohispowerful
Heis saidtoremoveobstaclesbutalsogives
soundjudgementandneverrushesintothingsbeforethinkingthem
out . HewasthesonofbothParvatiandShivaandisshowntobe
acentralfocalpointofbalance . Thereareanumberoflegends
associated GaneshaandtheMoonandevensherespectedhis
power .
TheEasternchakracentreofYesodiscalledtheMuldahara
andisdescribedbythesymbolofafourpetalledredlotuswith
thelettersv, sh, s,s ingold,oneachofthepetals . Inthe
centre

thisisasquarewithaninvertedtriangle in the
centreandanelephantunderneath .

Thedietiesofthis centre
areBrahma,SaktiandDakini . Thesenseassociationtothis
chakraissmell . Itrelatestotheadrenalglandsandthecen-
tralnervoussystem . Thiscentreisinfactananchorforthe
Kundalineenergy.
TheElephantistheanimalofYesodandisasymbolofboth
strengthanditsassociationtoFoundation . Itscolourisalso
ofsignificance,asawhiteelephantisconsideredsacred .

The
'Raqia is the support of theSun, the Moon,
The Infernal Mansion of Yesod is called Perdition
L1 7/pg 1 0
Romans linked the elephant with immortality, while in Christian
symbology it shows the power of Christ going forth and trampling
everything evil underfoot .
The second Heaven is called Raqiawhich means firmament .
the stars and the
planets, as it is said (in Genesis 1 : 1 7) : "God set them in the
firmament of the Heaven" . ' Thisis a Heaven which is almost (but
not quite) visible . It is an area orplace which reflects the
emanations (of higher Heavens) but also links certainindividuals
who have importantduties on earth within the patterns of the
cosmos . 'Their brilliance is reflected therein' is one saying
that is worth repeating due to its accuracy . It gives them the
conscious aspect of cosmic consciousness .
(damna-
tion) or Abadon (1 1 3-63) .

This relates to a receding abode in


which is filled with affliction .

The root of this word is AB


(paternity, fruit) and DON (a cause or judgement -a type
dissension) .
The King of,EdomassociatedtoYesodisBAAL-HANAN,whichis
fromtheRootBAmeaninggradualmovementandHAshowingdeter-
minedexistence . Theinferenceofbothtogethershowsabirthin
progress .
Thegeometricfigures

Yesod arethe Enneangleand


Enneagram .

Matherssays : 'TheEnneangleasawholeisdeferred
1
A
4 4
i
P
1
fromevery3rdpointrepresenteththeTriple
bothinthesevenplanetswiththeCaputandCaudaDraconis
the Moon, andwiththeAlchemicalprinciplescounterchanged
interwoven . ItisnotsoconsonantwiththeNatureofLunaas
theEnneagramperfectedfromevery5thPoint . TheEnneagramis
thestarofLuna,andisespeciallyapplicabletohernature . It
representsherastheadministratrixtotheEarthofvirtuesof
theSolarSystemundertheSephiroth . TheEnneagramreflected
fromevery4 thpointiscomposedofthreet'-ianglesunitedwithin
circleandalludestotheTripleTernary

thethree
alchemicalprinciplesthemselves . '
The2=9GradeofTheoricusisan Fair Gradeandisonein
whichtheCandidateisexposedtotheplanetarysquareofLuna .
thisistostimulateintoactionthePituitaryglandorthethird
eyeasitissometimescalled . Inalchemythisgradecorresponds
ttheXanthosisortheyellowstateoftheexperiment . During
ritualnotonebuttwoaurasarestimulatedhere,thevitaland
theemotionalauras .
one emotionalstimuliwhichdrawsforthlifeforce(prana)
throughthevitalauraofthesubconscious . Itisinthisgrade
thatnewdesignsandsymbolsimprintthemselvesinthesubcon-
sciousoftheTheoricus,buildingthefoundationforfuturework
tocome .
L1 7/pg 1 1
to the 9th SephirahYesod .

It naturallyrepresenteththepower
theEnnead,andtheEnneagonshoweththeEnneadoperatingin
Naturebythedispersaloftheraysofthe7Planetsandofthe
HeadandTailoftheDragonoftheMoon .

TheEnnegramreflected
Ternaryoperating
f
and
Thetunainflience,associatedtoYesodis
TITLE :
TITLE IN MICROCOSM:
KABBALISTIC SOUL :
ATZILUTH NAME :
BRIATIC NAME:
YETZIRATIC NAME :
ASSIAH - PLANET NAME :
QLIPPOTH:
HINDU CONCEPT :
EGYPTIAN DIETY:
GREEKDIETY:
ROMAN DIETY :
GEMSTONE :
MAGICAL VISION :
MAGICAL WEAPON :
AROMATIC:
VEGETABLE DRUG:
MINERAL DRUG :
TAOISMASSOCIATION :
PLANT :
ANIMAL :
TAROT ASSOCIATION :
VICE :
VIRTUE :
GEOMETRIC ASSOCIATION:
ASSOCIATIONS
FOUNDATION
GENITAL REGION
NEPHESCH
SHADDAI EL CHAI
GABRIEL
ASHIM
MOON
GAMALIEL
GANESHA
SHU
ARTEMIS
DIANA,DEAARTIO
QUARTZCRYSTAL
MACHINERYOFTHEUNIVERSE
PERFUMESANDSANDALS
JASMINEANDGINSENG
ORCHIDROOTEXTRACT
LEAD
KAN
MANDRAKEANDDAMIANA
ELEPHANT
FOURNINES
SUBSERVIENCE
INDEPENDENCE
ENNEANGLEANDENNEAGRAM
L1 7/pg- 1 2
4 1
p
THE HEAVENS :

RAQIA
KING OF EDOM:

BAAL-HANAN
HELLS :

PERDITION
CHAKRA:

MULADHARA
ROSICRUCIAN GRADE :

THEORICUS
L1 7/pg 1 3
I
I
I
I
1
I
I
4
I
I
I
I
I
0
I
LESSON 18
MALKUTH - KI NGDOM
'The Tenth Path(Sephira) is called the Resplendent I ntel-
ligence because it is exalted above
everyheadandsitsonthe
thronefBinah
.I tilluminatestheSplendours
Lights,andcausesan
countenances,theangelofKether .'
Thetitle'ResplendentI ntelligence'showsthatonehas
reachedMalkuth
(bydescent)-andbythatvirtueoneattains
L18/pg1
fully
Mal kuth
allthe
influencetoemanatefromthePrince
the
unification with the brightness of Kether because now the Tree is
developedunit .

Theoldsaying"KetherisMalkuthand
isKether"appliestothisinstance .

Thereference
thethroneofBinahiscomplexbut we mustrememberthatBinah
wasthefirstseparationoffemininepolarity(fromChokmah)and
hencethefirststirringsofnewlifebeingformedonanasyet
unmanifestedlevelwhichrelatestoanentireTreebeforemani-
festing in a new area of development .
MalkuthisthetenthandfinalSephirothandmeansKingdom :
forthisistheworldinheritedbythecompletedforcethathas
madeitswayfromI Cether .I tistheoptimumpointofdevelopment
inthisplaneofexistence
.TheTreenowmustgoontoother
areas
.Malkuthisalsoapointofoverlapasit isat thepoint
coveredbythethreeveilsofnegativeexistenceofthenext
Tree .

Tohelpunderstandthiswetaketheelementofearthas
Malkuth and the other three elements as emanations from another
plane, all of whom contributeMalkuth'sformation .
ThevirtueofMalkuthisdiscrimination,anecessaryobject
lessonforthisisthegrossestareaofexistenceandaworldof
considerableoverlapsfromthefourelements
correspondingheavensandhells
.Assuch,discriminationis
neededforexistencealoneotherwisetheseotherworldswould
mixinwithourowntosuchanextentonecouldnottellthe
difference
betweenrealityofthisworldandthenext.Justas
firemustbeseparatedfromwaterinthenaturalorderofthings
so should other foundationsmakinguptheworldofMalkuth .
TheviceofMalkuthisscepticism(ofotherexistences)
whichistheresultofhumansbeingboggeddownonaMalkuthian
level,immersedintheirownsensationswithlittlethoughtor
actiondedicatedtothespiritualplane .

Withoutthehigher
spiritualaspirationsthesoulmusttryandwidenitsscope
thematerialplanethroughagradualbuildupofevents,sothat
theentitybeginstorealisethattherearemorethingsinheaven
andearththanjustplanetearth .
on
ThemagicalimageofMalkuthisayoungwomancrownedand
veiled
.Theveilshowsthehiddenessenceofthespiritualside
ofthings
.I nalchemicaltermsthisistheAnimaMundiandshows
thefirststirringsofgrowthinMalkuth
.Theunconsciousacti-
vityin
theastralshowsapreparationisunderwaybutitisnot
yetreadytorevealitself.

Fromtheesotericconceptthisis
1
4 4
i
f
I
0
elementsbutwithinthekarmicpatterns
ofdevelopment .
TheesoterictitlesofMalkutharenumerous .

Someofthem
are :
GatesofShadowofDeath - showthekarmicpatternoflives
throughwhichoneneverreallydies .
GateofTears

thesorrows
lifetimes .
Gate Justice- thisshowsthateverythingmust
balancedbeforeascentiontothenextlevelofexistence .
GatesofPrayer - showthedevotionalaspectoflife .
GateoftheDaughteroftheMightyOnes - thisshowsthe
birthofearthitselfintermsofplanetaryrelationships .
GateoftheGardenofEden - theentrancewaytothestate
ofthedivineisthroughEarth'sandhumanincarnation .
TheChinese'I 'Chingtrigram is Kun,orEarth .Thearchetype
itrepresentsisthemotherimageandshowsthepassiveor
receptivequalitiesofnature
.I nhumantermsitrelatestothe
softbodyorgansandcoverings .
Themagicalweapon
Malkuthisthecircleandthe
triangle
.Thecircleshowstheoutwardspiralwhichisgrowthor
dispersion .Thetriange at thecentreofthecircleshowsthe
balancedform(ofmatter)thatthegrowthistaking
.I tisthe
evolutionaryprocessofgrowthcontrolledbythenucleus,which
L18/pg3
mother nature, who is guidingour destinies through the four
learningin

various
whichmeans"LordorMasterofEarth" .
L18/pg4
is thetriangle
.Withoutthecircletherewouldbenocurrentto
extendthegrowthandwithoutthetrianglethecurrentswould
havenothingtoextendorgrow .
RockCrystalisthestoneassociatedtoMalkuthandis
usuallylikeicetolookat .I twasusedasasymbolofpurity
bytheChurch .I tsrelationshiptotheconceptofKingdomis
thatthepurityofitsappearanceshowsthestateofentranceto
heaven(asKether)throughMalkuth .
ThespiritualexperienceofMalkuthisvisionoftheHoly
GuardianAngelorAdonai :

Thistitleissomewhat .misleadingand
- actuallyreferstoawareness of a higherpresencewithinour-
selves whichisactivatedinthehermeticmysteryschoolsatthe
process

initiation .

I tisherethatmanfirstcomesinto
contactwiththehigherplanesofhislife .

Onemayperceive
higheressencethatsomecalltheChristorAdonai,thoughits
finerdetailsmaynotyetbeknowntous .
The-AtziluthiceffectofMalkuthisshowninAdonaiHaAretz
Theeffectofthisworld
istonourishmatterandcreateahealthyenvironmentforit
grow.

Themajoreffecthereisthatoftheenvironmentwhich
Atziluthcreatesasawhole .

I talsostabilisesthe magnetic
fieldoftheEarthandstimulatesgrowthofthingsingeneral .
I thasadualfunctionofbothsendingemanations(spirit)down
toearthandcollectingthedevotionsofthisplanetosendback
uptheladdertoKether .
1
r
A
4 1
I
i
0
r
Sandalphon which means "Co-Brother" ; from the Greek, Sandalfon
Syndelphos . H is the twin brother of Metatron and because
his remarkable height it is said he can reach his brother in
Kether itself.Sandalphon-influences world affairs in general
from the growth of thevariouscountriesbutalsothroughthe
environmentaswell .I tcreatesthebuildingblocksanddesigns
foreachcivilisationandgraduallystreamlinesthem .
TheYetziraticeffectisthrougntheKerubim,theangelic
choir - whocontroltheelementsontheincorporeallevel .

The
meaning ofthewordCherubinHebrewisfrom"whenceI shall
led ."

Thisangelicchoirisarashdeparturefromtheother
angelsastheywereformedfromaspectscfthepurestenergiesof
earthitself(suchasgold)(Exod .XXVi8,19: XXXVI I 9)and
theirshapesrepresentaspectsofthefourenergiesoftheele-
mentsthemselves .

Thesethougharenotelementsbutareplaced
betweentheangelsandtheelementsinheirachy .Theytakethe
energiesoftheelementsandsettheminmotion .Theyeffectthe
earth,andmanhimself .
TheenergiesofMalkuthinAssiaharethefourelementsand
spirit .Thefourelementsareinfactpartofmanandevery
aspect

fthisplanetbecausetheyarethephysicalformationof
L18/.pg 5
The effect of the Briatic world is through the archangel
or
. ourvery .existence . I tisimpossibletodoafulllengthstudy
theelementsinthesmallspaceallottedherebutanygood
bookonastrologywillmorethanadequatelydealwiththesub
L18/pg 6
ject .

The best way of association on a simple scale is : fire


heat and warmth, water - cold and
earth - coldandsolid .
nameLilith,theevilwoman .
firstbeautiful,butafterwardschangesintoablackmonkey
likedemon . LegendsaysthatLilithroamedtheEarthbeforeEve
andwaslaterthewifeofSammael .

I twasshewhomAdamthought
wouldbehisfirstwife .WhenEvewascreatedLilithtookflight
otherareasoutsidetheGardenofEden .Shewassaidtb
themotherofCain .Sheistheenemyofinfantsandtemptressof
man .

Shehasalsoothernameswhichsherevealedt

Elijah :
Abeko,Abito,Amizo,Batna,Eilo,I ta,
Odam,Partasah,Patrota,Podo,Satrina,Talto .
ThevegetabledrugofMalkuthisatinturefromCornSilk
andisadiureticanddemulcentthathelpswithproblemsofthe
urinarytract .I tsactionisthatofbreakingdownandtransmut-
ingsolidsintoliquid,whichispartoftheactionofMalkuth
.
I tsspiritualeffectisonthelowerregionsoftheNepheshwhich
stimulateitintoincreasingitsvibrationarylevelwhichinturn
raisesthepsychicpitchoftheindividual .
Dittany Crete is aperfumeofMaltruthandisextremely
powerfulinnature .Whenusedasanaromaticitcanalterthe
energyleveloftheadepti(duringmagicalworks)
damp,air-warmandmotion,
TheQlippothicforcesofMalkuth are personficatedbythe
Theappearanceisthatofawoman
I zorpo,Kali,Kea,Kokos,
sothatit
providesanenormousresidueofmagicalpower .

Whenusedin
1
a
1
i
M
A
Lie/pg7
worksofevocation,Dittany(whendirectedbywill)canpenetrate
theastrallayerandpickupthecorrectvibrationformateriali-
sation .Wheninhaledformeditativeworksitcanraisethe
consciousnessto avery highdegreeofperception,butthereis
alsoadangerofpossessionifusedinexpertly.Notethatthe
commonnameforDittanyofCreteisOreganum.
ThemineraldrugofMalkuthisMagnesium . I tisasilvery
typeofmetal . - As a medicineitcanbefound in avarietyof
formulassuchasMagnesiumChloratumwhichhelpstheliver,skin
complaints,andabdominalinfections .I talsohelpswith
tumours .MagnesiumPhos .isgoodfordiseasessuchasangina,
musclecramps,neuralgia .Fromtheesotericviewpoint,Magnesium
isthequalityofgrowth,itgivesout lifesenergies .
OneoftheplantsandtreesassociatedtoMalkuthisWillow,
whosebarkisusedforskinconditions .Aninfusion its
berriesisusedasasexualsedative .Therelationshipto
Malkuthisoneofrefinement .

PlantsfromtheLiliaceaefamily
arealsolinkedhere . Anytypeofalcoholmadefromtheessence
Lilyissaidtoearthpeopleorbringthembackto reality,
thoughitmustbeadministeredcarefully .I tsgeneralcharacter
meaningistopurify,andsweetness .I vyisanotherassociation
toMalkuthandshowsmarriageandgrowthtruetothereceptive
qualityofitsnature .
OneoftheEgyptiangodformsof Mal kuthisSeb who wasthe
sonofShuandTefnut,fatherof I sis, Osiris,SetandNephthys,
usually depicted as a seateddiety with a Goose mounted on his
crown . The Earth was in fact the body of Seb . He was the god of
theEarth's surfaceandtheunderworld,andwasoneofthegods
of k arma . i s saidtohavebeenagodofHeliopolis - the
birthplaceofEgyptiancreationaccordingtoitsinhabitants .
OtherassociationsherealsoareaspectsofI sisandNephthys,in
theirearlystagesofdevelopment .
TheGreekgodformofMalkuthisPersephone,thevirgin
earth .ShewasthewifeofHadesanddaugherofDemeterand
Zeus . thelegendofherabductionbyHadesintotheunder-
world,theentiremythisonebasedoncultivationofthevirgin
earthsothatgrowthwilloccur .Psycheisalsoanothercorres-
pondence notethatcanbeequallyappliedhereaswell .
Psyche(whichmeans"Soul"inGreek)wasamaidenofabeautyso
greatthatshewascarriedawaybyZephyrustoa
wasjoinedeverynightbyanunknownhusbandwhoturnedouttobe
Eros .

spiteofseparationandmanytrialsandtribulations
thetwoloverswereeventuallylefttotheirownresources
. dessofcornandadaughterofSaturnandVesta .
L18/pg8
and husband of Nut .

Seb can be also called Geb or Keb . eis


placewhereshe
with
theblessingofZeus .ThisrelatestoMalkuththroughmarriage
andunion .
TheRomangodformassociationtoMalkuthwasCeres,the
RomannameforMotherEarth .Shewasinherearlystagesagod-
Duringher
searchforherdaughterProserpinetheearthwasneglectedwhich
wasanunpardinablesinforthegoddessofagriculture .

Ceres
1
t
4 1
r
i
r
t
t
I
1
L1S/pg 9
first appeared in Sicily which she shed her abundance on .
Mathers says : 'The Dekangle as a whole is referred to the
Tenth Sephirah- Malkuth . The Dekanglenaturallyrepresentsthe
poweroftheDekad,andtheDekagramshoweththeDekadoperating
innaturebythedispersaloftheraysofthe10Sephiroth
therein .Thenumberofdegreesofa'greatcirclecutoffbetween
itanglesis36,thehalfoftheQuintileastrologicalaspect .
TheDekagramreflectedfromevery5thpointiscomposed 2
PentagramswithinaCircle .I tshowstheoperationofthedupli-
catedHehofTetragrammatonandtheconcentrationofthePositive
andNegativeforcesoftheSpiritandofthe4 elementsunderthe
presidencyofthepotenciesofthe5inBinah ; therevolutionsof
theforcesunderAimahtheGreatMother .'
Malkuthhasinfacttwogradesassociatedtoit .
is the 1=10 Grade of Zelator (meaning "seriousor
student")anditsmeaningisbelievedtohavebeenapplied
alchemicalstudents .

FraterAlbertus,inhis"`AlchemistsHand-
book"describessomeoftheoldRosicruciangradesfroma17th
CenturymanuscriptwhichrunsparalleltotheGoldenDawngrades
in theearlystages .

ThecandidateintheZelatorGradehasthe
earthypartofhisaurarevitalisedandenlargedwithincreased
sensitivity .

DuringtheceremonytheZelatoris"introduced"to
theearthelementandlinkedtoit .Thiseffectinalchemyis
relatedtotheblackeningormelanosis,astageofconsolidation .
I nmoderntermsthisisbringingforththerationalforthough
thisGradeisrelatedtoearth,itisalsorelatedtotheSephira
Thefirst
zealous
L19/pg 10
of Malkuthwhich incorporates all four elements in it and harmo-
nises the Zelatorwith his environment .(The nextthree grades
are more planetary related) .
The aura affected by this ritual is the etheric aura, which
has

type of energyfieldthatisdirecteddirectlyintothe
physicalauraduringtimesofillness .
energytobetappedandcanoftenbeexperienced as atype
"secondwind"whenexhaustionordepletionofvitalforcesis
experienced .

Thisadditional
aftershewentthroughthisgrade,
I tisareservoir-of
energyorpowerforceisthe
ethericlink (in amildform)throughthepoweroftheEnochian
Tablets .
TheinitiatoryGradeintotheOrderis-calledtheNeophyte
or0=0grade,inwhichtheaurahasavitalorlifeforceimpreg-
natedintoit.I sraelRegardielikenedthe0=0Gradetothe
alchemicaldissolutionprocesswhile Dion Fortunefoundthat
heraura,whichwasperforated
someyearsbeforebyapowerfulpsychic,washealed .The
Neophyteritualstimulatesthephysicalaura(whichisclosestto
thebody),byincreasingthevibrationalpitchofthetattwas
locatedinthesacralorlowestchakracentreatthebaseofthe
spine .This coursehasthephysicalfunctionofpromoting
goodhealth .
OneofthecreaturesassociatedtoMalkuthistheSphinx .
I tissaidtobethecompositeformofthebreastsandheadof
woman,thebodyofabull,thepawsofalionandthewingsofa
1
i
1
t
a
0
t
11
Lie/pg 11
bird . From an esoteric view this figure represents the elements
as the builder of life . The whole key concept is change through
transmutation .

Oneelementtransmuted,bytheprocessoftime,
intoanother .
TheHindudietyofthisSephiraisLakshmiwhowasthe
goddessofwealthandpower .

Sheisoftenshownstandingon
lotuswithalotusinonehandandgoldcoins in theother .
Lakshmiwasagoddessofjoyandhappinessandwasconsideredthe
powerbehindVishnu .
ThefirstHeaveniscalledVilonwhichmeans"veil

This
referstotheveilplacedoverEarthitself.TheRabbinicalbook
"PirkeHechaloth"lists 22angelsofthisHeavenunder Khabiel
ThisHeavenisonethatdirectlysurroundsusbutis still invis-
ible

ournormalsenses .

I tistheessenceoftheastral
I tisperceptibletosomeof
thosesensitiveenoughtorecogniseitsexistence .I tiswhat
theancientscalltheastrallight,thattwilightareawhere
souls meetduringtheirunconsciousmoments .I t is aworld
easilyreachedbythosewhowishtotry,itsmainentryformis
merelyacceptanceofitsexistence - areceptivestateofbeing .
planesinbetweenlifeanddeath .
ThenameoftheI nfernalMansionofHellassociated
MalkuthisShaol(337)=DepthsoftheEarth.Thisworld
sometimesreferredtoastheWellbecause itisthe blackvoid
whichthesoulsinksintoafterdeath .TherootShArelatestoa
powerfulmovementinretrogradeand assuchis a movementwhich
is
TI TLE :
TI TLE I N MI CROCOSM :
ATZI LUTH NAME :
BRI ATI C NAME :
YETZI RATI C NAME:
ASSI AH - PLANET NAME :
QLI PPOTH :
HI NDUCONCEPT :
EGYPTI ANDI ETY:
GREEKDI ETY:
ROMANDI ETY:
MAGI CALVI SI ON :
GEMSTONE :
MAGI CALWEAPON :
AROMATI C:
VEGETABLEDRUG :
MI NERALDRUG :
TAOI SMASSOCI ATI ON :
PLANT :
ANI MAL :
TAROTASSOCI ATI ON :
VI CE :
L18/pg1
is opposed to the Kabbalistic Universe and the Talmud . The root
OL shows anxiety or sorrow and when these roots are placed
together showa powerful opposing force of asorrowful nature .
ASSOCI ATI ONS
MALKUTH - KI NGDOM
FEET
ADONAI HA-ARETZ
SANDALPHON
KERI BUM
EARTHANDFOURELEMENTS
LI LI TH
LAKSHMI
SEB
PERSEPHONE
CERES
HOLYGUARDI ANANGEL
ROCKCRYSTAL
MAGI CALCI RCLEANDTRI ANGLE
DI TTANYOFCRETE
TI NCTUREOFCORNSI LK
MAGNESI UM
KUN
WI LLOW
SPHI NX
4 TENS,4 PRI NCESSES
SCEPTI CI SM
1
I s
r
t
t
p
r
VI RTUE :
GEOMETRI CASSOCI ATI ON :
THEHEAVENS :
KI NGDOM OF EDOM :
HELLS :
ROSI CRUCI ANGRADE:
DI SCRI MI NATI ON
DEKANGLE
VI LON
HADAR
SHAOL
NEOPHYTE,ZELATOR
L18/pg13
f
I
t
4
t
r
J
I
At thispointyouhavenowcoveredtheassociationsofthe
SephirothoftheKabbalisticTreeofLife,learnttheBanishing
RitualofthePentagrampracticingittwicedaily,andpracticed
someformsofGematria,NotariqonandTemura .RereadLesson3,
I ntroductiontotheKabbalah,asthislessonbringstolightthe
useoftheTreeofLife,andtheKabbalahinyourstudies .I tis
timenowtocommencesomeexerciseswhicharetobepracticed
P
}
LESSON19
throughoutthenext22lessons .Pleasenotethough,thatthese
exercisesarenotassociatedtothefollowinglessons .Theyare
butexercisescommencingyourpracticalmagicaltraining,tobe
includedwithyourreading .
MI DDLE PI LLAR
A tapebyI sraelRegardie,isrecommended for usewith
thislecture .THEMI DDLEPI LLARisavailablefromFalconPress
atadiscountedpriceof$10 .00,whichincludespostalcharges .
Thistapeprovidesthepracticalexplanationofhowtodothe
MiddlePillar .Listentothistapeuntilyouhavememorisedthe
exercise .Practicethisexercisedaily .
L19/pgI
Atthebeginningoftheexerciseyoumustperformthe
BanishingRitualofthePentagramasgiveninLesson2Part2 .
AttheendoftheMiddlePillarexerciseyoumustrepeatthe
timeitmaybecomealmostimpossibleforyouto
DON'TGI VEUPandletyourpsychegetthebetter of
L19/pg2
BanishingRitual

thePentagram.

Please follow these


instructionstotheletter .
Wehope you will,afterdoingtheMiddlePillarexercisefor
awhile,realiseitsbenefitsandcontinuethisexerciseforthe
restofyourlife,atalaterstageincludingalltheSephiroth
inyourexercise .Regardie'sbookon"TheMiddlePillar"should
expoundonthisfor you. I T I SAMUSTthatyougetholdofthis
bookandstudyit .Asyouworkthroughthiscorrespondence
courseyouwillgraduallyunfoldanunderstandingastohowyou
canusetheknowledgeoftheKabbalah,andtheTreeofLifethat
wehaveandwillbeproviding,alongwiththebenefitsandfuture
useofyourknowledgeofthe"MiddlePillar"exercise.
M_E_NTA_L_TRAI NI NG
THOUGHTCONTROL
Whileperforming your MiddlePillarexerciseeachmorning
youwillprobablyfindthatyourmindwanders,andoveraperiod
concentrate .
you.

Your
egodoesn'tlikegettingpinneddownandwilltryallthetricks
inthebooktodeviateyoufromyourpurpose,andhaveyou
believingthatitwasyour"inner"choice .Atthisstageinyour
trainingitisnecessaryfaryoutogivethisTricksterabreak
1
I
11
4 1
11
t
1
1
i
Butduring your littleperiodsofmentaltraining,
MiddlePillar,thatisYOURTI ME,sodon'tletitinterfere
.
Tohelpindiscipliningyourthoughts,doyourMiddlePillar
exercise in themorningsonrising,giveyourmindandpsychea
day'sbreakandperformthefollowingexerciseintheeveningson
orjustbeforeretiring .
gI nEg- i - se
L19/pg3
everynowandthen,sodothisduringyoureverydayactivities
.
likeinthe
Placeyourselfinarelaxedposition .
Closeyoureyesandthenobservetheflowofthoughtthat
moves
Later you canincreasethetime .Assumetheposition
beingasilentobserver,independentofyourthoughts
observe .
Trynottofallasleepinthisexercise,ifyoufeelyour-
selfdroppingawaytosleep,discontinuetheexerciseimmed-
iately,andtryagainthenextday.
Duringthisexercisekeepyourbreathingregularanddeep,
breathingfromtheabdomen .
Nowthatyouarewatchingyourthoughts,begintoholdthem
andnotletthemracepastformorethoughtstorushin .
Leteachthoughtgowhenyouwanttoletitgo,ratherthan
itjustslipaway,thengetholdofthenextthought .
tiNNo.rNNhh
acrossyourmind .

Dothisforfiveminutesatfirst .
and
L19/pg4
Thisexercise is forthepurposeoflearningtocontrol
our
thoughts

Various stages ofMental Exercises will be given


theendoffuturelectures .

Unlessotherwisestatedthey will
not berelatedtothelecturesthemselves
.Onlygoontothenext
exerciseafteryouhavemasteredthefirst .Youareyourown
guru,thereforeitisyourconsciencetofacewhetheryouhave
masteredsomethingormovedontothenextexercisedueto
boredom.
1
t
4 1
1
I
1
J
I
i
}
LESSON20
THEELEVENTHPATH
'The Eleventh Path is that of Scintillating I ntelligence
because it is theessenceofthatcurtainwhichisplacedclose
totheOrderofDisposition,andthisisaspecialdignitygiven
toitthatitmaybeabletostandbeforethefaceofthecause
ofcauses .'
simpleterms,theabovestatement,fromtheSepher
Yetzirah,showsthatasaPathitisplacedjustoutsideofthe
GodheadinKetherasitisanemanationfromitinbothtermsof
ascentanddescent .I tisgiventhequalityofaveilorcurtain
becausethetotalityoftruthcanonlybeshowntotheindividual
wheninKetheritself.Thename'Scintillating'isattributedto
itbecausethisPathisthefirstessenceoflifeitself,inits
purestformoutsidethe'causeofcauses'(Kether) .
TheHebrewletterassociatedtothisPathisAleph .By
GematriaALPh : 1+30+800=831whichmeans"direct,guideorteach"
whichdemonstratesanauthorativeforcetakingtheinitiative .
AnothermethodofviewingAlephisto
L20pg1
studyitsshapeandcompo-
nentparts .

I nfactAlephismadeupofaVauplacedbetweena
YodandaDalethwhichmakesuptheworuI VD=YOD : whichbythe
pointedhandillustratesthedirectionofforcebyguidance . The
shapeoftheletterisalsosaidtoresembleaplough .

Sincea
ploughisusedtotilltheearthandprepareitforgrowthit
The alchemicalsymbolismofthisPathis
withthedivineleashofinnocence .
L2Opg2
standsasasymbolofpotentiality .TheEnglishtranslationof
ALPhisOx(orbull)whichstandsforpowerandgrowth,the
beginningofspring .
itisthedivineessenceandispartofthefirstmatter .Froma
practicalalchemicalviewpointitisthewateryessenceofthe
experiment,thisappliestothethreekingdoms,animal,vegetable
andmineral .ThereisacertainrelationshipheretotheI ndian
conceptofpranaandtheChineseconceptofChithatcirculates
withinthebody.
TheTarotTrumpappliedhereisthe"Fool"whichdepictsa
nakedchildunderatree .Hestandsintheshapeoftheletter
Alephandholdshisdarkerside(portrayedbythewolf)incheck
Theblossomshereachesfor
arethoseofdivinewisdom,whichshowasthemicrocosm,the
subtlecentresofthebodyandasthemacrocosmthestars
(Mercury),
them
selves .Here,inthistrump,thechildhasemergedthevictor
(oflife)andpersonifiestheconceptofthe'DivineChild'for
he(orshe)isthechildinallofusthathasemergedtotake
control.I tisalsoimportanttonotethatthe'ChildGod'
aspect,inmodernpsychologicaltermsrelatestothepsycheof
theindividualinitsprimordialstatewhichisdependentonthe
actionsassociatedtothegodinquestion .
TheHindubeliefisthatallthingsaregovernedbytidesor
currentswhicharecalledtattvas .

Theseareinfivedivisions,
1
4
1
t
i
l
t
i
I
t
L2Opg 3
havingassociationstothefiveelements .ThenameoftheTattva
forthisPathisVayuwhichissymbolisedbyabluecircle .The
keyword thisTattvais'Locomotion'becauseifonewereto
classifymotionitwouldbecyclic,soitsenergyisdirected
intosphereticalethers .Vayuhasthefunctionofskinnourish-
mentandrepairwhichifbrokendowncanbeclassifiedintofive
differentsubdivisions(suchasTejasofVayuorPrithiviof
Vayu) .
OneoftheEgyptiangodformsofthisPathisNuwhichisone
oftheeightgodsofthecityofKhemennu(Hermopolis) .The
EgyptianBookoftheDeadreferstoNuintheformofaninvoca-
tion : 'I amthegreatgodaelfcreated,Nu,thatistosay,who
madehisnamesthecompanyofgodsasGod' .Thisundoubtedly
referstNuasaskygodwhowasbeforethecreationofthe
earth .JustbystudyingtheEgyptiancharacterforNuwefind
thedirecttranslationis'Godofthewaterymassofthesky' .
Becauseofhisuniquepositionagreatdealofdifficultywas
experiencedinpinpointinghisexactboundariesintheheavens .
HewasneitherPet(thesky)orNuit(theHeavens)sothelogical
placementofhisboundarieswasinbetweenthem .I nwaterdynas-
tieshewaslatermergedintootherareas .Otherkeynames
associatedtothisgodareabyss,deepandyoung .Fromamoder-
nisticviewpointNuwasthegodofatmosphere
linkedwiththeVayuTattva .
whichisdirectly
TheGreekattributiontothisPathisthatofHermes,mess-
engerofthegods,andtheepitomyofthe'DivineChild'myth .
L2Opg4
Hisbirthwasinacave,thechaosandrosetobecomeoneofthe
mainOlympiangods .Oneimportantassociationisgodofthewind
andwasalsoguidetothedeadsoulstotheunderworld . was
also a protectorandbenefactortomankindandactedas a guide
intravelsandbusiness affairs . Anotherimportantaspectof
Hermestheguideisthathecouldalsoleadasoulbacktolife,
fromtheunderworld .TotheKabbalistthisshowsthatHermes,
likethe11thPathcouldbeassociatedtodescentaswellas
ascent .
TheI ndianmythsassociatedhereisthatoftheMaruts(who
areaneasterncounterparttothewesternconceptoftheSylphs,
thefairiesoftheair)whowerethesonofRudraandPrisni
(goddessofthemonsoons) .

Thebestwaytothinkofthemisthe
godsofwind,stormandrain(whentheyunited) .
'BookofRagiel'statesthatitwillacquire
kings,princesandmagnets .I nmodernterminologyitis
Laterassocia-
tionshoweverelevatedthemabovetheirelementalstatustogods
oftheatmosphere .Theyareoftendepictedflyingacrossthe sky
in thecompanyofRodasi,wifeofRudras,whoapparentlyhassome
controlovertheirunrulynature .
ThepreciousstonesallottedtothisPatharetheTopazand
Chalcedoni .ThemagicaleffectsofTopazarenumerousbutinthe
thegoodwill
saidto
influencethoseinpowerfulofficestofavouryou .I nSanskrit
TopaziscalledPushyaraga,Si-Lang-SyakinCantoneseandYnakunt
Al-AzrakinArabic .
1
a
t
11
4 4
r
1
i
I
I
I
I
I
1
AlbertMagnus describeditscolourlikeSaffronwiththe
magicalpropertiesofrestoringsanitywhileRabancsMaurus
statedthatitinducedprophecyifcontemplatedon .Chalcedony,
abrightredgem,hasthemagicalpowerstowardoffevilactions
(ofapsychicnature)againstthewearerandasageneralprotec-
tionagainstevildemons(accordingtoGonelli) .
TheeagleisthebirdofthisPathandtheancientEgyptian
hieroglyphicfortheletter'A'depictsaneagleoveritwhich
signifiesthestart of anewday.Asanelementalsymbolthe
eaglestandsforairbutitgoesmuchdeeperthanthis .Depend-
ingonthecontext,theeagle in alchemicalsymbolismshows
Mercurius(1ststage)soaringorbeingliberatedfromthePrimea
Materia.FromtheearlyChristianviewpointtheeagleisa
symbol

thedivinemessengerwhichequateswiththeGreek
association of Hermes .
L2Opg5
TheSyrianconceptalsolinksclosely
withtheHermesmythastheeagleguidedthesoulsto
immortality.
TheegendaryorderofbeingsassociatedtothisPathare
theSylphs,theelementalspiritsofair .Theoriginsgobackto
thetimeofSolomonwheretheyweredescribedasresembling
birds .TheirkingiscalledParalda .Theirabodeisinthe
cloudsandtheysometimesmaketheirappearancethroughmistand
vapour .Thefavourtheybringtothosewhoappeasethemis
wisdomandtheyaffecttheintellectofman .Theyalsoappearas
wingedfairiesridingthewindontheirsteedsarounddawnand
sunset .
commandtheDemustobuildhistemple .
whosemeaningliesintheArabicrootoftheverb'tpenetrate'
alsoitshowsachoppingmovementakintoasword'saction .
ThesupremeElementalKingassociatedhereisTahoelojand
hisnameistakenfromthecircleofnamessurroundingthegreat
sealoftruth - theSigilumDei-Aemeth .TheDemonicKingofair
iscalledOriens .Hehas30subprincesunderhimandeightmain
servants ; Sarisel(MinisterofGod)Gasarons,Sorosma,Turitel
(mountaincastdown),Balaken(Ravagers),Gagison(spreadon
flat) , Mafalac(afragment)andAgab(beloved) .Thebasisf
LordOrien(accordingtoMathers)isfromtheLatinmeaning
risingoreastern, andalsoifspelledOriensisURO="toburn
ordevourwithflame" .

TheGreekEurus,Ezreia,Aneuru(Adj)
meaningextensiveorvastcanalsobeappliedaswell .
L20pg6
The cardinalpointassociatedtothisPath is eastand
Mizrach,governedbytheArchangelRaphaelbecauseofoneofhis
associationstothesun,whichrisesintheeast .

Hewasthe
archangelwhobroughtthemagicalringtoSolomonwhouseditt
Theangel is Chassan
ThevirtueofthisPathisNoscire(orknowing)itisthe
Pathoftheintellectthatcravesandseeksintellectual stimuli
asameansoroutletofexpression .

TheviceofthisPath
ignorance,heretheindividualignoreswhatheknowstobethe
, correctwayandinsteadpursuesalifethatisagainstthekarmic
patternthathasbeensetforhim .
a
4 4
11
11
i
6
I
M
L24 pg 7
The magical power of this Pathhere is divination .

a
lecture on the subjectofdivinationtotheGoldenDawn, Wynn
Wescott(underhismottoofSapereAude)says : 'Menperceived
thatthefreewillwhichtheyseemedtopossess,wasonlyahope
andnotanattainment,andsofellnaturallyintotheideaof
predestination, and then argued that if all before us is to be
predestineditmaybepossibletoforeseefutureeventsandso
divinationwas-bornandittookoverathousandshapes .'
ThemagicalweaponsofthisPatharethedaggerandfan .
Thefanofcourseisaninstrumentforcreatingaircurrentsand
assuchisassociatedhere .Somefansaremadefromfeathers
whichfurtherstressedtheAirlinkandisusedassuchinthe
2=9gradeofTheoricusintheGoldenDawn .Thedaggerisof
coursetheelementalweaponinairanditistobeusedinall
workoftheairynature,andunderthepresidencyofVau,andthe
"Sword of Tarot
AperfumeofthisPathisGalbanumanditsaromawasusedin
ancienttimesto ; promotedivinationbylightingincensearound
thetemplearea.Alsowhenastrologicalcalculationswerebeing
deducedGalbanumwasusedasitwasthoughttopromotetheintel-
lectandraisethespirituptotheloftyheightsrequiredofthe
workbeingdone.
I
I
I
I
PeppermintextractisthevegetabledrugofthisPath .I ts
medicaleffectistocalmthenervoussystemdownbybringingit
intosome sort ofequilibrium.

I nmagicalritesthisherbis
usually given after anysort of ritualistic or trance work, to
bring the adept back to a more calmer plane of existence .
The plant or tree of this Path is the Poplar (Aspen) and the
legend has it that of the Heliades the sisters of Phaeton who
watched as their brother fall from the sky intoariver .Because
theextentfo'theirgriefandtheconstantvigilattheplace
wherehediedtheyturnedintoPoplartrees .
airistheabilityofthePoplarto'quake'or'tremble'during

I
heavybreezes(duetothethintrunks) .
TheDemonicPrince airisAzazelwhichmeans"God
strengthens" .Thisangelwasoneoftheleadersofthefallen
angels .Heisdescribedasanangelofboththeswordandshield
andhencehisassociationtoair .
anangel

fireheisinfactassociatedwholly

airin
attitudeandaction .
TheRiverofEdenassociatedhereisandasdescribedin
Gen .11 .14 : 'Andthenameofthe3rdRiverisHiddekel : Thatis
itwhichgoethinfrontofAssyra' .

Thisrelatestotheeast,
thebirthplaceoftherisingsun .
butalsoforgrowthofthehighernaturemanifestinginanearth
plane .
TheElementalRulerof airisAriel whichmeans"Lionof
LOpg 8
Therelationshipto
Thoughsometimesdescribedas
I tstandsnotonlyforreason
God" .

Thisangel is usuallydepictedwithalionshead . Being


inthekingdomoftheelements,he also controlsQlippothic
I
i
I
I
I
I
I
M
I
I
This is fromthe
emptyspace .

I t
generalisations .
"WrathofGod" .
Rabbiniontexts .
throughstorms,
Malkiel(meaning
L2upg9
demonswhoareundertheairpresidency.Hischargeisnormally
onthefirstwindgustsandhesometimesgivesfavoursifcalled
upon .Arielequatesto24 2whichmeanstorestorsupportsacred
objects .ThisrelatestoairasacushionfortheHeavensover
theEarth .
Theintelligence of Uranus (which has a dual association
withaironthisPath)isAusiulwhoalsopresidesoverAquarius .
rootAU(orAO)whichisthelinkthatjoins
hasbeendescribedasmeaningvaguedesire,
ThespiritofUranusisZaaphielwhichmeans
Hehascontroloverstormwindsaccordingto
Accordingtolegendhedealswiththewicked
hurricanesandthelike .TheangelofUranusis
"GodsKing")whoaccordingtoreligiouslore
onceguardedthegateoftheSouthWindandhecontrolsthefiery
partoftheairelement .
YETZI RATI C TEXT :
ALCHEMI CAL ASSOCI ATI ON:
HEBREW LETTER:
TAROT :
EGYPTI ANDI ETY:
GREEK DI ETY:
ROMAN DI ETY:
PLANET :
MAGI CAL WEAPON :
VI RTUE :
VI CE :
MAGI CALPOWER:
MI NERALDRUG :
VEGETABLE DRUG :
TATTVA :
I NDI AN ASSOCI ATI ON :
GEMSTONE :
PLANT :
AROMATI C:
ORDER OF BEI NGS :
ANGEL- ARCH :
ANI MAL :
CARDI NAL POI NT :
SUPREME ELEMENTAL KI NG : TAHOELOJ
DEMONI C KI NG :
ELEMENTALRULER:
DEMONI CPRI NCE :
ASSOCI ATI ONS
SCI NTI LATI NGI NTELLI GENCE
MERCURY
ALEPH
THEFOOL
NU
HERMES
MERCURY
URANUS
DAGGERANDFAN
KNOWI NG
I GNORANCE
DI VI NATI ON
MERCURY
PEPPERMI NTEXTRACT
VAYU
MARUTS
TOPAZANDCHALCEDONI
POPLAR
GALBANUM
SYLPHS
MALKI EL
EAGLE
EAST(MI ZRACH)
ORI ENS
ARI EL
AZAZEL
L20pg10
1
w
1
1
I
A
LESSON 21
THE TWELFTH PATH
'The 12thPath is the I ntelligence of transparency, because
it is that species of magnificence called Chazchazit (seership)
theplacewhenceissuesthevisionofthoseseeingapparitions . '
TheYetziraictextrelatestoaplaceorpositionwhereone
seesbeyondtheusualphysical dpsychic l imitation . it
relates to thepsychicaspect of theselfdevelopedenoughtosee
theinnerworkings of theastralplanes . SincethisPathleads
Ketheritshowstheluminosityofthisdivinebrilliance(in
reflection),butenough of thepresenceofthedivinecanbefelt
andevenglimpsedwithourovertsensesthatthemortalbound-
ariesarecastaside . Sothatourtruewillguidesusinour
search

theunificationthisisnotseershipinthegeneral
sense butamagnificentintuitiveandemotionalexperience
thedivineblissoftherealSelf . I tisherethatoneperceives,
throughvariousdiversemeanstheperceptionsofanotherdimen-
sion . Toanextent,onebecomesthereceptorofvariousthought
modesemanatingfromourownhighergeniuswhichhaspermitted
thisparticularlineofcommunication .
TheHebrewletterassociatedtothisPathisBeth . Fabre
d'Olivetsaysthatthisletterwhenutilisedasaconsonant,
belongstothelabialsound . Asanabstractimageitrepresents
themouthofman,hisdwelling,hisinterior . Asagrammatical
sign, it
integral and
is the paternal and in nature acts as a virile sign,
that

interior and active action .

I n Hebrew, it

the
indicates article expression in nouns or action .
Beth has almost the same indicativemovement as the extractive
letter Mem,but with more force and without any extraction or
division of parts .
Hebrew word for the letter Beth is BI Th which has
valueof 412 .

By Gematria we find ChDTh "new", YThB "to settle,


dwell" and ThAVH "longing . Since Beth means House the above
associations are easilyapplied to a newhome. Fromanesoteric
standpointBethshowsussomethingjustbuiltorcompleted,and
inturnrelatesbacktotheTarottrumpoftheMagician,the
youngadept .
ThealchemicalassociationhereisthespiritMercurius
which has "grown up from the previous state and now has
stabilityandstrength .

I nthis, itssecondarystateMercurius
is

completedcomponentpart . Thatinturncaneither
extractedfromoraddedtotheexperiment,
spiritualquality . ForwithinitsdivineseedMercuryherewill
in turn now transmute to another level of refinement so that it
canre-emergewithotheraspectsofitself .
TheTarottrumpappliedhereistheMagician . Thegrownup
child portrayed in the Fool who stands before the altar (of the
universe)andgazesathiselementsandmeditatesbefore
them.

Thisi

thecardofpracticalritualmagic .

Hisbody
givingitanelusive
using
1
I
1
I
I
I
1
r
I
outline hat, and his tunic show the Caduceusasalsoportrayed
onhisclothing,showinganextremelystablestatecomingfrom
bothexternallyandinternally . I tis a symbol of DivinePower
abouttobeputintopracticalusethroughthescienceofmagic .
ThevirtueofthisPathisreasonandshowstheabilityto
rationaliseabstractconceptsandputthemintopracticaluse .
This uses the faculty of the mind, the will to rationalise the
newmodesofthoughtandstrengththeadeptwillfindonhis
Path . I t is the Path ofdirect action through application of the
highermentalfaculties . ThismeansthatwhileonthisPaththe
trueWillwillberevealed,andfollowedbythehigheraspectsof
Self .
TheviceofthisPathisfalsificationandrelatestthe
blindfoldoneputsontheself(bothconsciousandunconsciously)
sothetruewillisblockedandtheaspectsoftheselfare
aimlesslyindulged,whichisascatteringandwasteofenergies .
I tisherethatonelacksdirectionandtheintellectsuffersdue
lackofconsolidationanddesperatelytriestolatchontoany
modethatwillgiveitadditionalstimuli .
suffersalsobecauseitsmainfunctionsareblockedandthose
emanationsthatdogetthrougharewastedontrivia.
ThemagicalpowersorspiritualexperienceofthisPathare
themiraclesofhearingwhichshowdirectauriccontrol

the
aura,
thosewhoareill .

Thegiftoftonguesrelates
Thespiritualside
t
counterbalancethenegativeblockagesintheauraof
automatic
communication with those energies on the astral plane . This
oPens the channels up with thehigherselftodirecttheknow-
ledgesciencesnotyetknowntoman . I tisherethatone
beginstounderstandthesethingsforthebenefitofallmankind .
Egyptiangods thisPatharebothThothand
Cynocephalos . Thoth,as diety,hasbeenexplainedinthe
earlierlessonsbuthiscompaniontheCynocephalosordogheaded
apeislittleknown .

LikeThothhewasskilledin
balancedthescalesandreportedtheJudgement
Hermes is also associated here (as it was in
andusinghisflutetolulioneofthegiantstosleep
mathematics,
weightsandmeasures.

I theJudgementHallitwas

who
backtoThoth .
ThoughhisoriginsarepreEgyptian,itwastheCynocephaloswho
didtheactualweighingwhileThothrecordeditwhichshowsthat
theApewasthelowersymbolofthetwoandistheopenerofthe
way. HewasinsomecirclesconsideredtheloweraspectofThoth
himself .
Aleph),but
hereitrelatestoadifferentaspectofhisnatureandshowsthe
younggodasaformidableopponentandwielderofpain . During
thewarwiththeTitansweseeHermesusinghisskillsina
practicalmannerinhelpingZeusobtainbackhisstrengththrough
anoperationofsorts,andusingtheinvisiblehelmetofHades
through
manipulationorvibrationthroughmusicalnotes . Herewehave
Hermesthepracticalwarrior anaspectportrayedinthe
Magician .
1
q
1
The magical weapon of this Path is the emblem or Lauren
the Caduceus. UnliketheWand of
theCaduceuswhichisapplied
totheSephiraofChesedtheLaurenoftheCaduceusworksby
reflectionandnotbydirect
po. er thoughtheapplicationis
stillapracticalone
. Nevertheless,thisisalsoshownonthe
tunicoftheMagicianintheTarotTrump
. Theenergiesofthe
Caduceusarethuscontrolledindirectly(throughelementweapons,
ritualetc . .
Theemblemblindsthosewhoopposebalanceand
harmonyandgivesstrengthandharmonytothosewhoseekit
-
throughmanipulation .
ThelegendaryorderofbeingsassociatedtothisPathare
theI nvisibleAdepts
. ThoseMagicianswhocontrolthedestinies
of nations by subtle manipulations of the astral web. These are
thosethatarethesocalledMasters . Theyareinhumanformbut
livemanylifetimesandworkdirectlywiththe
maintainingthekarmicbalances .
astralplanesin
OneoftheperfumesofthisPathisMace,whichisderived
from the covering ofa Nutmeg . As an aromatic it isconsidered a
carminativeandalterstheauricvibrationsothatitis
morein
empathywithMercury
. TheyellowishqualityofNutmegisbutone
aspectofitsMercurialassociationasitseffectontheuseris
oneofaidingconcentrationandmemory
. I teffectsthesurround-
ingatmosphere(duringritual)byclearingawaythenegative
vibrationsandopensupachanneltotheoperatorwiththeastral
plane . WhiteSandalisanaromaticwhichstressesthewarrior
sideoftheMercurialnatureandusedinconjunctionwithMace
VLJl F+y O
brings powerful magical effect to any ceremony . Mastic and
Storax are alsoMercurial aromatics but they are of less density
than either Mace or White Sandal . Mastic is more for reconcilia-
tion while Storax is more a blank aromatic which can be used for
a number ofreasons, such as separation, birth, destruction, ill
will and revenge . On its positive side it canbe used for crea-
tive work in business.
A tincturefrom such plants as Wild Lettuce anideal
associationtothis Path . Thejuice and leaves are made into a
tincture which has a number of effectssuchasa sedative, hypno-
tic, anodyneetc . I t is used to help any nerve disorder . I ts
effect on the aura though is amazing and links the patient very
deeply with theessence of theplant . Thoughthisisadangerous
drugitseffectsarepowerfulintearingawaytheveilsof
reality,whichtheindividualmustbepreparedfor . I tcanbe
driedandsmoked . Absintheisanotherassociationworth
mentioning .
Agateisoneofthepreciousstonesof thisPath .

I ts
esotericvaluesshowthatitpromotesexcellentcommunicationand
favourabledispositiontothewearer,givingthisindividual
certainmagnetism. ManyoldMagicaltextscitedAgateasastone
thatwillguardtheweareragainstalldangersandt
allobstacles,aswellasgivecourage . TheAgatehasyettobe
testedforitsmagneticqualityanditseffectonthehumanaura .
I ftheancientsarecorrecttheseeffectscouldbeconsiderable .
Asanamuletitissaidtoprotectthewearerfromspellsandis
I
. i
Taphthartharath
also a symbol of authority .
Olympic Planetary Spirit is Ophiel . He is under the
Sovernorship of Mercury and has control of 100,000 legions and
easily gives familiar spirits . He teaches all the arts that are
related to Mercury and has the ability, through ritual alchemy,
to transmute quicksilver into thePhilosophersStone. Ophielcan
appearinavarietyfformsandshapes(accordingtoold
Grimores)butusuallyasafairthicksetmanwithamiable
speech .
Angel

MercuryisRaphaelanditsintelligence
calledTiriel .

AsadietyTirielispossiblyPersianinorigin
andrelatestodetermination(fromthedepthsofthemind) .
istheSpiritofMercury . I tsname is derived
fromtherootTPThmeaning"asign"or"example" . Anotherroot
THRisalsoincorporatedintothenamewhichmeans"infusion"or
"distillation"or"theessenceof"whichiscoupledwith
determination .
VervainisoneoftheplantsofthisPathandfromamedi-
cinalviewpointitisusedasanexpectorantforBronchialprob-
lemsandanantiperiodicfornerves .

I twasalsousedas
protectionagainstanyformofwitchcraft
.

Anotherassociation
i

herbMercury(MercurialisAnnua)whichisgreenincolourand
hashairyleaves .

I tisadangerousherbbutisusedfor
Rheumatismaswellasbeingapurgative .
TheSwallowisanassociationtothisPathandisinfact
dualassociation(toVenus) . I tshowstime,thebeginningand
of
theendandisoftenreferredtoastheheraldofspringandas ,,

'
suchhaslinkstoHermesasHeraldoftheGods .

TheI bisisyet
anotherassociationandisrelatedtoThothwhoisoftenshown

wearingtheheadofanI bis,asitwasbelievedthathehovered
overthepeopleofEgyptandinstructedthemwhileinthisform .
TheApeisofcourseyetanotherassociationofThoth .
TheHinduassociationtothisPathisRamawhoisusually
depictedwithabowandarrow(mindandwill) . Heisconsidered
bysometobethefinalincarnation,theperfectedman . Oneof
hisotherattributesisthechallenge,whichhedearlyloves,
especially of a mental nature . He is married to Sita (his intel-
lectualcounterpart)whichshowsasanabstractconceptthe
perfection4theintellect .

OneoftheRama'sservantsis
Hanuman,
asJustice .
theMonkeydiety, asymbolofWillandcunningaswell
q
1
YETZI RATI C TEXT :
HEBREW LETTER:
TAROT :
EGYPTI AN DI ETY:
GREEK DI ETY:
ROMAN DI ETY:
PLANET :
MAGI CAL WEAPON:
VI RTUE:
. VI CE:
MAGI CALATTAI NMENT:
MI NERAL DRUG:
VEGETABLE DRUG :
I NDI ANASSOCI ATI ON :
. GEMSTONE:
PLANT :
AROMATI C:
ORDEROFBEI NGS :
OLYMPI CSPI RI T :
ANGEL - ARCH:
ANI MAL:
AS_ -- SQQ-I I -AT-I QNS
I NTELI GENCEOFTRANSPARENCY
BETH
THEMAGI CI AN
THOTH
HERMES
MERCURY
MERCURY
CADUCEUS
REASON
S
FALCI FI CATI ON
MI RACLESOFHEARI NG
MERCURY
TI NCTUREOFWI LDLETTUCE
RAMA
AGATE
VERVAI N
MACE,STORAX,MASTI C
I NVI SI BLEADEPTS
OPHI EL
RAPHAEL
SWALLOW,I BI S,APE
4
I
I
I
I
I
This Path which links Kether to Tiphareth is called Uniting
I ntelligence and also has been referred to as the Path of Truth
because it comes directly from the godhead (Kether) on the middle
pillar, and as such is the Essence of Glory, because a form f
clarity is . envisaged . Since Kether is the head of the Tree and
Tiphareth is its heart the combination of the head and heart

acting asone can only be truth on its own level .


r
t
I
I
LESSON22
THETHI RTEENTHPATH
'The13thPathisnamedtheUnitingI ntelligence,
calledbecauseitistheEssenceoftheGlory . itithe
ConsumationoftheTruthofindividualspiritualthings . '
TheHebrewletterassociatedtothisPathisGimel(Camel)
which

Gematriaequatesto73andisthenumericallvalueof
Chokmah (Wisdom) and ChSh "to take shelter and trust in" .
de'OlivetsaysthatGimelasaconsonant,belongstotheguttural
sound
. Theonebywhichistranslatedisamoderninventionand
responds

itratherimperfectly .
certainCarviliuswho,
inventedorintroducedtheletterG,
Plutarchtellsusthata
and is so
havingopenedaschool

Rome,first
todistinguishthedouble
soundoftheC
. AsasymbolicimagetheHebrewGimelindicates
the throat of a man, any conduit, any canal, any deep hollow
object
. Asagrammaticalsign,itexpressesorganicdevelopment
andproducesallideasandoriginationsfromthecorporealorgans
and their actions .
The Tarot trump associated to this Path is the High
Priestess . This shows a young woman, lightly veiled, offering up
achalice .

Here she, as the quintessence gives part of herself


t the finder and is the grail bearer . Her water empathy is
shown by her blue clothing as bearing the very essence of life
itself to all those who would seek her and the cup she nourishes .
Out of all of the devotional qualification, she isapersonifica-
tionoftheelusiveelixeroflife .
TheEgyptiangadformofthisPathisAah-Tehuti (a form
Thoth)theMoonGod . Heisusuallydepictedasabeardedmummy
(withtwofacesthatsymbolisethewaxingandwaningmoon)witha
lunarheaddress . Hesymbolisesthegrowthorpowerofthenew
moonandalsowasconsideredthekingofgods,
L22/pg2
makerofeternity
andcreatorofthecreatures . Aah-Tehutiwasanagriculturalgod
as well as a god of new life . He is also a god of time and
prayedtointhiscategorywithgreatreverence . SometimesAah-
TehutiwasshownwiththeheadofanI bis,hencehisrelationship
toThoth .
GreekgoddessassociatedtothisPathisArtemir(aswell
astoYesod,butinanotherform),anagriculturalgoddesswhois
alsothegoddessofthechase . Hernameissaidtobederived
fromthebearwhichwasoftengivenasheremblem. moon
goddess she presidedover childbirth and as such was also a diety
of death as well as life . Though there were numerous versions of
1
44
t
i
Artemis she is often depicted as the
nature . Also he is both guardian and hunter
virgin huntress, with bow
and quiver . She was the daughter of Demeter and Zeus and sister
of Apollo. Also she was the goddess of
bow was said to unleash disease and pestilence those who
gained her disfavour . The Roman goddesses of the Moon were both
Diana, the goddess of light and of swiftness showing the Moon
waxing and Hecate thewaning side .
Soma is the Hindu lunar diety and is a departure from the
European feminine concept of afemalediety . Ourownchildren
storiesofthemaninthemooncanestablishaparwithSoma . I n
legendSomawasnotonlyamoongodbutthequintessenceofthe
godsintheformofagoldenelixer,thedrinkofimmortality
synonymouswiththeessencewithintheHolyGrail . Hewasagod
ofthestarwarsandwasconsideredbothgoodandevil,-hisforms
werevariedbuthistwomainoneswereofabull (with large
horns)andabird .
TheanimalassociatedtothemoonandthisPathisthedog .
ThereissomeassociationtoArtemisasshewasalwaysdepicted
huntingwithadog . Moreimportantlyinmodernterms,thedogis
asymbolofmansinertnature,thelatentordarksideofhis
music and dancing .

Her
andasymbolofmans
egonature . Sincethedogandegoarethesame,thehunterand
huntedarebroughtclosertogetheruntiltheymergeintoacom-
pleteharmoniouswhole . Thedogwithoutmanorhisegoselfis
oneextremehalfoftheCain . Thedogsymbolsareoften synony-
mouswiththewatcher or guardian(inChristianconcepts)while
the old hebraic concepts showed impurity . Plutarch summed it up
bysayingthat dogs show theconservative, watchful, philoso-
phical principle of life .
The magical attainment associated to this Path is shown
through dreamclairvoyance . These are not happenings of mere
chancebutacarefullyworkedoutplayinwhichthedreameras an
aspect of egoconsciousness, directs and takes part in, through
the Yechidah, the core essence of self . Dream divination can be
either spontaneous or induced by experimenting with meditation
before sleep .

I n reality, this Path relates to the aspects


dream control fordivination purposes .

Control can andi


usually done, through will power and repetitive exercise .
Lam=. . / pg'+
of
The
useof dream symbolism for the occultist is shown by the amount
of studies on occult symbology which one has assimilated, and the
acceptance ofthis materialon a very deep psychological level .
When one studiesthe associations to the Sephiroth and Paths they
in factinterrelateintothesubconsciouswhichthenputsmanyof
these kabbalistic images under headings which control our deepest
feelings . They then become moreeasily identifiable for us to
interpret .
The magical weapons associated to this Path are the bow and
arrow and are undoubtedly related with Diana and Artemis as
hunters . The shape of the bow depictsthe lunarcrescent, which
when pulled folds out showing the full Moon . On releaseofthe
bowthetensionisreleasedandthecyclebeginsagain . There
areanumberofassociationstothebow,allofthemlinktothe
1
t
49
r
i
I
I
mind in some way . The bowis intuition which finds ittarget (in
the dark) with theunconsciousorZenaspect of training . I t
shows the mind, through will, directing the energies . f its
unconscious contents.
Thevirtue of this Path is virginity in its moraland esote-
ric significance . Virginityinitsbroadestsenseoftheword
relates to the untapped depths, which when applied across the
board to everyday slang is often called virgin territory, an area
of the unknown . These depths in relationship to Simel relate to
thepurest essence of the spirit that has not been contaminated
by any foreign condition .

I t is this purest essence that we all


possess that aligns us with the concept of both purityand virgi-
nityas a concepttorespect,regardlessofitsphysicallimita-
tion .
The vice of the 13th Path is stagnation and it only differs
fromthe above paragraph in the form of potential . Virginity as
a virtue is an untapped resource which awaits awakening . Stagna-
tion is in fact the self same resource that refuses
and as such all the purity and spirituality is stagnated . The
driving point of these two faculties is emotional stimuli . The
virgin is like the drawn bow about to be sprung while stagnation
isa pool that no one uses or comes to.
There are number,of perfumes associated to this Path .
Lignum Aloes is one and is said to relate to the fourth, eleventh
and

twenty eighth

lunar mansion .

I ts stimuli

is

in
awakening,
reconciliation of opposites as well as producing certainpsychic
effects .

Menstrual fluid isalsoabasisforaperfumeandis


saidtoattracttheforcesoflovewhencorrectlyappliedand
called forth .

Thisrelatesnottotheblooditselfbuttothe

highcontentofitsspiritualvaluewhichwasrecognisedfromthe
lawsofMosestohischosenpeople,andtotheceremoniesof
NorthAmericanI ndians .
ThevegetabledrugsofthisPathareallthoseofanemmena-
gogue nature, that is, drug that brings on menstruation .
Pennyroyal(MentaPulegium)isonesuchherbthataninfusioncan
bemadefromtostimulatethemenstrualfunction,andisalso
goodforrheumaticsaswell . TheJuniperBerryisanotherplant
whoseinfusioniswellappliedhereandhasavarietyof
applications .
ThelegendaryorderofbeingsassociatedtothisPathare
theethericformsorcommonlyknownasGhosts . Theseareinfact
theethericforms(orbodies)ofthedeceased . I tisalsonoted
thattheactionsoftheseformsappearmorefrequentlyafterthe
SpringEquinoxandithasbeenconsideredthatthemagnetic
influenceofthesunontheearthatthisperiodproducesafield
thatactivatesdormantethericshellsthatshouldhavebeen
dispersed deathbutexistbecauseofastral-ethericfreak
conditions . Theethericbodydoesretainthememoriesofthe
individualwhoinhabiteditinlifeandwhenmagnetically
effecteditcandrawonenergytohelprestructureitsfabric
enoughformaterialisation .

I nsomeinstancestheseetheric
1
44
1
i
1
1
shells can drawfrom the living causing energy depletion and
general ill health .

Etheric shells are not to be confused


spiritual hierarchies but should be thought of as a residue
energy thatshould be dispersed into the atmosphere .

I thas
soulandnospirituallinksontheinnerplanes
with
no
andgenerally
wandersintheastrallightwhichcansometimesoverlapintothe
physicalworld .
TheOlympicPlanetarySpiritoftheMoonisPhul,
alsotheangelofMondayandisreferredtoas
PowersoftheMoonandSupremeLordofWaters' .
extendtochangingallmetalintosilverandgivesservicet
mankindofhiswaterspirits .

Alsoheteachesthesciences
Lordof
thosewhocallhim .

TheoriginofPhulisintheArabic
the
Hispowers
fore-
bearer oftherootPHLwhichrelatestoaprivilegedconcept,
distinguishingordividingintoparts(stagesoftheMoon) .
MugwortisalsoassociatedtothisPathandtakesitsname
fromtheoldGermanicphrasemeaning'flyplant'andissonamed
becauseitsvibrationsannoyinsects . Folkloreshowsusthat
thisplant,apartfromprotectingonefromspells,itcanbeused
asatobbacosubstituteandwhenitsfumesarebreathedinafter
dryburningscaninducevisionaryforms . I tseffectsarevery
noticeablewhenplacedunderapillowfordreamorclairvoyance .
MoonstoneisagemofthisPathandlegenddictatesthatin
thisstonethereisamovinglight . Thisisbecauseofthelight
variationonthestone'ssurface . Kunzconsidersthisisbecause
of a clairvoyancy produced bytheangledplaneswithinthegem .
I tisastoneofgoodfortuneandisusedasagiftforlovers
anditissaidtogivethemthegiftofclairvoyancy(ifplaced
inthemouth)whenthemoonisfull . Thestoneissaidtohave
anauricvibrationsimilartothemoonandassuchisconsidered
amooninmicrocosm .
TheArchangeloftheMoonisGabrielwhiletheintelligence
of

theMooniscalledMalakB
Schechalim .

Thespirit

LunaisSchadBarschemothHa
. Shartathan . The28AngelsoftheLunaMansionsareasfollows :
1 . Geniel
2 . Enediel
3. Anixiel
4 . Azariel
5 .

Gabriel
9.
TarshisimVe-AdRuachoth
Amnediel15 . Atliel

22 . Geliel
Barbiel

16 . Azervel

23. Requiel
10 . Ardifiel17. Adriel

24 . Abrinael
11 . Neciel

18 . Egibiel

25 . Aziel
12 . Abdizuel19. Amutiel

26 . Tagriel
6 .

Dirachiel13 . Jazeriel20. Kyriel

27. Atheniel
7.

Scheliel14 . Ergediel21 . Bethanael28. Amnixiel


1
41
I
I
I
YETZI RATI C TEXT :
HEBREW LETTER:
TAROT:
EGYPTI AN DI ETY:
GREEK DI ETY:
ROMAN DI ETY:
PLANET :
MAGI CAL WEAPON:
VI RTUE :
VI CE:
MAGI CAL ATTAI NMENT :
MI NERAL DRUG:
VEGETABLE DRUG:
I NDI ANASSOCI ATI ON :
GEMSTONE:
PLANT :
AROMATI C :
ORDER OF BEI NGS :
OLYMPI C SPI RI T :
ANGEL - ARCH :
ANI MAL :
UNI TI NG I NTELLI GENCE
GI MEL
HI GH PRI ESTESS
AAH-TEHUTI
ARTEMI S
DI ANA
MOON .
BOW AND ARROW
VI RGI NI TY
STAGNATI ON
DREAM CLAI RVOYANCE
SI LVER
I NFUSI ON OF PENNYROYAL
SOMA
MOONSTONE
MUGWORT
LI GNUM ALOES
GHOSTS
PHUL
GABRI EL
DOG
I
4
A
t
4
LESSON 23
THE FOURTEENTHPATH
'The 14th Path is the I lluminatingI ntelligenceand is so
calledbecauseitisthatChasmal(scintillatingflame)whichis
thefounderoftheconcealedandfundamentalideasofholiness
andoftheirstagesandpreparation . '
TheYetziratictextwhichlinksBinahtoChokmahiscalled
I lluminatingI ntelligencebecauseitdealswiththeconcealed
. -(yetofaholynature) . SincetheconceptsofthisPatharethe
oppositesofBinahandChokmah,onemustconsiderthatbetween
themaneutralfieldexistswhich is theharmoniousinfluenceof
both . Outoftwopolarities,athirdisthenborn . Thescintil-
latingflameisofcourselifeitself,nurturedby . itsdivine
essence . ThisrelatesbacktothethreepillarsontheTreeof
Lifewiththecentralpillarjoiningthem .
TheHebrewletterassociatedtothisPathisDaleth,which
ingeneraltermsmeansadoororentranceway . Theletters
and
makingupthenameDLThequatesto434whichis'LordorMan
War'aphraseofthesamenumericalvalueofAI ShMLChMH
relatestothesuccessfulexitofthechildrenofI sraelintothe
wilderness,andthevictoryoverthePharaohsChariots . Herewe
haveatransitionfromonelifestyletoanotherwhichcould
likenedtogrowthanddevelopmentthroughfreedom .
de'Olivet considers that Daleth, as a letter, belongs to the
dental sound . I t was the emblem of the universal quarternary ;
that is to say, f the sourceof all physical existence . As a
symbolic image it represents the breast, and every nourishing and
abundant object . As a grammatical sign, it expresses in general,
abundance born of division . I t isthesignofdivi'siblaand
dividednature . TheHebrewemployitasanarticle,butenjoys
thatprerogativeinChadiac,SamaritanandSyrian,whereit
fulfilsthefunctionsofakindofdistinctivearticle .
TheTarotcardofthisPathistheEmpressandshowsawoman
(wearingacrown)seatedonathroneandholdinganorb(witha
crossupon)it in herlefthandand a wandintherighthandwith
adovehoveringoverherleftshoulder . Thisshowsthepersoni-
fication motherhoodwiththedivinerighttoruleoverher
lifeandherchildren,shownbythedovejustaboveher,sheis
. at peakofspiritualgrowthastheunbornchildinherwomb,
alsoshownbythe-doveliftsherspiritualandemotionalgrowth
toahighlevelofdevelopment . Sheisfertilityatitsbest .
TheEgyptiangodfarmofthisPathisHathor,whoisalso
associatedtoNetzachaswell . I nNetzachherassociationis
ratherageneralone(covering . maiden,mother,oldcrow),butas
the14thPathitismoredirectlyrelatedtootheraspectsof
Hathor'snature . I noneformshebecamethetoolforthewrath
of

toDestroymankindforhistreasonagainsthiscreator,
whichfitsinwithevaluationofDalethbyGematria . AlsoHathor
intheformofHet-Hereliterallymeans"Houseabove(skyor
t
i
L
As a Greek diety Aphrodite occasionally indulgesin warrior
pursuits . While protecting her son Aeneas, she was slightly
wounded by Diomedes . She was a love and warrior goddess, the
latter being the darker side of her nature which was a favourite
of the Spartans who offered sacrifices to her on the birth of
female children .

As the Roman goddess, Venus, she was a love


' goddesswithout peer, she was also called Cypria, Cytheraea,
Exopolis, Philomeda, Telessigama, Coliada, Area, Verticordia,
Apaturia, Etaria and Libertina, to name but a few.
The magical weapon is the Girdle of both Venus and Aphrodite
which applyhere, as it does for Netzach . The girdle was called
'Cestus' by the Romansand 'Zune' bythe Greeks . I t gave the
wearer the power to be irresistable to others regardless
physical appearance . I t was used by Juno to capture the rapture
of Jupiter so that his attention was drawn fromthe Greek-Trojan
conflict, while Neptune aided the Greeks to victory .
heaven)
land .
in many ways likethe Girdle of Venus .
control ones auric vibrations so that they can attract the vibra-
,
she was also the goddess of the underworld,
tions of another member of the opposite sex .
done at a conscious or unconsciouslevel does
I t is the ability
or holy
magicalpowerofthisPathisauricmanipulationandis
Whetherthisis
notmatter,just
theabilitytodoitgivesonetheessenceofthispower .

Ona
consciouslevelthisismoredifficult,becauseitrequires
constantattention .

I n a sense it can be best described in one


word "captivation" .
The vegetabledrug of thisPathisanyaphrodisiac . These
drugsworkontheegoandstimulatethe flow rate of thechakra
centres through theTattwas . Ahighlymagneticaurastimulated
fromeitherthegenitalorheartchakrawillaltertheflow
sothatitproducesaveryhighmagneticcharge,whichdraws
otheraurastoit . Oncetheseaurastouchandmergethestimu-
latedonethentakesonavampirelikeactionbydrawingfromthe
auraonewishestocontrolandassuchdullsthe
stimulithatisnormallyactivatedatthistime .
rate
normaldanger
ThereareanumberofperfumesattributedtothisPathand
allarealluringinnature . OneoftheseisfromPatchouli
(usingthedriedroots)andanotherisTuberosewhichwasuseda
lotinMalayaandI ndonesia .

Adrugthatcanstimulatesexual
desiresisParachloro-Phenylanilide(Pupa)whichatthetime
writingisasideproductofTumorresearch .
Thevirtue

thisPathismotherhoodanditshowsthe
chosenreceptacleforthedivinespiritoflifetoenter . I tis
thehighestofvirtuesinboththehumanandspiritualplateau
andhasbeenconsideredassuchbyjustabouteverycivilisation
onthisplanet . Thereareteachingsofmotherhoodthroughthe
ages*butallshowit is astateofholinessandreverence . I tis
atimewherebothmotherandunbornchildshareandlinktheir
aurasinastateofcommunicationknownonlytothem .

I tisthe
t
t
.
4
i
L
1
t
I
portal for new life to enter on this level of existence .
The vice of the 14th Path is "Extinction" which is when life
is either taken or prevented from being born . Procreation of the
species is one of the prime virtuesof mankind,
strongest next to self preservation .

I t is when the state


motherhood isbeing
preventedorabused,thatonecan call
extinction a vice. I t must be on deliberate or selfish grounds .
Kali is associated to this Path and is to an extent another
form of Durga . Like Durga and Kalika (another of her names) she
is also called "DivineMother" . As a diety she is often shown
dancing on Shiva with four arms holdinga sword and recently
severed head with theempty hands positioning themselves to form
meditational mudras, showinga lack of fear . Unlike her other
form Kali is black in colour which relates to thevoidfromwhich
allthingsenterandreturn . Aroundherwaistandneckare
several : headswhich-showthatlifeisinmanyincarnations . She
isconsideredtheSaktithatawakenedherconsortShivafromhis
meditations . Devotiontothisdietyliftstheveilofrealityos
thatthetruewillcanbeknown . LikeallmothersKaliisboth
creativeanddestructiveandsheisforemostthemotherprotector .
Thepreciousstoneofthe14thPathistheNewZealandGreen
Stone(Jade)whichiscommontotheMaoripeople(thePolynesian
inhabitantsofthatcountry) .

Thisstonewasusedasboth
weaponandanornamentandisusuallyhandeddownto
possiblyis
familieson
thedeathofthewearer .

I thasmuchMana(power)anddepending
greenstone carvings
on how it is cut was reserved for theheads of tribes and their
families .

I t was used as aburiel stone as


living link to its deceased owner .
well and was said to
Many

these old
had a Tapu (curse) placed on them that is
considered veryeffectivebybothMaoriandEuropeanalike .
ThemainanimalssacredtothisPatharethedoveandswan .
generaltermsthedoveisthevehicleofpurityofthehigher
naturedescendingintothelowerforms(matter) . I n . John1 . 33it
says-'Uponwhomthoushalt see thespiritdescendingas a dove,
andabidingonhim,
greatmotherimagesof variousreligions .
thisishe,whichbaptisethwiththeHoly
Christ' .

Asasymbolthedoveissynonymouswithmost4the
I nancientEgyptthe
doveshowedpurity(sittingontheTreeofLife)wherethe
Greek/RomanbeliefsshowsloveandinancientI sraelthedoves
wereusedastempleofferings .
TheWhiteSwaninsymbologywasusuallyassociatedtoVenus,
anditissuggestedthatitsgracefullinesareanalogoustothat
anakedwoman.

Theobjectbeingthegratificationofones
deepestdesires(asinthe"SwanSong"beingadeathwish) . From
ChristianstandpointtheSwanisoftenlinkedwithChrist's
mother,theVirginMary . I tisthebirdwhobecamethemotherof
thecosmiceggoftheuniversewhichBrahmasprangfrom .
CloverisoneofthePlantsassociatedtothisPathandfor
themostpartwasusedasacharminandagainstwitchcraft .
I relandforexampleitsprotectiveabilitiesweresowidelyknown
1
t
44
i
I
I
I
that it was adopted as the Shamrock (4 leaf clover) with the
legend
shore .
St Patrick banishing evil influences from I reland's
I n I reland the four leaf clover was a victorioussymbol
of Catholicism witheachleafdenotingtheCrossof Christ . I
preChristiantimestheShamrockleavesweresaidtorepresent
(1)fame,(2)wealth,(3)lover, (4)health . Thesignificanceof
thenumberofleavesonthecloverisveryimportantininterpre-
tingitsmeaning .
TheAngelofVenusiscal1edAnaelandwas-oneoftheseven
angelsofcreation . - Hepresidesovermotherhoodandreproduction
ingeneralandisbrothertotheangelTobit(refer : Bookof
Tobit) .

HisnameisderivedfromtherootANwhichrelatesto
"morality"
. TheintelligenceofVenusiscalledHagielandcomes
fromtherootHGmeaningintellectualactivity,
thatexciteswithintheself . I tsArabiccounterpart
expatriation .

ThespiritofVenusiscalledKedemelwhich
fromtherootQDwhichmeans"atypeofpivotaction
pointonwhichthingsturn" .
ThelegendaryorderofbeingsassociatedtothisPathare
theSuccubiwhichisthetermforafemalespiritwhotakeson
temporarybodyforminordertohave sex with humanmale .
Thesebeingsdonothavetomanifestvisiblybutonlytothe
sensation of touch,inotherwordstheycanbefelt .

Thisway
theyconserveenergyforcopulationwhichtheydraw
partnersandtakebackwiththemintotheastral .

I nmodern
timestherehavebeena
or any movement
shows
or focus
fromtheir
number
ofcasesofSuccubireportedand
most tend to be in the ghost category .

They are the former


etheric bodies of deceased souls who stay alive through the sex
act . These can best be described as a form of ghosts which are
rare .
The Olympic
PlanetarySpiritofVenusisHagithwhogoverns
venerealaspects .
Hebrew
has4000legionsofspiritsunderhim .
Whenheappearsheisconsideredfairinstatuebutcanchangeto
variety of shapes if not challenged correctly .

Hagith in
canbespelled a number of ways in(dependingonHebrew
dialect)suchasChGYThHGYTh,orevenAaGyTh . -Thelattershows
therootAaGwhichmeans"ardour"or"warmth"(of
nature) . TherootHGalsohasasimilarmeaning .
ASSOCI ATI ONS
YETZI RATI CTEXT :
HEBREWLETTER :
TAROT :
EGYPTI ANDI ETY:
GREEKDI ETY :
ROMANDI ETY:
PLANET :
MAGI CALWEAPON :
VI RTUE:
VI CE :
MAGI CALPOWER:
I LLUMI NATI NGI NTELLI GENCE
DALETH
EMPRESS
HATHOR
APHRODI TE
VENUS
VENUS
GI RDLEOFVENUS
MOTHERHOOD
EXTI NCTI ON
MANI PULATI ON
sexual
1
t
t
41
I
r
I
I
I
I
VEGETABLEDRUG:
I NDI ANASSOCI ATI ON :
GEMSTONE :
PLANT :
AROMATI C :
ORDEROFBEI NGS :
ANGEL :
ANI MAL :
OLYMPI CPLANETARYSPI RI T :
APHRODI SI AC
KALI
GREENSTONE
CLOVER
PATCHOULI
SUCCUBI
ANAEL
DOVE/SWAN
HAGI TH
t
4
t
t
r
I
r
r
I
P
I
LESSON 24
THEFI FTEENTHPATH
'The15thPathistheConstitutingI ntelligence,socalled
becauseitconstitutesthesubstanceofcr eationinpur edar k-
ness,andmenhavespokenofthecontemplations;itisthat
dar knessofinScr iptur e,Jobxxxviii .9 ."andthethickdar kness
aswaddlingbandfor it" .'
Theentir easpectoftheabovetextr elatestothecr eation
oflifeinthechaoticdar knessofspace .Thoughitdoesnotsay
itoutr ight,'itr efer stothedevelopmentoflightandheatwher e
ther ewasnone.Thedar knessor voidinthisinstancebecomesa
wombso-thatcr eationgoesthr oughagestationper iodhencethe
r efer encetoJob .Thedefinitionofthewor dconstitutein
Webster sDictionar yistocomposeor elect :setupor establish.
Thisofcour seisr ecognisedasthefir stpr incipleofdevelopment .
Hebr ewletter associatedtothisPathisHehandis
shownasHHwhichhasanumer icalvalueof10 .ByGematr iaother
meaningsar edeter mined,suchasGBHmeaning"elevated,exalted,
high",or DAHmeaningto"soar .Bothofthesephr asesdenote
heightthepoitionoftheancientwindowsintheHebr ewtemple -:
andalsothepositionaspar tofthenameYHVH .Hehasawindow
hadamainfeatur e,toletinlight,andassuchhascer tain
esoter icconsider ations .
de'Olivet says thatHeh as aletter is a symbol of univer sal
life. I t r epr esents the br eath of man, air , spir it and soul : that
which is animating and vivifying . As a gr ammatical sign, it
expr esses life and the abstr act idea of being.
Hebr aic tongue, of gr eat use as an ar ticle.
supr eme author ity fr om which all under his r ule bow t
later epochs he wasshown with a bulls head .
I t is,inthe
TheTar otcar dofthisPathistheEmper or .Her ewehave
is
ener gyper sonifiedandalsoshowsmer cyalongwithhisaggr essive
tendencies,illustr atedbythelambunder hisfeet .Tomanyhe
islifeitselfashiswor dcar r iesthepower ofbothlifeand
death .Heisthemasculinedynamicfor ceexer cisinghisr ightto
exist .Heismor ethanaking,heistheemper or -pr iestinchar ge
ofhissubjects'spir itualandphysicalwellbeing .
istheconquer or whoshowsvictor yandthenegativeaspects
r ulethatgoalongwithit .
The Egyptian godfor mofthisPathisMenThu,who is often
depictedwear ingahead-dr esswithafalcon'shead,solar disk
andaur aeus-ser pentwithtwolar geplumes .Hewasawar r ior god
ofwar (oftenshownwithaswor d)andanaspectofthesungod
AmenRaandwasalsosometimescalledMenthuRandMont .in
TheEmper or
Legendhasitthat
hewasoncekingofMer monthis(Upper Egypt) .Ratr iedtoadopt
Mont,hisfor mer r ival,butthegodpr efer r edhispr esentdwel-
lingandtooktheattitudethatitwasbetter tor eigninhell
thanser veinheaven .
1
i
1
y
t
t
i
I
I
almost equalled Jupiter in power and statur e. I t is saidthat she

aided the voyage of the Ar gonauts in navigation . As a war goddess


I
I
I
P
f
r
1
I
TheGr eek associationher eisAtheneandtheRomanver sion
isMiner va .MythologytellsthatMiner vaspr angfullyar medfr om
the head of Jupiter . She was not only a goddess of war butwisdom
andallthear tsaswell .Her pr owesswasfor midabletosaythe
leastandshewasknowntohur lthunder bolts,bestowlonglife
andgivepr ophecy.Shewasanextr emelypower fulgoddessand
shewasoftenshownwithwar r ior helmetandplumeandshieldwith
the sever ed head of Medusapaintedonitandar medwithaspear .
Theastr ologicalsignlinkedtothisPathisAr iesandis
depictedbyar am'shor nswhichshowsit'

aggr essivehead-
per sonisadynamicindividualfullofdr ive
extr emelyimpulsivealongwith
buttingnatur etemper edbyit'ssingle-mindedness . AAr ies
andtheur getoget
aheadnomatter whatlevelofwor ktheyar ei

Theyar ecr eative


peoplewhoar econstantlystr ivingfor somethingnewandhave
str ongauthor itar ianappr oachtolifeingener aland ar e
it .TheAr iansar etheindividuals
whohavetheneedtowinatever ythingtheytur ntheir handto .
Thekeywor dstotheir successar ewillpower anddecisiveaction .
Theconstellation of Ar iesisther amor lambasithas
beensometimesdepictedandiscalledTLH(Telah)inHebr ewwhile
itsAr abiccounter par tisAlHamalmeaningthegentlesheep .I ts
ancientAkkadiannamewasBar aziggar whichr oughlytr anslated
meansthesacr ifice of ther ighteousness(fr omBar meaning
sacr ifice and ziggar meaningr ighteous) . The whole ancient
concept of this constellation was one of sacr ifice as its main
star was called El Natik meaning slain (or wounded) as wasalso
the next br ightest star in this system which was called Al
Sher atan .
the bur in.
magical weaponsofthisPathar ether am'shor nsand
Thehor n isoftenanOldTestamentsymbolofvictor y
(whenr aised),anddefeat(whenbr oken)andlinksver yheavilyto
theoldfer tilitycultswhichr elatedthe'hor nofplenty'tonew
gr owthandto sexuality. Jungconsider edthehor nadualsymbol
becauseitcanbothpenetr ateandbear eceptacle(itshollow-
ness)whichr elatestothecyclicconceptofnatur e .Thephallic
r epr esentationsofthehor nr elatealsotopower andener gyfor
itis a signofstr engthandpower .Thebur in,likethehor n,is
oftenusedlikeaknifefor magicalwor kwith
pr ojecting point .
Themagicalvir tueofthisPathismar tyr domandr elatesto
theindividualgivinghisor her lifeinthepur suitofanendea-
your sothatother swillbenefitfr omit .
vir tuesmar tyr domisthemostr ever ed .-I nmoder ntimesitis
oftenshownasthesoldier whogiveshislifeinwar for his
countr y.

theher metictr aditionthemar t,, .- istheindividual


whobr ingsthr oughthewor kfor thebenefitofother s
extentattainsimmor tality(intheeyesofthebeholder )by
becominganexamplefor other stoemulateinper for mingthegr eat
wor k.
itstipasthe
Ofallthesaintly
andtoan
J
t
4
i
t
t
I
I
I
4
M
The vice of this Path is self pity,her e the individual
gives up andhas no dr ive or ambition to complete life let alone
under stand its spir itual significance. Gener ally this occur s when
the dr iving for ce of the individual has expended itself or in
plain ter ms when one is simply wor n out . Fr om an esoter ic view-
point the psychehasr ejectedthetasksallottedtoitfr omthe
higher selfandtr iesdesper atelynottocomplywiththesedir ec-
tionswhicheventuallybegintocloseinonitfr omallsides,
and in an act of whatsomewouldcallselfpr eser vationsimply
shutsitselfdowntoitslowest ebb.
ThemagicalattainmentofthisPathisthepower to
consecr ate.Thispower isonethatisdevelopedthr oughboth
r itualpr acticeandknowledge,andinvolvescallingandcontr ol-
lingnamesofpower thatonehasbeenassociatedwithbydir ect-
ingthemtoper for madesir edtaskfor you .I tinvolvesbinding
thesepower stoconsecr ateanobjectsuchasatalismanor eleme-
ntalweapon,or evenusetheir power toclear anar eaofnegative
for cessothatonecanwor kinanuncontaminatedar ea(ofastr al
influencesthatis) .I talsoinvolvespr ojectingonesaur ainto
theobjectbeingconsecr atedaswellsothatavitallinkis
establishedbetweenoneandtheobjectinquestion .Sometimesin
simpleconsecr ationitdoesnotinvolvecer tainspir itualhier ar -
chiesbutmer elyextendingonesown
gener allyspeakingthese
aur atoclear ar eas,
typesofconsecr ationar ealmostalways
under thebanner ofsomehier ar chyor another eveniftheyar e
notinvokeddur ingacer emony .
Thebloodstone is one of the zodiac gems associated to this
Path and is both gr een and r ed in colour with the r ed aspects
consider ed to be like dr ops of blood . I ts old name was Heliotr ope
and wasr elated to the old Egyptian city of Heliopis wher e it
fir st gained somefamedur ingtheEgyptiandynastiesasastone
ofimpor tantr eligioussignificance .Legendassociatedtothis
stone says thatithasthepower to makethewear er invisibleand
itwasoftenconsecr atedbypr ieststo givear mies theabilityof
stealthandtattacktheir enemiesbefor ebeingdetected .
Bloodstonewasoftenwor nintobattleasanamuletagainstbeing
wounded . I t was used as a good luck piece by all those under going
sur ger yandchildbir thsothatnoexcessivebloodwouldbelost
Oneoftheplantsassociatedher eistheGer aniumwhichhas
beenusedinbir thcontr olbyvar iouscivilisations .Asabody
wash, solutionoftheleavesawakentheaur aclosesttothe
skinandper for msmuchthesamefunctionswhenappliedexter nally
asdoesRosemar y.I tisatypeofaur icr evitaliser whichgives
onear enewedvigor andfr eshness .PotionsofGer aniumshavebeen
usedfor manyother
loveofanother ,
ar dentdesir efor you.
dur ingancientcelticfer tilityr ites .
usesaswell,suchasaninfusiontogainthe
which is supposed to fill the individual with
Other usesfor itincludedtowear it
Dr agonsBloodisaper fumeassociatedher ewhichhasaver y
1
I
I
bythepatient.Whenthisstoneappear edindr eamsitwasusually
anunfor tunateomenwhichshowedsor r owor lossduetoanaccident
t
i
I
I
I
I
I
I
I D
unpleasant ar oma and gives off a thick pall of r ed smoke
used as an incense. I t was used in ancient

timesbefor e
battle wher e soldier s inhaled its ar oma, for
when
it was said to aid
them in their fighting abilitybyfillingtheir nostr ilswiththe
bloodor scent oftheenemy.I nwor ksofevocationitwasusedto
summonspir itswhomyouwishedtoper for m amar tial taskfor you.
Alsodur ingsacr ifices(for victor yofabattle)itwasusedt
engulfthesacr ificialanimalwithitsar omabefor edeathsothat
the animal wouldcar r ythescentwithinintothenextwor ldso
thatther ewouldbenomistakein whatthesacr ificewasoffer ed
for .
Thelegendar yor der ofbeingsassociatedtothisPath ar e the
Eumenidieswhower econsider edtheminister softhevengeance
thegods .Theywer esaidtohavebeenbor nfr omtheblood
CoeluswhenwoundedbyhissonSatur n .
ofthesebeings :Tisaphone, Megar a, AlectoandNemesisandwer e
said give r epeatedtor mentsto those whoear nedthegods
disfavour .Theywer esometimesknownunder other namessuchas
Fur iae,Er yniesandDir aeandtheweaponsthey used wer e
conscienceandflagellation.I nappear ancetheywer ever ymuch
liketheGor gonstolookatandhadseethingser pentsinsteadof
hair andalwayswor eblackbloodiedgar ments .
of
Ther ewer esaidto be four
TheangelofthisPathis Aiel whosenameisder ivedfr omthe
Hebr ewr ootAI meaning"manifestation"or "desir e" . I tshowsthe
r awaspectofbothpassionanddesir ewithintheself)with'no
objector pointofdir ectionfor ittogoto .I tisstr ongly
r elated to theconceptofablindfor ce.Ther ootAI Lr elatesto
for ceanddesir eunited .Theanimalsassociatedtothisr ootar e
ther amanddeer .AI Lequatesto41and
thesamevaluesuchasYAL(to willful),LVH(bindor
associate),GAUAL(DivineMajesty)andGChL(tobur n),allwhich
ar evar ying degr eesofthenatur eofAiel .
TheanimalsofthisPathar ether amandowl .Thefor mer has
beenalr eadydiscussedinpr eviouspar agr aphsandwewillconcer n
our selvesonlywiththelatter .Theowl,becauseitisanight
bir d,r elatestothenight,todeathandalsotowisdom .I n
mythologytheowlwassacr edto Miner va whichr elatedto
wisdomoffor esight .
r elatestoother wor dsof
Extr actsofBetalNutisthevegetabledr ugofthisPathand
itisfoundmostlyintheSouthPacific .I tissimplychewedand
thenatur aljuiceswhichcontainar ecoline(avolatileoil)ar e
r eleasedwhenthesalivaactsasacatalystwiththecalcium
oxide(thelime)inthenut .
Theminer aldr ugofthisPathisPotassiumPhosphatewhich
iscommonlycalledKali .Phos .Thisminer alcellsaltwor ksmainly
onthener voussystemandtr iestocalmitdownfr omahighly
nEr - vousstatesuchasemotionalstr ain,melancholia .ndhyster ia.
I tismainlyusedbythosewhoar eover emotionalor panic
str iken .Kali .Phos.isinfactaner venutr ientandhelpsthose
whosener vefluidshavebeendepletedthr ough
whichbr inganstatesofexhaustion .
the
over stimulation
I
I
I
I
lb
YETZI RATI C TEXT :
HEBREW LETTER:
TAROT :
EGYPTI AN DI ETY :
GREEK DI ETY :
ROMAN DI ETY :
SI GN :
MAGI CAL WEAPON:
VI RTUE:
VI CE :
MAGI CAL ATTAI NMENT :
MI NERAL DRUG:
VEGETABLE DRUG:
GEMSTONE :
PLANT :
AROMATI C:
ORDEROF BEI NGS :
ANGEL:
ANI MAL :
ASSOCI ATI ONS
CONSTI TUTI NG I NTELLI GENCE
HEH
EMPEROR
MEN-THU
ATHENE
MI NERVA
ARI ES
RAMS HORNS
MARTYRDOM
SELF PI TY
CONSECRAT1OI Y
POTASSI UM PHOSPHATE
BETAL NUT EXTRACT
BLOODSTONE
GERANI UM
DRAGONS BLOOD
EUMENI DI ES
AI EL
RAM/OWL
~*m--=-r

--r --r
I
I
P
I
LESSON25
THESI XTEENTHPATH
"TheSixteenthPathistheTr iumphalor Eter nal
I ntelligence,socalledbecauseitisthepleasur eoftheGlor y,
beyondwhichisnoother Glor ylikeuntoit,anditiscalled
alsothePar adisepr epar edfor theRighteous ."
The16thPathiscalled'Tr iumphalor Eter nalI ntelligence'
becauseitshowsthewayandmanner tofollowsothatonecan
enter par adiseandisplacedbetweentheSephir othofChokmahand
Chesed.ThecombinationofbothWisdomandMer cywhichinfluence
thisPathishar moniousbecausetheyar eonthepillar ofMer cy
.
TheobjectlessononthisPathisthewayoflifewewishto
choosewhichhintsatr eligiousover toneswiththeendr esult
beingspir itualhappiness .
TheHebr ewletter associatedtothisPathisVauwhichmeans
hookor nailandhasanumer icalvalueof6
.Other r ootwor dsof
thesamenumer icalvaluear eBDmeaningsingled,alone,GGmean-
ingtoexpandor dr awoutwhichclear lyshowsar elationshiptoa
nailor pin
.Thenumer icalvalueofVauasawor dis12andfr om
thisother wor dssuchasVVmeaningtoconnector jointogether
andChDmeaningtopenetr atewithshar pnessalsoshowvar ying
linkstoVau.
I
VauisaHebr ewchar acter thathasthr eedistinctmeanings
L25/pgi
(accor ding to de'Olivet), two ar e vowe and a thir d is a
consonant. The fir str epr esentstheeyeofmanandisasymbol
light.Thefollowingisanear andisasymbolofsound(air
andwind)andthelast(asaconsonant)isanemblemofwater
showingtasteanddesir e.Asagr ammaticalchar acter itisthe
knotwhichunifiesor thepointbetweenthevoidandmanifesta-
tion. esoter icter msVauisthetr ansmutingpr ocess which
changesonethingintoanother . Vau hasavar ietyofesoter ic
meaningsassociatedtoitandwassaidtobeoneofthemain
idiomspr eser vedbyMoseswholear ntitwhenhewasunder the
tutelageof the Egyptianpr iests.Vauisalsothesonin
Tetr agr ammaton .
Tar otassociationtothisPathistheHier ophantwhoas
themasculinefor ceisacounter par toftheHighPr iestess .His
officeisfir mlyentr enched(shownbythebullsheads on
L25/pg2
sideofthethr one)andheisthespir itualpontiffandthe
dir ectlinkbetweenmanandGodandassuchisHisr epr esentative
onear th.Thewar r antwhichtheHier ophantholdsshowsthat
holdsthekeytothemyster iesbeyondtheveilwhilehiscr ook
showsthather epr esentstheshepher doftheflockandisr eady
tohelpthoseintr ouble .Histr iplecr ownshowsthather epr e-
sentsthemyster yoftheblessedtr inityandisabletor ulewith
author itybecauseofit .
TheEgyptiangodfor mofthisPath
isApiswhowasalso
Asar -HapiandSer apis(theApis-Hapitr ansmutationwasdoneby
theGr eekspossiblybecausedistinctknowledge

thesetwo
either
called
I j
4
1
1
1
r
I
I
I
P
I
dietieswasunclear ) .Apiswasoftendepictedwiththeheadofa
bullwithsolar diskandplumesandholdingthecr ook,flailand
sceptr e.Apisofcour sewasmadeagodoftheunder wor ldandwas
aphysicalOr isis,hisouter shell,buthewasalsoanemanation
ofPtah.LegendhasitthatApisspr angfr omavir ginheifer
impr egnatedbyPtahthr oughcelestialfir e .I twasinmanyr es-
pectsthefor er unner ofthebiblicalgospelsofthevir ginMar y
andher impr egnationbyGodtobeFather sohisSonJesuscould
bebor nwhowasinfactpar tofhimself .
TheGr eekgodfor massociatedtothisPathisHer a(fr omthe
Gr eekwor d'har io'meaningchosenone)wifeandsister ofZeus
anddaughter ofCr onusandRhea .ThenameHer aistakenfr omthe
Gr eekwor dhar io.Shewaswellknownasthejealousstepmother
againstHer culeswhoinstigatedthe12labour sandhopedthat
Her culeswouldfail .Onhisr etur nhometoThebessheinflicted
himwithafitofmadnesssothathekilledhischildr en .I nmany
waysHer awasthestylisedwifeandgavebir thtofour childr en
(Hephaestus,Ar es,HebeandI lithyia)andwasvir tueper sonified
andfaithfultoZeusuntiltheend .Her jealousycouldalsobe
consider edassimplybeingover lyzealousinthepr otectionof
her mar r iageinher continualper secutionofthosewhower e
lover sofher husband(andhisillicitchildr en) .TheRoman
counter par tofHer awasJuno .I nmany wayssheistheidealhuman
ar chetypefor theoldconceptofmother chur chandhenceher
r elationshiptothisPath .
Theastr ologicalsignassociatedtothisPathisTaur usthe
L25
/pg3
bull . A per son with thissunsignisusually patientand
per sistentindividualwhoisstr ongandunwavinginthoughtsand
ideas,opinionsandmodesofexpr ession .Theycanbestubbor n
individualsontheonehandandbever yhastyinjumpingto
conclusionsontheother .Theyar ealsomater ialisticandar e
consider ed'r ocklike'intheir devotiontodutyandfamilyand
ar epeoplewhocanalwaysber eliedontohelp .Conser vativeisa
keywor dtodescr ibetheTaur ean,whoisbor nunder themost
fixedoftheastr ologicalsigns .
TheHebr ewnamefor thisconstellationisShur (ShUR)which
meansbothcomingandgoing .I twaspossiblyder ivedfr omthe
ChaldeeTor (TUR) .TheAr abicnameisAlThaur andtheGr eek
Taur os.Thelar gestofthestar sinthisconstellationisAl
Debar en(fr omtheChaldee)meaninggover nor or leader .Other
star sinthisconstellationar eElNath(anAr abicwor dmeaning
wounded),ThePleiades(congr egationofther uler )star cluster
whichtr anslatestokimah(CUMH)inHebr ewmeaningaccumulation.
Alsother eisTheHyadescluster whichmeanscongr egated.Other
star sinthisconstellationar ePalilicium,Wasat,AlThur aiya,
Ver giliaeandVer tex .
ThemagicalweaponofthisPathisthelabour pr epar a-
tion .Thekeywor dinthemagicalattainmentofthisassociation
islabour ,for withoutitther ecanbenowor kor str uctur eto
ascend.Theadeptmustpr epar ehimselfthr oughstudiouseffor t
andwillpower tomaster thestr uctur eheisin,sothatatthe
focalpointofthemer gingofmindandbodyheisr eadytobecome
L25/pg4
J
1
I
1
6
I
I
I
I
I
P
I
the magus, an adeptofbothpower andknowledge .For allthose
whostudyanymagicalsystempr epar ationisthemostcr ucialand
demandingofallthestepsofmagic .I fitisnotdonecor r ectly
disaster canonlyr esult.Pr epar ationalsor equir esr elentless
study .andstr engthofpur pose(allattr ibutesofTaur us)oftenin
thefaceofr idiculeandadver sity .
Themagicalvir tue

thisPathispr oductivity.The
pr eviousPathdealsinr awener gywhileher eitisgivenshape
andstr uctur esothatithasanoutletfor theend
L2/pg5
pr oductto
emanatefr om.Fer tilityisalsoawor dofsor tsthatcanbe
appliedher e(thoughinasomewhatlimitedfashion)for itisa
gr owthper iodwhichisslowbutsur e .Thisisthetimeofbuild-
ingandfor tifyingonesstr engthsandaspir ationssothattheend
r esultcanbeassur ed .I tisthetimeofbuildingsecur ity,for
ifthemagicalfoundationisunstablethegr owthoftheper sona-
litywillbelopsidedandtoavoidthisallpossiblear easmust
belookedatasfutur egr owthstr uctur es.
TheviceappliedtothisPathiswhenoneismater ialistic
andwor ksfor onesowncomfor tswithouttheunder standingofthe
higher aspir ationsofthesoulandwhatdr ivesit
.Thewor kof
buildingandfor tifyingstillgoesonbutthemainpointof
differ encebetwe :nthevir tueandtheviceisther easonwhyone
wor ksandbuilds.Thisiswhenanindividualsolelyr ejectsany
other conceptother thanwhatheseesor feelsandhebecomesa
slavetohissenses .Such a per sonwillgetsocaught up inthe
par tthathewillfor getthatther eisawhole,letalonehowto
r ecognise it .
The magical attainment of this Pathis the secr et of physi-
cal str ength. This isin fact quite a difficult accomplishment as
it involves under standing of many of the fundamental pr inciples
of natur e within the body of the individualwho tr iesto develop
this attainment . I f one dr aws an analogy to the Yogis of I ndia
who do some astonishing feats of str ength and endur ance with
appar ently littlephysicaleffor tonecanthenbegintounder -
standtheunder lyingpr inciplesthisinvolves .Todothisonehas
tofir stmaster hisownbodyandthenbeabletocommandittodo
extr aor dinayfeats.Thisisnotimpossiblebutitdoestakemany
year stodevelopthecompetencytodothiswhichcan
appr oachedthr oughmeditationandselfdevelopmentexer cises .
Theminer aldr ugher eisNatr umSulphur etum(Nat .Sulph.)
whichwor ksateliminatingwastewater fr omthebody .Deficiency
inthiscellsaltmakesonebilliousandcanpr oducefever s .I t
r egulatesthewater flowwhichweobtainthr oughtheatmospher e.
Thiscellsaltwor ksonthedigestivesystemhelpingtohar monise
anyover loads .
TheplantofthisPathisMallow(MalvaRotundifolia)and
whenusedfor magicalpur posesr elatesbothasaloveandpr otec-
tion influence.Gener ally car r ied or placed in the home it will
br ingpeaceandhar monytopar tner s .I tisalsosaidtobedieal
inr itesofexor cism.Theflower softhisplantar epur ple/pink
andar etr umpetshaped .Asamedicineatinctur eofthisplant
L2/pgb
onlybe
a
1
1
1
6
I
I
I
I
I
I
r
1
L2 /pg7
br ingsr elieftoinflammationsandbr onchialupsets .
OneofthegemstonesofthisPath
is Jet(afor moflignite)
whichwasagemstonewhichhadr emar kablepower attr ibutedtoit .
Becausethiswasafavour itegemofthegodsmanyassociatedthe
contr olofthenatur alfor cesofnatur etoit,somethingwhich
onlygodscoulddo
.I twasalsousedasanamuletfor tr avels
over water
.I twassaidthatanyonewhowor ejetwouldhaveitas
par tofthebodyfor itwasbelievedtogainitspower fr om
livingor ganisimsandassuchattacheditselftothem,pr ovided
itwaswor nagainsttheskin .Alsoitwasoftengiventoladies
whomonewishtoplaceunder their contr olasitwasbelievedit
hadthispower
.Oftenonestonewassepar atedintotwopar tswith
thecontr oller havingtheor iginalpar tandtheper sonhewished
tcontr olhavingtheother
.I ngener alitwasgemthat
pr otectedthewear er againstallevilspellsandenchantments .
TheanimalassociatedtothisPathistheCher ubofear th .
Thebiblicaldescr iptionsoftheCher ubofear thisabeingwith
4facesand4wingsthoughinr ecenttimesmostusea
explanationofeachCher ubhavingonlyoneface
Gr eater KeyofSolomon"Whowasmadetheguar dianofthe
simplified
(dependingon
whichelementitr epr esented)andonesetofwings .Theear th
Cher ubisdepictedashavingabullshead .Theywer ethefigur es
placedatthecor ner ofthetaber naclewher ethetabletsofMoses
wer ekept .TheCher ubsar er efer r edtoinboththeoldandnew
testaments(Ezii,iandApociv,6-7) .Theyar ementionedinthe
Ter r es-
tr ialPar adisewiththeSwor dofFlame" .Their functionsar e
still not clear cutthoughmostscholar shavealignedthemwith
for cesr epr esentativeoftheelements
.
AnincensetoassociatetothisPathisCinquefoilwhich
str engthensthesensesbynotonlyincr easingthevibr ational
pitchoftheaur a(so
L25/pg8
thatmor eper ceptionoccur s)butalso
r einfor cestheaur awithadditionalstr engthdir ectlyfr omits
ownvibr ator ylevel
.I nevocationwor kitisagoodbasear omato
wor kwithtogivesubstancetotheastr albodyofthespir itin
thetr iangleandassuchactsasaholdingor binding
.factor on
it .ThoughCinquefoilcanbeusedonitsownitisgener ally
mixedwithar omaticstogiveitafiner edge .Thisappliesto
wor kingsnotonlyofthisPath
.Thebestwaytodescr ibe
Ciniquefoilisasatypeofuniver salbasear omaticasfar as
magicalwor k-goes .
Theangel of thisPathisAr aziel(ARZYAL=249)meaningmy
moonisgod,andwasoneoftheangelsmentionedinthebook of
Enochwhowassentfr omheavenbecausehematedwith,mor tal
women .Ther ootARZr elatestotheear thor somethingper manent
likefoundations .Thisofcour seshowsthatAr azielwasanangel
whogr ewmor eandmor eintomatter untilitappear shemayhave
beentr appedinithence,theter mfallenangel .Thewholeconept
ofthefallenangelsifviewedinthislightshedsslightly
differ entmeaningonthesubjectthan
texts.Beingtr appedinmor talfor mmeantthatAr azielandthe
other fallenangelssimplycouldnottakebacktheir for mer state
ofpr e-existencewhichwasanonmanifested
thestandar dbiblical
one.

Their only
J
4%
F
I
method

salvation wastor ewor ktheir waybackthr oughthe


evolutionar ypr ocessofmankind .
I
I
Thelegendar yor der ofbeingsassociatedtothisPathar e
theGor gonsandtheMinotaur .Thefor mer wer ethr eesister sbythe
nameofMedusa,Eur yaleandSthenowhower ethedaughter sofCeto
andPhor cys .Allofthese(exceptMedusa)wer eimmor talandwer e
saidtohaveliveser pentsinsteadofhair withscalescover ing
their bodiesandwingsofgoldandhandsofbr ass .Their looks
wer esaidtotur npeopleintostonebuttheywer edefeatedby
Per suswhokilledMedusabyusinghisswor dasamir r or sohe
wouldnothavetolookatthemdir ectly.TheMinotaur or
Minotaur usasitissometimescalledwasacombinationofboth
manandbullandwassaidtohavebeenfor medfr omtheunionofa
whitebull(fr omNeptune)andPasiphae,wifeofMinos .The
Minotaur wasconfinedtoalabyr inthwher eeachyear sacr ifices
(ofyoungmenandwomen)wer eoffer edtoitfr omAthens .
L25/pg9
YETZI RATI CTEXT :
HEBREWLETTER:
TAROT :
EGYPTI ANDI ETY:
GREEKDI ETY:
ROMANDI ETY :
PLANET :
MAGI CALWEAPON :
VI RTUE :
VI CE:
MAGI CALATTAI NMENT:
MI NERALDRUG:
VEGETABLEDRUG:
GEMSTONE :
PLANT:
AROMATI C :
ORDEROF BEI NGS :
ANGEL:
ANI MAL:
QQSsQcc1A1_I QNS g.
L25/pg1 0
TRI UMPHAL/ETERNALI NTELLI GENCE
VAU
HI EROPHANT
API S-HAPI
HERA
VENUS
TAURUS
LABOUROFPREPARATI ON
PRODUCTI VI TY
MATERI ALI SM
SECRETOFPHYSI CALSTRENGTH
KALI PHOSPHORI CUM
NAT.SULPH .
JET
MALLOW
CI NQUEFOI L
GORGONS/MI NOTAUR
ARAZI EL
CHERUBOFEARTH
I
4%
i
V
I
I
I
I
r
L26/pg1
LESSON26
THESEVENTEENTHPATH
'TheSeventeenthPathistheDisposingI ntelligencewhich
pr ovidesFaithtotheRighteous,andtheyar eclothedwiththe
HolySpir itbyit,anditiscalledtheFoundationofExcellence
inthestateofhigher things.'
The17thPathconnectingBinahandTiphar ethiscalled
DisposingI ntelligenceandissaidtodisposefaithtothe
devout.Theother titlegiventotheemanationsofthisPathis
calledtheFoundationofExcellencewhichshowsthatfaithand
hopecometothosewhoear nit .Fr omanesoter icviewpointone
couldalsoconsider thattheHolySpir itisBinah(duetoits
associationtoVau-theSon,thethir dper sonofthenameYHVH)
whichthr oughthe17thPathuniteswithTiphar eth,whichalsois
analogoustoVaubutonamuchlower scalethanBinah .Since
Tiphar ethistheSephir aofther ighteous,Binahsendsitsemana-
tiondownthe17thPathbecauseitisalso
Excellence in thestateofhigher things.
TheHebr ewletter associatedtothisPathisZainwhichhasa
numer icalvalueof7.ABDmeaningtoper ishor destr oyisone
Hebr ewr ootofpar ticular inter estfor thistiesinwellwith
aswor d.Other mar tialr ootsofthesame
Zainand the conceptof
theFoundation
valuear eGDmeaningtoassaultandDNAmeaningstr ength
. Asa
wor dZain(ZI N)hasatotalvalueof67whichequateswithBinah
whir led aboutone in the air . He fur ther states that Zain
onlyr elatestoaswor dbuttoanyshar pinstr umentsuchasan
ar r ow,dar tor avelinandasagr ammaticalsignitshows
abstr actfor mofalin .
TheTar otcar dassociatedher eistheLover sandinits
Goldendawnfor matisquiteuniquefor itshowsthemyth
Per suesflyingthoughtheair andr escuingAndr omeda,who
chainedtoar oc ,fr omtheseamonster whoisabouttodevour
her .I nthiscar dwehavePer suesholdingtheswor dandinfact
becomesitsoutwar dtoolandr epr esentsair .

Andr omedais
chainedtother oc whichr isesfr omtheseaandsher epr esents
water .ThechainsshowthatAndr omedaistr appedinthestoneand
Per sueswillr escueher fr omitbypenetr ation(r emember the
pr eviousassociationtopowder whichistheshatter edstone)with
theseamonster actingasthecatalyst.For ifhewer enotgoing
todevour Andr omedathenshewouldnotbetr appedinthefir st
placeandhencethe
andwater .
L26/pg2
which means under standing . Zain can also be spelled as ZYN(F)
which ma es its numer ical valueof717whichr elatestoTChN(F)
andmeansgr indor r educetopowder andYZN(F)meaningpr epar a-
tions.Thiscanalsor elatetothingsbeingr educedtodustasa
r esultofamar tialconflict .
I tisconsider edbyde'OlivetthatZainwhenusedasaconso-
nantr elatestoahissingsound,whichcer tainobjectsma ewhen
not
an
meetingwithPer suesmaynever havetaken
place.Thewholeconceptisoneofunitingaspectsofbothfir e
1
16
I
I
Lib/pg
The Egyptiandietiesher ear eanythatfor matwinfunction
andnotnecessar ilythatoflover s .For exampleta eHor usand
Set,theear lyEgyptiandynastieshadSetasr uler ofthenight
andHor us(theelder )asr uler oftheday .Bothofthesegods
heldthecelestialladder whichthedeadclimbedtowhichhadto
bedoneinhar mony.I sisandNephthysar eanother exampleshowing
howthetwosister swor edtogether .I siswasagr icultur egoddess
ofgr owthandher sister loo edafter thecr opsinthetwilight
whileI sisslept .
TheGr ee associationothisPathisthelegend the
Dioscur ior thesonsofZeus.Thewer econceivedbyZueswhomade
lovetoLedainthefor mofaswan.Ledabr oughtfor thtwoeggs
asar esultoftheunion.OnecontainedCaster andClytemnstr a
andtheother PolluxandHelen.Thoughthepar entageofthefour
hasalways been in doubt, they wer e ac nowledged as childr en of
Zeusbecausetheywer ehatchedfr omaneggwhichwouldhave
har dlybeenfr omLeda'shusbandTyndar us .Manyoftheir her oic
epicsar er ecor dedinthevoyageofJason andtheAr gonauts .
EventuallyCastor was
illedandhisdeathwasavengedbyhis
br other ,andZeusper mittedCastor to
oinPollux(whowas
immor tal)asaconstellationinthes y.
ThoughthelegendofCaster andPolluxcouldapplyequally
aswellher e,thelegendofRomulusandRemusisapur elyRoman
myth that could also be associated to this Path. These infants
sur vived on the mil of a she wolf until found by Faustaulus, a
L26/pg4
shepher d . The twins wer e in fact gr andsonsofthefor mer ing
Numitor ofAlba,andwer eor der edtobethr ownintotheTiber by
their Gr eatUncleAmulusafter hehadta enthecr ownfr omhis
br other .After avengingtheir gr andfather 's deaththebr other s
builtthefor tificationsofacity,andindoingsotheyfounded
(Rome),andRemuswas illedbyhisbr other after her idiculed
hisbasicdesign.
ThesunsignassociatedtothisPathisGemini .Thosebor n
under thissignshowtheattr ibutesofthecur iousandver satile .
Theyar emor ethanli elyassociatedtothear tsinsomewaywith
loveor flair for thedr amaticincommunications.Theyar e
peoplewhoar equic ontheupta ebutalsodisli estic ingto
r outines.Theyar esensitiveindividualsbutalwaysonthemove,
never attachingthemselvestooneplaceor thingfor anylength
oftimebefor eitlosesinter estfor them .Thewholeideaofthis
signisboundupinthementalpur suitsandthisiswher e
excellbestpr ovidingtheyr emainlongenoughatthem.
they
TheconstellationofGeminiiscalledthetwinsandissaid
tohavebeenbasedonthelegendofCastor andPollux .TheCoptic
namefor thisconstellationisPi-Mahimeaningtheunited.Ther e
ar eappr oximately85star sinthisconstellationwiththebr ight-
esttwobeingApollomeaningr uler andHer culesmeaningwhocomes
tolabour ,bothofthesear eintheheadsofthetwins .

Other
star sar eAlHenahmeaninghur tor woundedandMebsuta
tr eadingunder feet.Ptolemysays'Thestar sinthefeet

f
Geminihaveaninfluencesimilar tothatofMer cur y
meaning
and
40
1
1
t
6
t
I
I
I
I
F
I
I
moder atelytothatofVenus .

Thebr ightstar sinthethighsar e


li eSatur n,'
. ThemagicalweaponofthisPathisthetr ipod .Oneofthe
mostfamoususesofthetr ipodwastheor acleofDelphiwhosat
onthetr ipodseatabovethesulphur fumesandbecamethevoice
ofthegods.Thetr ipodisinfactatooloftheI nner Or der and
assuchcanonlygener allybegoneintoatthislevel .Mather s
says'Andr emember inwor ingwithatr ipodtheconeofr eception
willattr actanypassingI ntelligence or For ce.Thus,withoutthe
gr eatestcar e,muchdeceptioncouldar ise,andevenagainstthe
intentionofthecommunicatingI ntelligence,deceptionmayr esult
thr oughconfusedmistr anslationsbytheOper ator or Oper ator s .
Thevir tueofthisPathisclassification,for her ethe
power fulener giesthusdevelopedalongcer tain
L26/pg5
linesar eta ena
stepfur ther andclassifiedor pigeonholed
.Thisisaver y
necessar ythingfor withouttheclassification,theener gy
attainedinpr eviousPathswouldscatter andbewasted
.Thisisa
pointwher elogicisintr oducedtodiver sifyvar yingener gy
for cessothattheyar echannelledintothecor r ectar eas .This
isapointwher eter msofr efer enceneedtobeapplied
so that
mor egr owthcanbedeveloped .
TheviceofthisPathisisolation,for itisher ethat
ener giesar edevelopedalongasinglelinewithnothoughtfor
diver sificationintoother ar eas
.I nisolationther eisnoclas-
sificationfor itisbutasingleappr oachwhichisr estr ictive
intousefular eas.I nisolation
L26/pg6
to say the least . Any differ ent ener gies found that do not fit in
with the single isolation theme ar ediscar dedandnotchannelled
onealsoignor esthedevelopments
goingoninother ar easandinmanyinstancesthisisaduplica-
tionofeffor twhichcanbeconsider edawastebutmor e
tantlyitshowsanar r owviewpoint .
ThemagicalattainmentofthisPathistobeabletobeintwo
placesatthesametimeandofpr ophecy .The eywor daddedto
thisstatementisawar eness.Tobeintwoplacesatthesametime
withoutawar enessisnobenefitatallandthisoccur sinthe
legendofthedoppleganger ,thatmyster iousdoublewhotur nsup
in other ar easandis an exactduplicateoftheselfwithallhis
or her memor ies .Thesear eofcour seinvoluntar ypr o ectionswith
nodir ectionatall .Usingtheastr albodythoughtoexper ience
thingsontheear thlyplaneisanother matter andthiswhen
contr olled,isanexper ienceofthisPathwhichisaver ypower -
fuloneatthat,for itbr ea sdownallwallsofpr ivacyand
becauseofthisagr eatdealof
thosewhocanmaster thisexer cise .
Oneofthepr eciousstonesappliedher eistheAlexandr ite
whichwasnamedafter Czar Alexandr ain1831 .Thestoneitselfis
afor mofchr ysober ylwhichisanatur algr eenbutchangestor ed
under ar tificiallighting .I tisalsofoundintheeastaswell,
especiallyinSr i-Lan a(Ceylon)wher elar gespecimenshavebeen
locatedandwher eitis nowntobealuc ystonebutnotun-
associatedwithbloodshed.Thecommonopinionofitisthatthe
impor -
discr etionshouldbeusedfor
t
14
1
1
r
I
wear er willcomeintogoodluc thoughnotwithoutpayingaheavy
pr icefor it(thr oughsuffer ing) .Other stonesalsoassociated
her ear eTour malineandI celandSpar .
TheplantofthisPathisanytype
Dictionar y says thatthedefinitionofahybr id(inr elationto
plants)istheoffspr ingoftwoor mor eplants

differ ent
species.Thewholeconceptismer elyoneofgr aftingtopr oduce
better var ietyofplant.
Wor mwoodisaper fumethatcanapplytothisPathduetoits
mentalstimulationthoughthisper fumecanapplytoother ar eas
aswell.

I tisanextr emelypower fular omaticwhenusedinits


r awstateanditisstr onglysuggestedthatthis
usedonitsownbutmixedwithother
contr olcanbe eptover i especiallydur ing magical
cer emony.I ttotallypenetr atestheaur aofthemagicianandwhen
heor sheisinvolvedinevocativewor thiscanhelpestablisha
r appor tbetweenthethemagicianandthefor ceinquestion .One
ofthepr oblemar easassociatedtothisper fumeisthatanytype
offor cecanwiththeper fumepenetr ateanaur awhichcr eates
doublevisions(whichr elatestothepar ticular wor ldfthe
unwelcomedfor cemixedinwithour pr esentexistencer esultingin
anover lapofthesenses),thatis,ifthemagicianisnot
pr epar ed.
Theminer aldr ugofthisPathisKaliMur iaticumor Kali .
L26/pg 7
hybr id.Webster s
per fumenever be
ar omaticssothatbetter
Mur .asitissometimescalled .Thiscellsaltisessential
a
to
in this existence to eep themanifestationup .Most
L26/pge
fibr in (a pr oteinessentialfor clotting of theblood)for mation .
Kali .Mur .isoftenusedinaninflammator yillnessinitssecond
stageofdevelopment.I thelpscoughsandcoldsandanyr espir a-
tor y complaints.
The legendar yor der of beingsassociatedher ear eanythat
becomevisibleinappear ancewhichofcour secutsacr ossa
var ietyofdiffer entspir itualheir achies.Theonethingtheyall
have in commonisthepower tomanifestinthiswor ldwhilestill
existinginthenext.Todothisr equir esatr emendousamountof
ener gyandthespir itinquestionmustdr awfr omlivingsour ces
manifestationsthoughar eonlyfor alimitedper iodand
ofthese
r elate
ver yheavilytoastr ologicalinfluencesandcer tainlocalcondi-
tionsthatallaidthemanifestation .
TheangelofthisPathisAmbr ielandisalsoassociatedto
the12thhour ofthenight .ThenameAmbr ielisfr omther ootAM
meaningmother ,sour ceor or igin .
r ootsli ePRDmeaningtor ender separ ateand
Ther ootBRisafor mof
potentialcr eationor inter nalmovement.Puttogether itr elates
tothemovementinthemother 'swombor thefor mationofthe
foetus.Ambr ielhasanumer ialvalueof284which r elatesto
RPDtospr ead
ar ound.Theentir easpectshows us thatAmbr ielisanangelwho
loo safter newdevelopmentsthatar edualbynatur eandhavea
lar gegr owthr ate.
Thebir dsassociatedtothisPathar ethoseofthespea
ing
1
w
1
1
r
t
v
s
I
cour se anaspect of communication which is a ey wor d of
Path. Other associations her e ar e animals of dual plumage
is a char acter istic of their feather s or s in, such as the zebr a,
tiger or penguin.
YETZI RATI C TEXT:
HEBREW LETTER:
TAROT:
EGYPTI AN DI ETY:
GREEK DI ETY:
ROMAN DI ETY:
SI GN:
MAGI CAL WEAPON:
VI RTUE:
VI CE:
MAGI CAL POWER:
MI NERAL DRUG:
VEGETABLE DRUG:
I NDI AN ASSOCI ATI ON:
GEMSTONE:
PLANT:
AROMATI C :
ORDER OF BEI NGS:
ANGEL :
ANI MAL :
L26/pg9
var iety such as par r ots, par a eets,magpies etc . Spea ing
ASSOCI ATI ONS
DI SPOSI NG I NTELLI GENCE
ZAI N
LOVERS
HORUS/SET
CASTER/POLLUX
ROMULUS/REMUS
GEMI NI
TRI POD
CLASSI FI CATI ON
I SOLATI ON
DUPLI CATI ON
KALI MURI ATI CUM
ERGOT (LSD)
ANY TWI N DI ETI ES
ALEXANDRI TE
HYBRI D
WORMWOOD
MANI FESTED SPI RI TS
AMBRI EL
SPEAKI NG VARI ETY OF BI RDS
isof
this
which
i
t
w
I
I
I
I
I
1
I
I
Path.Other associationsher ear eanimalsofdualplumage
isachar acter isticofth*ir feather sor s in,suchasthezebr a,
tiger or r .penguin.
YETZI RATI CTEXT:
HEBREWLETTER:
TAROTS
EGYPTI ANDI ETY:
GREEKDI ETY:
ROMANDI ETY:
SI GN:
MAGI CALWEAPON:
VI RTUE:
VI CE:
MAGI CALPOWER:
MI NERALDRUG:
VEGETABLEDRUG:
I NDI ANASSOCI ATI ON :
GEMSTONE :
PLANT:
AROMATI C:
ORDEROFBEI NGS:
ANGEL :
ANI MAL :
L26/pg9
var iety such as par r ots, par a eets, magpies etc. Spea ing is of
cour se an aspect of communicationwhichisa eywor d

this
_ A29Q C_ 1AT_ _ I O_ NS_
DI SPOSI NGI NTELLI GENCE
ZAI N
LOVERS
HORUS/SET
CASTER/POLLUX
ROMULUS/REMUS
GEMI NI
TRI POD
CLASSI FI CATI ON
I SOLATI ON
DUPLI CATI ON
KALI MURI ATI CUM
ERGOT(LSD)
ANYTWI NDI ETI ES
ALEXANDRI TE
HYBRI D
WORMWOOD
MANI FESTEDSPI RI TS
AMBRI EL
SPEAKI NGVARI ETYOFBI RDS
which
------------
r
L27/pg1
LESSON27
THEEI GHTEENTHPATH
'TheeighteenthPathiscalledtheI ntelligenceoftheHouse
ofI nfluence(bythegr eatnessofwhoseabundancetheinflux4
good things upon cr eated beings is incr eased), and fr om its midst
thear canaandhiddensensesar edr awnfor th,whichdwellinits
shadeandwhichclingtoitfr omtheCauseofallcauses .'
The18thPathiscalledtheI ntelligenceofthehouse
I nfluenceand oinsBinahandGebur ah . Thisshows'bythegr eat-
nessofwhoseabundancetheinfluxofgoodthingsuponcr eated
thingsisincr eased'whichr elatestotheabundanceoftheMother
in Binah who dispenses her bounty to the cr eative Sephir a
Gebur ahdir ectlybeneathit .Ther efer encetothehiddensenses
simplymeansthatBinahisabovetheabyssandassuchishidden
fr omviewbut itsemanationswor dir ectlyonGebur ahthr oughthe
18thPath.

Ther efer ence'whichclingtoitfr omtheCause


causes'r elatestothefactthatBinahisaSephir oththat
of
is
dir ectlyconnectedtoKether whichissometimescalledtheCause
ofcauses.
I
I
I
TheHebr ewletter associatedtothisPathisChethwhich
meansafenceor enclosur e.Thenumer icalvalueofthisletter
is8whichr elatestoother wor dsofthesamevaluesuchasAGD
meaningtobindtogether ,GHmeaningtor estor etoitsfor mer
stateandDAGmeaningagitated.Allofthesecanr elatetoa
boundar y of a countr yor statewhichalsogivesthought

the
pr incipleofr ebuildingandgr owth .
L27/pg
Thewor dChethhasanumer -
icalvalueof418,whenr educedtothedoubledigitof13r elates
towor dssuchasGYmeaninganationor landr ising,YABto
desir eandAYHmeaninganenemy
.Alloftheseshowthemar tial
aspectsofbor der patr olandexpansionofonesboundar ies
oneisliabletocomeacr oss .
de'Olivetwr otethatChethcanbeconsider edeither asa
vowelor aconsonant
.Asavocalsounditr epr esentselementar y
existenceandisasymbolofthevitalaspir ation.Asaconsonant
itshowsmanathistoilandemphasisestheeffor tandlabour in
wor .Asagr ammaticalsignitcomesbetweenHehandKaphwhich
r elatetoabalanceofthingsattachedtolabour andeffor t .The
wholeconceptshowsthatChethissomethingthatmustbewor ed
andfoughtfor sothatabalancecanbeobtained,whichisnot
unli ethetheor yofdemocr acy.
TheTar otassociationofthisPathistheChar iot .This
depictsawingedwar r ior r idingthr oughthes yin

char iot
dr awnbytwohor ses.Themainemphasisis on theconceptof
patr ollingfor her ethewar r ior isever vigilantandaler t .The
ar eathathepatr olsisinthes ywhichtendstoshowthathis
boundar iesar ealmostlimitlessandar eever incr easing,as
str ivesfor notonlythemater ialbutthespir itualaswellwhich
tendstoshowabalanceofsor tsinhisaimsanddir ectives .His
wingedar mour showsthatheinfactischangingandadaptingto
thear eashegoesinto.
that
1
Of
1
1
4
1
P
for mofthisgodwasamansbodywiththehead
L27/pg3
TheEgyptiangodfor massociatedtothisPathisKhepr awho
or iginatedfr omanear lyEgyptiandynasticper iod
.Thear chetypal
beetle
(scar ab)
.I nasensethisr epr esentedthephysicalshellofman
after hislifehadfinishedfor thiswasthefor mfr omwhichthe
spir itr ose.Kephr awasagodwhowasselfcr eatedandassuch
usedthebeetleemblem .

ThenameKhepr ameanshewhor ollsand


r elatestothebeetlewhor ollsitsdung
(andeggs)infr ontof
itwher eever itgoes.I twasconsider edthatasthebeetle
r olledtheeggstheyhatchedandgener atedlifefr om,itwas
analogoustothesunr ollingacr ossthes ygivingbothlife
heatsothattheseedsoftheear thcouldgr ow.
and
TheGr ee mythsassociatedher eApolloasthenavigator and
Apolloasthechar ioteer .Asthenavigator Apolloassumedthe
for mofadolphinandguidedashipofCr etanstoCr issa wher e
they : ,eventuallywor shippedhimunder thenameofDelphinian .As
Apollothechar ioteer hewouldgoever ywinter fr omDelphitothe
landofBor easinachar iotdr awnbygr iffinsor whiteswans,and
assuchwasoftenr elatedtothecomingofsummer ashischar iot
wasoftenconsider edasolar char iotfor healwaysbr oughtwar mth
withhimtoDelphi .
TheRomanmythofthisPathisdualandnotonlyassociates
toApollobuttothewar char iotofMar saswell .Theemphasis
her eisthatthechar iotwasaninstr umentofwar ,conquestand
victor y.Withoutdoubttheattr ibutionsofthechar iotar eall
solar butthechar iotalsostands
evolutionar ypr ocessoflifeitself
r iteabodeisthehomewher etheCancer ian
r eceptiveindividualswhoar ealsor eser vedand
Sar tanmeaninghewhoholdsor bindswhilethe
L27/pg4
for gr owth,developmentandthe
whichwhenr educedtoits
pr imar yconceptsshowslifeinitspr otoplasmicstateemer ging
fr omashell .Thechar iotisinfacttheshell(body)withthe
dr iver asthespir itwhoguidesit .
Theastr ologicalsignassociatedher eisCancer .Thosebor n
under thissunsigngener allyshowsomear tisticabilityandar e
mater nalandbenevolentintheir appr oachtolife .Their favou-
isthestr ongest
sur r oundedwithhisor her possessions .

Theyar esometimes
psychicanddr eamybynatur ebutontheother sideofthe coin
theycanbelazyandr estless.Bynatur etheyar egener ally
incontr olof
themselvesthoughtheyhaveaniner tmagnificencefor selfsacr i-
4iceifthepr essur ebecomestoomuchfor them.
TheconstellationofCancer (TheCr ab)wasor iginallydr awn
asabeetleinboththeEgyptianandHinduzodiacs(ar ound40 0
B.C)thoughear lier Egyptianzodiacsusedthehaw shead.I ts
moder nfor masacr abissaidtohavebeender ivedfr omthe
Gr ee swhomaintainedthatJunoplacedthissignintheheavens
ingr atitudefor bitinotheheelofHer culeswhenhefoughtthe
Hydr a.

OneoftheAr abictitlesfor thisconstellationisAl


Gr ee nameis
Kar inoswhichhasthesamemeaningandthelatinfor misCancer .
Thebr ighteststar inthisconstellationiscalledTegminemean-
ingholding .Ptolemysays'Thetwostar sintheeyesofCancer
0 1
1
1
1
1
I
I
I
I
P
I
L7/pg5
ar eofthesameinfluenceasMer cur y,andar ealsomoder ateli e
Mar s.Thoseintheclawsar eli eSatur nandMer cur y .'
ThemagicalweaponofthisPathisthefur naceofthealche-
mistwhichiscalledtheanthanor (anoldter minologyfor
Thisisofcour seanemptyshellwhichwhenheatedpto
constanttemper atur ehasthepower totr ansmuteonemetal
oven) .
into
another .Theadeptwhousesthismustbewellver sedinalchem-
icalpr inciplesandunder standtheir r eactionswitheachother .
ThePr imeaMater iaplacedintheanthanor doesnothaveto
metalbutcanalsobefr omtheor ganicwor ld.
Thevir tueofthisPathisbuilding,for her eper manent
r ootsandstr uctur esar esetupsothatwhenthesecur ityhas
beenestablishedtoitsoptimumlevelnewgr owthcandevelop .
Thewholeconceptisinfactoneofstabilisationsothatthe
emotionsandthestr uctur ecanmer getogether tofor mastr onger
union .I tisapr ocessofbuildinguponepor tionthathasto
catchuptothepar tthatismor edevelopedthanther esttoma e
astr onger whole.I fthisdoesnothappenthewea er aspectscan
dr agthedevelopedonesdownsothatnogr owthactuallyoccur s
andaper iodofr egr essiondevelops.Bybuildingupthewea er
pointsthefullpotentialisr ealisedwhichisgr owthonapr e-
viouslyunpr ecedentedscale.
TheviceofthisPathisr egr ession,whichisnotstagnation
butapointwher ethingsdeclinetosuchastatethattheymove
bac war ds.Thoughinsomeinstancesr egr essioncanbeavaluable
vibr ational
L27/pg6
tool, inthis instance it is a for m of decline . I t is the point
of hopelessnesswher eoneistoofar behindtotogoahead,which
r esultsinthethepsycher etr acingitsstepsbac toitsinfan-
tilesour ce.Thisisaper iodwher etheseindividualsshutthem-
selvesofffr omther estofthewor ldandseethingsfr omtheir
ownslantedper spective.
Themagicalattainment of thisPathisthepower ofcasting
enchantments .I nsimpleter msitisthepower tocr eatespells
(for wantofabetter wor d)over individuals .Her etheadept
cr eatesthepower ofsuggestionandthisisnotunli ehypnotism
butonalar ger scale.Themagenticaur aoftheadeptcaptivates
theaur aor aur asoftheindividualsconcer nedbysendingalight
char geintothemwhichthr owstheir owndefencemechanisminto
state

confusion.Thechar geinfactisusuallyofahigher
levelthantheir ownaur aandassuchta escontr ol
(for alimitedper iod)untiltheindividualconcer nedbuildsp
hisor her owndefencemechanismagainstit .Onahigher level
thisalsoconcer nstheadeptwhocontr ols cer tainspir itual
hier achiestodohisbiddingandinstr uctsthemtohelpor hinder
anindividualor placethisper sonunder their contr ol .
Aminer aldr ugofthisPathisCalcar eumFluor icumandisa
cellsaltchatdealsinelasticity .I thelpsbyfir mingthegums,
r iddingthes inofencr ustationsanditwor sonstr engthening
theinter nalor gans.I talsohelpscor r ectmentalinstabilities
suchasafear ofinsecur ityta entothepoint of amania.

I t
helpsr epair s intissuesthatfor mcr ac snear oints or
a
1
1
P
L 7/pg 7
or ificesandalsohelpsblur r edvision .Another impor tantattr i-
buteofthissaltisthathelpsmemor ybystr enghtheningthe
br ainfibr es.
TheHinduassociationisKr ishnadr ivingthechar iotof
Ar unatothebattleofKur u setr agivenintheBhagavad-Gita .I t
isher ethatKr ishnateachesthathopelessnessisbutanillusion
andthe illingoftheear thlyfor msoftheenemyissimply
eliminatingtheshellsoftheir existanceswithouthur tingthe
their souls.
One of the gemstones associated to this Path is amber . This
infactismor eofafossilizedr esinfr omaspeciesofancient
pineswhichwer edestr oyeddur ingtheclimaticchangesinthe
ear thstemper atur es.Amber wasusedfor talismaticpur posesfor
incr easingthevalueofwealthandto eeponesafefr omhar mand
evilinfluences.I twasheldinhighesteemfor itscur ative
power sagainstsor ethr oats,toothache,dr opsy,bloodand idney
ailments,heatstr o es,goitr eandr espir ator ypr oblems.Asa
ewelitwasgener allywor nasanec lacetouchingthes inand
wasconsider edagr eatpr eventer ofdyinginonessleep'(ifwor n
tobedatnight) .
ThelotusisoneoftheplantsthatcanapplytothisPath
andsymbolisesthefir stmanifestationoflifeandissometimes
consider edthesymbolofevolution .I nwester nmythswear e
r emindedofthelegendofthelotuseater s
whichstatesthat
I
thosewhohaveeatentheflower ofthelotuswillnever r etur nto
becomes the centr al or focal point fr om ar ound which all
evolves.
An ar omatic of this Path is Onycha (Ungala ar omatica) which
is der ived fr omaspeciesofshellfishandismentionedinExodus
(someclaimthatthisisalsoaspeciesofRoc Rose) . Whatever
itsor iginthemostimpor tantthingtoconsider isitseffect,
whichisasweetsmellthatdullsthesensesslightlyandpene-
tr atestheaur a.I tinfactcompletelyhidesthevibr ator yor
magneticpatter noftheaur afr omother ssothatonespr esenceis
difficulttodetect,especiallyindar nessthoughthis
limitedtoashor tper iodonly.Manyadeptsinthepast
Onychaasaar omatictohelpcr eateashieldsothat
for cescannotfindthem.
thatgainpower over other s
L27/pg8
their home landand shows the concept of the eter nal
wander er .
Ta ing many of themyths into account one finds that the lotus
Thelegendar yor der ofbeingsassociatedtothisPathar e
thevampir es.Bythisitdoesnotmeanthecommonvar ietyof
bloodsuc er ,butthosebeingsintheastr althatcanonlyexist
byfeedingoffhumanener gyandthiscutsacr ossnumer oushier a-
chiesofbeings.I nhumanter msther ear ealsovampir esas
bybr ea ingintotheir ether ic
andcontr ollingthembydr ainingtheir ener gysour ces,butthese
ar egener allyother humanswhogener ally pr ey onthosewho
natur alvictimsbytheir passiveness.
else
effectis
haveused
negative
wel1
aur as
ar e
TheangelofthisPathisMur ielwhichhasanumer icalvalue
OP
1
1
1
i
I
I
I
I
I
I
I
F
I
t
Reducingthistoadoubledigitfigur e
L27/pg9
287. Other wor ds o the same value ar ePRZ meaning to
disper se, be scatter edher eandther eandPZRmeaningdissipate.
wehaveDChH(17)meaning
topushout,thr ustandTChmeaningspr eadover thesur face .The
r ootMURfr omwhichMur ielista enshowsunitedmovementwhich
(goesupwar ds)andinvadesspaceor air ,whichr elatestoits
Ar abicor iginofgoingbeyondor exceeding .I tr elatestosome-
thingmovingupwar dsinspace .Thisangelisalsooneusedinthe
gr imor estoinvo eover amagiccar petsothatitwillfly .
AnyshelledanimalisassociatedtothisPath .Thetur tleis
oneexampleandisasymbolofmater ialexistenceandlifeitself
initsmostbasicfor m.Sinceitisacr eatur eofbothlandand
water italsoshowstheevolutionar ypr ocessindevelopment .The
cr abisyetanother for moflifethatcanbeappliedher eandis
asymbolofobliquemovement(andofsidesteppingissues)and
alsostr onglyr elatestowater .
YETZI RATI CTEXT:
HEBREWLETTER:
TAROT:
EGYPTI ANDI ETY:
GREEKDI ETY:
ROMANSYMBOL :
SI GN:
MAGI CALWEAPON:
VI RTUE:
VI CE:
MAGI CALPOWER:
MI NERALDRUG:
VEGETABLEDRUG:
I NDI ANASSOCI ATI ON:
GEMSTONE:
PLANT:
AROMATI C:
ORDEROFBEI NGS:
ANGEL :
ANI MAL :
ASSOCI ATI ONS
I NTELLI GENCEOFTHEHOUSEOF
I NFLUENCE
CHETH
CHARI OT
KEPHRA
APOLLO
THECHARI OT
CANCER
ANTHANOR
BUI LDI NG
REGRESSI ON
CASTI NGENCHANTMENTS
CALCAREUMFLOURI CUM
ANYSENSEDEPREVI ATI ON
KRI SHNA
AMBER
LOTUS
ONYCHA
VAMPI RES
MURI EL
ANYSHELLEDANI MAL
L27/pg10
J
1
1
i
I
I
I
F
t
LESSON28
THENINETEENTHPATH
NineteenthPathistheIntelligenceofthesecret
allactivitiesofthespiritualbeings, andissocalledbecause
oftheinfluencediffusedbyitfromthemosthighandexalted
sublimeglory.'
The19Pathiscalledthe'Intelligenceofsecretworksand
Spiritualactivities'andjoinsGeburahandChesedwhichshows
thatallactivitiesonthisplanearewhollyspiritual .There
arealsosecretworksthatarehappeningwhichcanovertakethe
spiritual,providingthatitgoesalonganddoesnotinterfere
withit.Theterm'mosthighandexaltedglory'relatestothe
horizontalPathslikethis'beingadiffusedreflectiono4Kether.
InfacttheemanationofKetheristhesecretinfluencewhich
sometimesworkswiththePathsnaturalorderdevelopment,
givingitadditionalimpetus
.
TheHebrewletterassociatedtothispathisTethwhich
meanssnake.Tethhasavalueofninewhichequateswithother
wordssuchasAChmeaningbrotherandBGDmeaninggarment.Onthe
faceofitthesewordshavenorelationtoTethbutifweusethe
wordNChShmeaningserpentalinkisthenformedwithbothwords
meaningserpent.Thishasavalueof358,asdoestheword
Messiach(Messiah)whichisthebrotherhoodofChrist.Thelegend
ofthegarmentorrobeofChriststilllivesontothisdayand
L28/pg1
L28/pg
of itsmiraculouspowers.

ThefullwordTethhasavalueof419
whichwhenreducedtoadoubledigitfigureof23relates
ChYH,partoftheKabbalisticsoulwhichshowsthestrong
tothespiritualinsightoftheword .Tethrepresentingboth
ChristandtheDevilatthesametimeisaperfectexampleofthe
ability of gematriatogiveopposingviews of thesamewholeor
differentaspects of thesamething.AssuchTethis a letter of
bothresistanceandprotection.
TheTarotassociationofthispathisthecardStrength
whichshowsagreatdealofcomplicatedsymbology.Herewehavea
.womanholdingsomeredrosesstandingnexttoalion .Ithe
earlierversions of thiscardawomanwasusuallyshownprying
openthejawsofalionwhichwassupposedtoshowtheweaker
overcomingthestronger.TheGoldenDawnformattakesthisastep
furtherbythe .addition of alchemicalsymbolismwiththesame
meaning.TheroseheldshowstheemblemofRosicrucianphilosophy
aswellasthebloodofthelioninthehandsofthosestrongof
spirit.
OneoftheEgyptianmythsofthisassociatedtothispathis
thatofBast,thecatandsometimeslionheadedgoddesswhowas
calledtheladyoftheEast.Sheisoftendepictedholdinga
sistrumandankhwithaserpentmountedonherheadandwasoften
identifiedasafemalecounterpartofbothRaandTem.Bastisin
factagoddessoffire,atitleshealsosharedwithSekhet,but
sherepresentedboththesunandheatinamilderformthanher
sistergoddess.Bastisalsolinkedtothemoonthrough
links
her
J
i
1
1
v
TheGreekassociationhereisoneofthelegendsofHeracles
(orHercules)andtheNemeanlion .Thiswasoneofthetwelve
laboursortasksofHeracleswhowenttoNeameatokillalion
whohadbeenonarampage.Afterfindingthatweaponswerenouse
againstthelionHeraclesthrewdownhisbowandfoughtwiththe
lionusinghisownstrengthandeventuallykilledit.Oneofthe
esotericconceptsbehindthismythisthatifonemustfight,
theymustfightontheirowntermsandwhateveronestartshe
mustfinish,forifHeracleslettheliongofromhisgrasphe
r
associationtofertilityandchildbirthaswashersonKhensuwho
alsohadmanyattributesofhismother.
wouldhavesurelybeenkilled .
TheRomanmythsassociatedhere is thatofVenusandher
unionwithVulcanthedeformedsonofJupiter .ThoughVulcanwas
thegodoffireVenusoftenmimickedhislamenessandcausedhim
agreatmanyproblemswithherinfidelities.Sheeventuallytamed
himthroughtheenchantmentofhergirdle .
TheastrologicalsignassociatedhereisthatofLeo .Those
bornunderthissunsignareproudandemotional
L28/pg
individuals
usuallywithagreatstrengthofcharacterandaregenerally
characterisedinthemouldasleaders
.Lookingatbothendsof
thescale,Leascanbeverysensitiveandoverbearing,bothat
thesametime.Theylikepleasantsurroundingsandcanbeeasily
swayedwithflattery
.Theyarethetypicalautocratandassuch
beingaleaderisnaturaltothemwiththeirboldness
.Onthe
L29/pg4
physicalsideofthingstheyoftenhavetroublewithbloodpres-
sureandotherarterialrelatedproblems.
TheconstellationofthisPathisLeotheLion .Throughout
thezodiacs of thevariouscivilisationstheLionisaconstella-
tionofimportanceandhasbeenrecordedsincethetime of the
EgyptiansandthePersians.Theconstellationhasover95stars
init
.ThemainstarwassometimescalledReguluswhichmeans
standingortreadingon.OtherstarsincludeDenebolameaning
thejudgeorhewhocomes,AlGibhameaningexaltationandZosma
meaningshiningforth.Ptolemysays 'Of thestars
The
in Leo, two
asMarsandJupiter ;thoseinthehipandthetailarethe
asSaturnandVenus,whilethose in thethighsarethesame
VenusandtoalesserextentMercury.'
in
the
headarelikeSaturnandpartlylikeMars.Thethreeinthe
neckarelikeSaturn,andinsomedegreelikeMercury
.The
brightstarintheheartiscalledRegulusandismuchtheSame
same
as
magicalweaponofthisPathisdrawingforthinternal
strengthtoreinforcethewill .Thisis of courseaninternal
aspect of consolidationbeforeapplicationandproducesanenor
-
mousdrainonthevitalityofthebodyasthecontrolsinthe
mainchakracentres(thetattvas)arespeededuptotakeinextra
energytoreinforcethevitalorganswhichinturnhelpstreng-
thenthewill .Thewholethingisdonethroughconsciouseffort.
ThisisnottobeconfusedwiththemagicalpowerofPath16for
hereallthepowerisdirectedtothementalprocessorswhilein
theformerthepowerisdirectedtothemuscles .
1
1%
J
qP
r
I
L 8/pg 5
The virtueofthisPathisindividualismwhichistheform
ofenergythatonelearnstohandlehere.Heretheindividualhas
theenergyanddrivetobutmustlearntohandletheseonhisor
herownterms,toanextentitisthebreakingawayfromthefold
tocreateanewenvironmentfortheself.Itisanaturalpro-
gressivestepandmustbedonewithcareforheretheindividual
beginstoestablishtheselfinapatternwhichishomogenous
withothercloselyalliedenvironments.Anotherwordthatcan
alsobeappliedtothevirtueofthisPathisparticipation,
whichallowsonetostaywithinthesocialpatternsgeneratedby
thistypeofenergyratherthanbeingapartfromthemyetstill
retainingoneindividualism.
TheviceofthisPathisdependencyandiswhenonehasthe
attributestogetahead,butrefusestousethemandsettlesfor
comfortwithouttakingrisksofanysorttofurther onesaspira-
tions.Itisasuppressionofallonesvitalinstinctsofself
development.Heretheindividualissointentonfittinginwith
thepatternoflifethatwholepointofthepatternisover-
looked.Dependencyalsoshowstheabilitytoloseoneselfinthe
schemeofthingssothattheycannotbesingledouttotake
anyformofresponsibility.
ThemagicalattainmentofthisPathisthepowertocontrol
wildbeasts.Whilereadingthismanyofuswillthink
on
ofthe
circusperformersuchastheliontamerbutthisgoeswaybeyond
teachinganimalstodotricks.Thisspecificallyrelatesto
L28/pg 6
individuals who can extend their aura so that it calms that of
animals (such as Daniel in the lions den) andassuchisconsi-
deredasamagicalattainment.Thisextendsnotonlytowild
beastsbuttobirdsandreptilesaswell,
everylivingthingexceptmanhimselfwhoisgiventhegift
reason.
mineraldrugofthisPathisMagnesiumphosphoricum
whichactsmainlyonthemotornerves .Itisacell salt that
helps relieve anyformofcramporspasmwheretheapplicationof
heat itrequired toalleviatetheinflamationandalsoisusedas
atypeofrelaxative.Magnesiumphosphoricum also helpswithany
problemsintheglandular system byhelpingtoregulateit.
The vegetable drugs of thisPathrelatetoallcarminatives
andtonics.Alistof some carminativesareasfollows:Thyme,
Parsley,Sage,Spearmint,Peppermint,Pennyroyal,Lavender,
YarrowandOregano.SometonicsareBlackberry,Mulberry , Aloe,
RedClover,Thuja,Dandelion , LemonBalmetc.
generallyjustabout
thenegativesideofthecointheOnyxwassaidtocause
maresandgeneralproblemsforthewearer.Anyperson
TheOnyxisone of thegemstonesofthisPathwhichissaid
tokeepawaythoughtsofasexualnature.Becauseofthisitwas
widelywornincountrieslikeIndiainanefforttoprotectthe
youngandvirtuousfrombeingledastray.Fromamedicinalstand-
pointtheOnyxwassaidtorelievefeversandinflammations.
night-
whowas
thoughttobeeffectedbyanOnyxwasusuallygivenaSardonyx
Go
11
14
6
I
P
L28/pg7
Stone(acombinationofCarnelianandwhiteOnyx)whichwassaid
toneutralisethepoweroftheonyx.TheArabscalledtheonyxel
jaza,thestoneofsadness,andsaidthatitdrainedthelife
forcesfromthebody.
TheplantofthisPathistheSunflower(Helianthusannus)
whichaccordingtolegend,bringsconceptiontothosewomenwho
wantchildren.Itissaidthatiftheflowerwasplacedinan
areaitwouldbringwealthtothosearoundit.Mostpartsofthis
planthavesomepracticaluse.Theflowerscanbeusedas
yellowdyeandtheleavescanbeusedasfodderforfarmanimals.
Theseedsareofhighproteinvalueandfromtheseavaluableoil
canbeextractedwhichcanbeusedformedicinalaswellculinary
purposes.Therootsofthisplantareusedforsuchthings
rheumatismandarthritis.
ThearomaticassociatedtothisPathisAlmondwhichcanbe
usedaseitheranincenseoranoil .ItsbotanicalnameisPrunus
communisa,bothitsflowersandkernalareutilised.Itisused
asanoilinbothfertilityandprosperityritualsbyboththe
EgyptiansandtheRomanstobothRaandApollo .Itwasalsoused
toanointloversforfertilityfestivals.TheGreeklegendasso-
ciatesthisincenseoroilwithPhyllis,whowasabandonedonher
weddingdaybyDemophon .Sheeventuallydiedofabrokenheart
andwasturnedintoanalmondtreewhichwasasymbolofhope.
ThelegendaryorderofbeingsofthisPatharetheDragons.
Theyappearinalmosteverycultureknowntomanandareconsi-
a
as
whattheyrepresentonemuststudy
periodsofculturaldevelopment.
L28/pg8
dered as a combinationofaserpentandabird.

understand
theireffectduring certain
IntheChristainreligiondra-
gonswereconsideredevilandhadtobeconqueredbecauseof
relationshipwiththeserpent.Intheeastthedragonisasymbol
solarpowerandgrowth.Usuallytheyaresymbolic ofthe
untamedareasofbothnatureandthepsyche .Thealchemical
conceptsofthedragonisthevolatilenature.Asbeingsandnot
symbolstheycanbetamedanddirectedorcausehavoc,depending
onthecircumstanceofwhowishestocontrolthem.
TheangelofthisPathisVerkielwhoisoneofthegover-
norsoftheSun.TherootVRrelatestothenoiseofthewind
whileCRisfromtheArabicmeaningburn .Theconceptrelatesto
burningwindswhichisinempathywiththedesertheat.Byusing
gematriawefindthatVerkiel(VRKYAL)hasanumerialvalueof
267whichequateswithMRKBHmeaningchariot,whichinthis
instancerelatestotheSun'sjourneythroughtheheavens .Reduc-
ing267toadoubledigitgives15whichrelatestoHVDmeaning
flashinglight,YGBwhichis'whoturnstheland'andYH'Hewho
is' .Alloftheseshowanaspectofangelicpowerrelatedtothe
Sun.
TheLionCheruboffireisassociatedhereastheanimal
thisPathandthroughthefireelementhedirectsthepotencies
ofheatandwarmthtotheearthbelow.Heinfactisacorner
stoneoftheforceoffireandlinkswiththezodiacrayssothat
hisdutiesaresharedbythehigherpowersabovehim.Thoughhe
1
4%
j
t
YETZIRATICTEXT:
HEBREWLETTER:
TAROT:
EGYPTIANDIETY:
GREEKDIETY:
ROMANDIETY:
SIGN:
MAGICALWEAPON:
VIRTUE:
VICE:
MAGICALPOWER:
MINERALDRUG:
VEGETABLEDRUG:
GEMSTONE:
PLANT:
AROMA' . -AC:
ORDEROFBEINGS:
ANGEL:
ANIMAL:
L28/pg9
is not the fire element itself he does control the forces o it
and as suchholds thebalanceofpower,heistheonewhores-
trictsthiselementtodesignatedareas.Withouthiscontrolthe
elementoffirewouldgetoutofhand.
A_SSQCI-A-T-IONS
INTELIGENCEOFTHESECRETOF
ALLACTIVITIES
TETH
STRENGTH
BAST
HERCULES(HERACLES)
VENUS
LED
INTERNALSTRENGTH
INDIVIDUALISM
DEPENDENCY
POWERTOCONTROLWILDBEASTS
MAGNESIUMPHOSPHORICUM
CARMINATIVES
ONYX
SUNFLOWER
ALMOND
DRAGONS
VERKIEL
LIONCHERUB
t
r
t
of
'The Twentieth Path is the IntelligenceofWillandis
calledbecauseitisthe
LESSON29
THETWENTIETHPATH
createdbeing,andbythisintelligence
primordialWisdombecomesknown.'
L29/pg1
so
meansofpreparationofallandeach
theexistenceofthe
ThisPathiscommonlycalledtheIntelligenceofWillandis
thepreparatorystageforallcreatedthingsunderthecreator .
Atthispointtheinherentwill,whichwaspreviouslylatent,now
becomesnoticed.Toacertainextentonecouldcallthisthe
stateofawareness,foritisourawarenessofbeingpartofa
divineplanunderthedirectionofthehigherself
.Thewhole
conceptisbeingverymuchawareofthespiritualevolutionary
processthatoneundergoesatthislevel
.,Itisherealsothat
onestartstobecomeawareoftheexistenceofourkarmicdesti-
niesandthepuppetlikemovesorchestratedbyourhigherselves
onourbehalf.
TheHebrewletterofthisPathisYodwhichmeanshand.Asa
letterYodhasanumericalvalueof10whichrelates
other
wordsofthesamevaluelikeGBHmeaning"tobeexalted",HHas
anexclamationoi grief(intheformof a teardrop)

Asaword
Yodhasavalueof20whichrelatestootherwordssuchas
DIV
meaningblackliquidorink,whichshowsthefirstmanifestation
ofthewritingoftheHebrewAlphabet
.InthebookoftheLesser
L29/pg 2
HolyAssemblyitsays:'AndallthingsareincludedinIVD,Yod,
andthereforeistheFathercalledAll,theFatherofFathers' .
Thisrathercrypticexplanationhasanumberofdifferentmean-
ingsappliedtoit,dependinghow.deeponewishestogo,butthe
essenceisthatYodrelatestoChokmahwhichisalsodubbedthe
Father.
Yodrepresentsmorethantheoutstretchedforefingerorhand
butalso to adropofseminalfluid,lifesessence.DeO'Livet
consideredthatYodrepresentedmanifestedpowerbutasagramma-
ticalsignwasinfactapotentialpointofmanifestationand
intellectualduration.Whenappliedasaconsonantitworkson
thematerialplaneandservesonlyasalink(suchasZainand
Shin) .Yod,byitsnatureandshape(thewomb)islinkedtothe
femalereproductiveorgansandassuchrepresentedthetender
aspectofemotioninitsinfantstate.
TheTarotcardrelatedtothisPathistheHermitand
depictsahermitgarbedinahoodedcloakholdingbotha lantern
andastaff .Theentireconceptisthatofamanwhohaslearnt
thespiritualaspectsofwhatliferepresentsthroughtheforces'
ofnature.Hetravelsalonewiththelight carrieswhich
representshisspiritualguide,hisownHigherGeniuswhich
teacheshiminsolitude.Therodheholdsisasymbolofhis
ancientpowersandgiveshimstrengththroughouthis
is .thepathfinderforallthosewhocomeafterhim.
journey.He
EgyptianmythsassociatedtothisPatharetwovaria-
I
I
I
I
r
r
thatofIsisthevirginwhich
L~9/pg3
tions of the Isistheme.ThefirstisIsisthewandererwho
travelledinstrangelandsafterthedeathofOsiris.Becauseof
herknowledgeandmannershesoongainedtherespectandaffec-
tionofallthosesheservedandrosetoapositionofprominence
i

foreigncourts.ThesecondformofIsisassociatedhereis
issometimesconnectedwiththe
Virgin Mary. ThisrelatestoIsisasbothvirginandmotherand
alsoisheavilyassociatedtoMaryweepingatthe crossforher
dead son. Both as virgin and sometimesasmotherIsis is usually
shownwithaveil .
OneoftheGreekmythslinkedtothisPathisthatof
Britomartis,whichmeanssweetvirgin.Sheissaidtohavebeen
thedaughterofZeusandwasapparentlyayounghuntressinCrete
whowasonceseenbyMinoswhofellinstantlyinlovewithher .
Britomartisrefusedhisadvancesandwhenhetriedtorape her
shefledtothehillsofCrete,wheresheaviodedhimfor9
monthsuntil eventuallycaughtupwithheronaclifftop
overlookingthesea.RatherthangiveintoMinosshethrew
herselfintothesea,preferringdeathratherthansurrender .As
reward for preservinghervirginityArtemisletherappearat
nighttonavigatorsontheseas.
OneparticularRomanmyththatcanbeappliedtothisPath
isthatofVirginia,oneoftheoldestoftheRoman dietieswho
presidedoverfieldsandcropsastheirprotectress .Alsoapart
frombeingagoddessofprotectedthefieldsandcropsshewas
also

goddessavictoryandthedietywhopresidedovercorn
earofcorn).Otherstarsinthisregion
L29/pg4
festivals. Legend has it that she roamed the fieldsandwoodsat
night,guardingcropsand guiding travellers.Shewassaid
havevisitedfarmersintheirdreamsandinstructedtheminhow
toachievebetterresultsfromtheircrops .
ThosebornunderthesunsignofVirgo(whichisappliedto
thisPath)arestudiousandversatileindividuals.Bynaturethey
aremethodicalandskepticalpeoplewhohave a knackofgetting
totheheartofanyproblem.Sometimestheybecomesopreoccupied
withtheirthoughtsandproblemstheytendtobeobliviousto
thosearoundthem.Theyusuallyhaveadreadofdiseaseandany
formofillnessnomatterhowtrivial .Asindividualstheyliketo
havetheirownwayinareasthattheyconsidertheirterritory
andtotheantagonisttheycanbecomeverydevious.
TheconstellationofVirgoisassociatedtothisPathandis
calledBethulah(meaningvirgin)whiletheArabicnameisSunbul
(ear4 corn). AnotherArabicnameforthisconstellationmeans
"abranch"andinlatinisVirga.Thereareover110starsin
thisconstellationandoneofthemainonesisTzemechmeaning
"preserved",whichinArabicisAlZimach(nowcalledSpica - an
areZavijaveh(the
beautiful),AlMureddin(whoshallcomedown),Subilon(spikeof
corn),AlAzal"branch",andSubilahmeaning"whocarries" .
Ptolemyobserves'ThestarsintheheadofVirgo,andatthetop
ofthesouthernwing,operatelikeMercuryandsomewhatlike
Mars:theotherbrightstarsinthesamewing,andthoseabout
thegirdleresembleMercuryintheirinfluenceandalsoVenus
44
i
M
t
r
L29/pg5
moderately those at thepointsofthefeetandatthebottom
thegarmentsarelikeMercuryandalsoMars,moderately'
.
Themagicalweapon of thisPathis the lamp.Thoughrepre-
sentative f heat, warmthandlife,itisalsostatedinthe
Neophyteceremonyofthe, GoldenDawnwhentheHierophant
addressestheNeophyteandpointstothelamp :'Inallthy
wanderingsindarknessthelightoftheKeruxwentbeforethee,
thoughit was
notseenbythineeyesitisasymbolofthelight
ofthehiddenknowledge'
.Thelampisinfactasymbolofbring-
inglightintodarkness,thoughitalsoisasymboloftheperson
whholdsitforitishethattraversestheunknownareas
seekingwisdom.
ThevirtueofthisPathisreorientation.Heretheself is
thoroughlyanalysedandgoesthroughageneralshakeup.Amore
encompassingoutlooknowdevelopsastheindividualgoesbeyond
theboundsof his previousexperiencesinthesensethathenow
worksforthecommongoodofall
.Itisacompletelynewspiri-
tualconceptthathasdevelopedwithintheself .Toacertain
extentthisisaninitiationofsortsintoanothermodeorlevel
ofexistence.TheleapforwardinthisPath,comparedtothepre-
viousone,isadrasticchangeastheegonowmustacceptits
trueplaceasapartandnotasawholeofthetheuniversal
harmony.
TheviceofthisPathisthatofblindacceptance.Itis
herethattheindividualadaptstoeverychangingsituation while
traps of this Path are blundered into by the
L9/pg6
not maintaining any single line of approach. All the pitfalls and
individual and are
not recognised for whatthey are. As a result of this there is no
great leap forward either emotionallyorspirituallyandthe
reorientationprocesscannotdevelop properly. Trainingforthis
developmentigivenbutinthisinstanceitisthewrongtype
anditlacksanydepth,sothedeepforcesoftheselfcannotbe
manifestedintotakingthecorrectcourseofaction .
ThemagicalattainmentofthisPathis invisibility. There
areanumberofvariationsofthisthemewhichcanbecategorised
intothreestages.Thefirstiswhentheadeptcanalterthe
vibrationsofhisauraandslowthemdowntosuchanextentthat
hebecomesthetypicalunnoticedperson,someonewhotanblendin
anywherenomatterwhatthesituationandgoundetected .The
secondstageiswhenapersondeliberatelycloakshisauraso
isusuallydone
orattack.

The
thatitisnotdetectableontheastral .This
whenheisunder some sortofastralscrutiny
thirdandfinalstageisthehighestaspirationoftheadept
thisPath,whenhecontrolshisauricpitchtosuchanextent
thathecanexcludelight rays andcanattaincomplete
invisibility.
ThemineraldrugofthisPathisKaliSulphuricumwhichwhen
takeninternallymanufacturesoilinthesystem .Itthenunclogs
thatoilthathasgatheredinthetissues anddistributesit
throughoutthebody.Generallyitrulesthe bowels andcontrols
theoilflowthroughtheentiresystem.Thevegetabledrugsof
1
t
I
I
I
I
M
t
L29/pg7
thisPathareanythatareclassedasasexualdepressant.Agood
exampleofoneoftheseformenisanyformofextractfromhops,
suchasbeer.Howeverthishasacompletereverseeffectin
andactuallystimulatestheirsexdrive .
OneoftheIndianassociationhereisanextractfromthe
Bhagvad-Gita:'Learnedpersonsandgreatsagesintherenounced
orderoflifewhouttertheOmkara,enterintoBrahman .Desiring
suchperfection,onepracticescelibacy.
youthisprocessforattainingsalvation.Theyogicsituation
that4detachmentfromallsensualengagements.Closingall
doorsofthesensesandfixingthemindontheheartandthe
Ishallnowexplainto
women
is
air
oflifeonthetopofthehead,oneestablishesthissituation.'
OneofthegemstonesrelatedhereisPeridot(whichisGreek
forgoldenstone)whichisabrightgreenincolour.Inearly
daysPeridotwascalledChrysoliteandalsoTopaz,buttheyare
infactadistinctlydifferentstonefromtheTopazandarenot
tobeconfusedwithit.Thisstonehadanextraordinaryinner
glowaboutitthatissaidtobedetectableatnight.Itwasa
stoneheldinhighesteeminancientEgypt.Peridothadthe
reputationofprotectingoneagainstalmostanykindofevilor
sorceryhavingmuchthesameeffectacrucifixhasonthevampire
ofthemovies.Itisalsosaid-tobeapowerfulamuletfor
obtainingloveandfordispellingfeversfromthebody.
Aplantthatcouldbeascribed

thisPathisthe
Narcissus.

InGreekmythologyNarcissuswasabeautifulyoung
obtainedinboththeEastandWestIndiesandSouthAmerica.
usedinfertilityceremonies,
L29/pg8
man who fell inlovewithhisownreflectionandeventuallypined
forit so muchthathediedofabrokenheart.Legend has itthat
thisflowersprungfromtheplacewherehedied.This
extractshave

narcotictypeeffectthatissaidtobring
stupifyingeffectifeatenorusedasanaromatic.Themagical
useofthisplantissaidtobringoneintouchwithhisHoly
GuardianAngel if eatenatthecorrecttime,thoughthisplantis
poisonousanddangerous.
ThearomaticsofthisPathareNarcissus(describedinthe
previousparagraph)andCinnamon(Cinnamomumzeylanicum) .Theoil
of Cinnamomisobtainedfromthebark of Lauraceaewhichis
andits
The
EgyptiansfirstusedCinnamonasbothaspiceandanaromatic
especiallyinembalmingandreligiousceremonies.Thoughmainly
oilof Cinnamonwasalsousedin
catholicism in lateryearsandbecameanincenseofwideand
varyingreputation.Itwasreputedlyusedasananointingoilfor
thetempleofthevestalvirginsinRome.
ThelegendaryorderofbeingsofthisPatharethefairies.
TheoriginsofthesebeingsarepossiblyCelticandthereare
saidtobethreestagesofthem.Theyareimpi-hbynatureand
haveoccasionallyconsortedwith
AnotherasociationtothisPathare
mentobetheirhusbands.
mermaidsandalthoughthey
arewaterybyvirtueoftheirenvironmenttheyarevirginalby
nature(inthesensethattheycannotmatewithman)andassuch
areassociatedtothisPath .
1
t
46
t
I
I
M
I
L29/pg 9
The Archangel of thisPathisHamaliel(HMLYAL) .Theroots
thiswordareHMmeaningaburdenordisturbance,whileHML
mean"afallingofrains"or"tears".Thenumericalvalueofthis
archangelsnameis116whichinturnrelatestootherswordssuch
asB1AaDYmeaningwithout.Reductiontoadoubledigitgivesus
17 which relatestoZBChwhichmeansslay-foodforsacrifice,ChT
meaningpressorjointogetherandYHBtogiveorsupply .The
entireconceptisthatofthewaitingvirginforit is asignof
potentialthathasnotasyetbeenfulfilledbutislookedfor-
wardtowithamixtureofsorrowandhappiness.Thisshowsthat
thisarchangelisonewhopreparespeopleforcomingevents.
TheanimalofthisPathisanyanimalofasolitarynature .
Therearenumerousassociationsherethatonlyrelatetothe
animalsnaturaltendenciesandassucharenotreallytrue
representationoftheanimalitselfandwhat its symbolismstands
for.
YETZIRATICTEXT:
HEBREWLETTER:
TAROT:
EGYPTIANDIETY:
GREEKDIETY:
ROMANDIETY:
SIGN:
CONSTELLATION:
MAGICALWEAPON:
VIRTUE:
VICE:
MAGICALPOWER:
MINERALDRUG:
VEGETABLEDRUG:
GEMSTONE:
PLANT:
AROMATIC:
ORDEROFBEINGS:
ARCHANGEL:
ANIMAL:
A_SS_QCIA_TI_0_NS_
L29/pg 10
INTELLIGENCEOFWILL
YOD
HERMIT
ISIS
BRITOMARTIS
VIRGINIA
VIRGO
SCORPIO
LAMP
REORIENTATION
BLINDACCEPTANCE
INVISIBILITY
KALISULPHURICUM
HOPS
PERIDOT
NARCISSUS
CINNAMON
FAIRIES(MERMAIDS)
HAMALIEL
THOSEOFASOLITARYNATURE
41
1
A
1
LESSON30
TWENTY-FIRSTPATH
'TheTwenty-FirstPathistheIntelligenceofConciliation
andreward,andissocalledbecauseitreceivesthedivine
influencewhichflowsintoitfrom .itsbenedictionuponalland
eachexistence.'
The21stPathjoinsChesedandNetzachandistitled'the
IntelligenceofConciliationandReward"becauseitreceives
divineemanationswhichflowthroughfromtheHigherSelf .The
term'conciliation'inthisinstancemeansthatthephysicalbody
andthedictatesoftheHigherSelfactinagreement .Thebody
cannotexist.withoutthedivinesparkofcreationwhichissus-
tainedunderthedirectionoftheHigherSelfwhiletheHigher
Selfcannotexistwithouttheenergiesneededtobeworkedouton
thephysicalplane.Itisacyclicconceptwitheachneedingthe
other, resulting.i n harmonyandgrowth,hencetheuseoftheterm
'reward' .
TheHebrewletterofthisPathisKaphwhichmeans'hand' .
Ithasanumericalvalueoftwentywhichrelatestootherwords
ofthesamevalue,suchasChZHmeaning"tosettle",thisinturn
canbelinkedwiththeconcept of ahandshaketsettlea
bargain.

Kaphasawordhasavalue of 100 whichcanrelate


KLKLmeaning'tonourish'whichshowsthehandasatool
L30/pg1
nourishment.

AlsoLAameaningto'absorb'or ' swallow' relates


applicationwhichshowsthe
inthiscaseispointedupward.
O'LivetobservedthatKaphrepresentsahollowedobject
or a cuppedhand.Asagrammaticalsignit is assimulativeinthe
sensethatitreflectstransientlife .Asaletter this wassaid
thavebeerrderivedfromtheletterChethwhichinturncomes
fromHehwhichisoneoftheimagesoflifewhichinturnrelates
toGimelwhichisitsbackuporreinforcement .
TheTarotassociationtothisPathistheWheelofFortune
whichdepictsa12spokedwheelwithasphinx above andan
tionofaproject .Thesphinxabove
thattheactualturningofthewheel
Amen-Raas'FatheroftheGods' .
L:4/pg2
hereaswellforitshowstheabilityofthehandtoencompassan
object.ThewordAaLmeaning'high '
or'exalted'isyetanother
handasapointerofdirectionwhich
ape
below.Theentireconcepthereistoexplorethecyclicnature
ofexistenceanditseffectthroughthefourelements
.Itinfact
showsacompletecycleofdevelopmentandthesuccessfulcomple-
thewheelshowsthatthe
turningofthewheeliswellbalancedwhiletheapebelowshows
iscontinuouswhichboth
contribute

theconceptofperpetualmotion,apowersource
thatcanbetappedifappliedcorrectly.
TheEgyptianmythassociatedhereisthatofAtumorTemuas
heissometimescalledHewasagodthatinsomeareasupstaged
Atumisusuallydepictedas
beardedmanwithadoublecrown,andseatedonathrone
.

The
nameAtumissaidtobefromtheroot'nottobe' .Hewassaidto
1
f
11
is
r
1
brotherswhoprocreatedwhereevertheywent,
L30/pg3
the closer of the day and held many varying titles such as
'maker of men' and 'makerofgods' .Atumwasinfactaveryearly
EgyptianGodformandinlaterperiodswasidentifiedwiththe
sungodbuthismainareaofworshipwasiandaround
Heliopolis.IntheBookoftheDeaditsays:"I am Atumwhenhe
wasaloneinNun,IamRawhenhedawned,whenhebegantorule
thatwhichhehadmade".Thisclearlyshowsthisgodas a force
that wasconsideredtobetherebeforecreation .
InGreekmythologythereareanumberofgodformsthatcould
beassociatedtothisPath.ThefirstisofcourseZeusandhis
attributionshave alreadybeendescribedinpreviouslessons .T
alesser extentsomeofhisattributionsarealsoapparentinhis
father,Cronus,whoisoftenassociatedtotime .Cronuswasone
oftheTitansandsonofUranusandGe .LegendhasitthatCronus
wasresponsible forcreationasweknowitbyreleasinghis
eventuallylaying
thebasicfoundationofcivilisationforman

inherit .An
oraclehoweverhadpredictedthatCronuswouldbeoverthrown
Jupitertheme.Oneof
by
oneofhischildren,soinordertopreventthisheswallowed
eachoneatbirth .WhenhiswifeRheagavebirthtoZeusshe
feltsuchaffectionforthechildthatshegave-Cronusastone
(disguisedashe-babyson)toswallowwhichtherebysavedher
sonwhoeventuallyfulfilledtheprophecy .
TheRomanmythsofthisPathareallavariation

the
themostappropriateisJupiterof
EstruscannywhowascalledTinia .

Hewasthe typical personifi-


L30/pg
4
cation of the fatherimage, both stern and vengeful at the same
time. In fact he was a typicalrendition of the god of the Old
Testament, who hurledthunderbolts at those who earned his dis-
pleasure and comforted those who obeyed and worshipped him.
The magical weapon of thisPathisthesceptre,whichis
oftenconfusedwiththewand.Firstofallasceptre is usedboth
asasymbolofauthorityandalsoasamagicalweapon .Whilethe
t formerneedsnoexplanationthelatterdoes .Inancientkingdoms,
andinsomechurches,thesceptreofthepriestorkingwasused
in consecration(mainlywithholywater)ritualsandincorona-
tions.Themystical theorybehindthissymbolofpoweristhat
whenraisedandwavedabovetheheadoftheassemblyitwassaid
tobestowbenefitsuponthepeople;generallythiswastheonly
timeitwasusedonapracticalbasis.Theideabehindthiswas
.thattheking representeddivine powerandthatbywavingitover
thepeopletheyinfactwerearecipientofthatpowerinmuch
thesamemannerasthetouchofthekingwassaidtohealthe
sick .This coursecanonlybedonefromauthorityandthe
lineagebehindit .
ThevirtueofthisPathiscompassionategenerosity.Here
theindividualisonewhoisinapositiontohelp,anduseshis
powerandwealthinturntohelpothers.Itisasimplelesson
butitcanonlyreallybelearntfromapositionofwealth
(whetherofspiritualormaterial)forthepersonmustcomedown
fromacompletelydifferentleveltohelpthosewhoneedit .
Thosewhoareat-thislevelandgiveoutwhatlittletheyownto
1
t
I
is,
I
I
t
M
E
form and control the masses .
L30/pg 5
others are on another karmic level with a different lesson
learn.

The wholeconcepthereistodisperseaccumulationsso
that one is remindedoftheirmortality.
Theviceassociatedhereisthatofindifferencetothe
wantsofothers.Heretheindividualhasdeliberatelyshuthim
orherselfofffromfeelingsotherthanthewantsandthedesires
oftheself .Toacertainextentwemustallbeindifferent at
timesforourowndevelopment,butheretheegohascompletely
takenoverbyshowingonlytheimmediateworldaroundusand
,forgettingthatotherstohaverightsandwants .Inarchetypal
termswehavetheempirebuildersooftenshowninbigbusiness
today,whohaslittleconscienceorconcernandwillbuildand
winatanycost.Itgoespastthestageofwantoraccumulation
andeventuallybecomesanobsessionthatisinfiniteinitspres-
suresanddesiresonindividualslikethese .
One themineraldrugsofthisPathisChromicSulphate
andrelatestobreakingdowntheglucoseintovitalenergy .It
takesenergyfromthecirculatorysystemandgivesproteintothe
bodypartthatneedsit .Alsoithelpsagainsthighbloodpres-
sureandisagooddeterrentfordiabetes.Adeficiencyin
Chromiumissaidtoleavewayfordiseaseslikediabetesand
arteriosclerosistoform .Initsnaturalformthebestsourcesof
ChromiumareBrewersyeast,shellfishandmushrooms.
ThemagicalattainmentofthisPathisthepowertotrans
Thisisagiftoftenseeninpoli-
ticiansandentertainersaswellasspiritualleaders
.
L30/pg6
abilitytoactivatewhatiscalledinsomeoccultcircles
instancesactslike
Itisthe
the
amagnettoanycollectiveandundirected
energywhichoftenappearsincrowds,andabsorbsit,whichin
turnstrengthenstheaurawhichinturncreatesmoreattraction
sothatthehigherenergiesingeneralarefocalisedinto
singleunit.Atthispointcontrolisthenassertedandthecrowd
isunderthespelloftheindividualwhoisthefocalpointof
attention.
Oneofthevegetableworld'sassociationstothisPathis
theOakTree.

CalledinancienttimesthesacredOak(asitwas
knownbymorethanonecivilisation)itwasthetreeofbothZeus
andJupiter.Itrepresentedsecurity,strengthandshelter
(usuallyfromstorms)andalsolongevity .AnOakgroveusedtobe
orangebandoftheaura
.Tothesightofaclairvoyantanyone
withthisgiftliterallyglowsorange
.Theaurainthese
1
s
t
I
thesacredgroveswhereDruidprieststaughtandheldtheir
ceremonies.Manyancientcultsofferedsacrificestothespirit
oftheOaktreebecauseitwasoftenthemightiesttreeinthe
forest.TheOakisalsoatreethatisnotedtoattractlightning
anddrawsaparallelwithbothZeusandJupiterasgodswho
hurledthunderbolts.
CocaineisthevegetabledrugofthisPathandisobtained
fromtheleavesoftheCocoplant .Themedievalhistoryofthis
drugisthattheSouthAmericanIndiansuseditbysuckingthe
Cocoleaves(withash)whichactedasacerebalstimulantandlet
I
I
I
I
ID
1
t
L30/pg7
themperformanumberofamazingfeatsofphysicalstrengthand
endurance.OriginallytheSpanishforbidtheuseofthisplant
butwhentheysawitsbenefitstofieldhands onplantations in
producingmorethanasatisfactorydaysworktheyturnedablind
eyetoitsuses.Itseffectdependsentirelyonthedosesand
lengthoftimeoneusesit .
TheHindudietyhereisIndra,whoisthegodofthunderand
s
rain.Heisoftendepictedinachariotandarmedwithbow
thatshootsthunderboltsathisenemies .Histitleislordofthe
heavenandappearstobeagodwhowasthereatthebeginningof
creation,thoughheisbyfarthemosthumanofalltheIndian
gods.Therearenumerousexploitsassociatedtothisgodwhois
possiblymentionedmorethananyothergodintheVeda.

Hwas
thetypicalsoldierwhogotdrunkforthesimplicityof itand
wasalwaystravellingandgettingintoscrapesinwhichhwas
nearlyalwayvictorious.Tomanyhewastheessenceofnature
itself,goodwhengoodandbadwhenbadbutanextremelypopular
dietywhoalwaysbroughtbounty .
ThegemstoneofthisPathisLapisLazuli(from'lapis'
meaningstoneand'azul'meaningblue)whichisadeepblue
stonewithbothgoldandwhiteflecksthroughit(ironpyrites) .
Themedicalpropertiesofthisstoneincludeacurefordepres-
sionandfevers,whenwornagainsttheskinitcantoneupthe
wholesystem.Othereffectsofthisgemarecuringeyeproblems
andepilepsy.Itspsychiceffectissaidtokeepawaynegative
influencesandbringgoodluckandwealthtothewearer.Lapis
Itseffects,
L30/pg e
Lazullwasalsoaspecialsymbolofthepriesthoodinancient
Egypt (as animageofMaat,goddessofTruth)andwasgenerally
associatedtopositionsofpower.
Saffron,asanaromatic,isalsolinkedtothisPath,andis
veryoldspiceandperfumedatingback topre-biblicaltimes .
wheninhaled,isthatofa calmati.ve.Inancient
timessaffronwasusedinfertilityritesandreligiousceremo-
niesCmainlyintakirgoffice)inbothEgyptianand Hebrew -; reli-
gions.Thesaffronaromaissaidtoenhanceandstrengthenthe
auraoftheindividual .Itsmagneticqualities,overall,arean
extremelyusefultoolinmagicalceremoniesand are .said tohelp
the .individuallinkupandcontroltheastral.1,nfhueftL 4es_-- around
him.
Anincubusisthespiritwhoisassociated- - hereandis
defined in the Oxford dictionary as an evil spirit who descends
onsleepingpersons,givingnightmares .Inrecent ..yearshowever,
someoccultistshaveusedthisterminconnectionwiththemascu-
linecounterpartofthesuccubi .Thisisthemalespiritwhohas
sexualrelationswithhumanfemales.Theincubuscaninfectthe
auraof a woman to such an extent that shecan be totally subser-
vienttothem.Thesespiritsareparasiticbynatureandtakea
greatdealofdislodgingastheyactlikeaanastralshelland
attachthemselvestotheauraoftheirvictim .
TheOlympicPlanetarySpiritofthisPathisBethor,whose
nameisderivedfromtherootBHRwhichmeanscrystalormarble
41
to
11
spiriti

usuallydepictedas
L30/pg9
(that throws out. bright sparks . This spirit rules 32 provinces
andgovernsallthingsrelatedtoJupiter .Heisnotedforhis
generosityinshowingpeoplehowtoobtainwealthandisableto
commandsomeofthelesserarielspiritstogivetruthful
answers.Bethorisalsoabletomakethehealingpowersofpre-
ciousstonesworkaswellasprolonginglife .Hehas42kings,
35princes,28dukes,21councillors,14ministers,7messengers
andcommands; .29,000legionsmfspiritsunderhiscontrol .This
a king .withadrawn t swordwhile
ridingonthebackofastag .Otherdescriptionsofhimvarybut
heit-'.al- so often showndressedinregalgarments .
The'_ar imil -ofthisPathisaStagwhichshowsshowsroyalty

.,
I
I
I
I
I
I
I
I
I
andregeneration(duetoitsantlersresemblingbushesand
branches) .Itisoneofthefewanimalsthatforgethelinkwith
thespiritual .-planeofexistenceandtheearth.Thestagalways
hadatremendouspowertohealattachedtoitspresenceandwas
said-tobe:abletoleadaherbalisttothemedicinalherbhe
seeking .
YETZ.IRATICTEXT:
EBREWLETTER:
TAROT:
EGYPTIANDIETY:
GREEKDIETY:
ROMAN,DIETY
PLANETS
MAGICALWAP.ON :
VIRTUE: .
VICES
MACALPOWER;, :
MINERALDRUG:.
VEGETABLE . .DRUG:.
INDIAN.ASSOCIATION:
GEMSTONE:
PLANT. :
.AROMATIC;. .
ORDER . .OFBE,ING,a:.,
ANIMAL:
OLYMPICPLANETARYSPIRIT :
L%2ZQC_AT2CQN_S
L30/pg 10
INTELLIGENCEOFCONCILIATIONAND
REWARD
KAPH
WHEELOFFORTUNE-'
ATUM/TEMU
ZEUS,CRONUS
JUPITER
JUPITER
SCEPTRE
COMPASS I ONATE.. G

:QIITY
IND,IF.FERQ4CE TO .

i4ANTSOF
OTHERS .,
TOTRANSFORM AND.,TFOLTHE
MASSES
CHROMIC SULPHATE- __
COCAINE
INDRA.
LAPIS~ .LAZUL,I
OAK -TREE
SAFFRON
INCUBUS.
STAG
BETHOR
r
I
I
I
I
I
I
I
1
1
1
t",
LESSON31
TWENTY-SECONDPATH
'TheTwenty-secondPathistheFaithfulIntelligenceandis
so calledbecausebyitspiritualvirtuesareincreased,andall
dwellersoneartharenearlyunderitsshadow .'
ThisPathconnectsGeburahandTiphareth and.i s called
.1
'FaithfulIntelligence' .Thisshowsspiritualvirtuesbeing
increased(inthe ' faithful) .

Overall,theconceptsofthisPath
L31/pg1
showthosethatfollowthedivineplanbeing augmented,while
thosethatdonot,apparentlyreceivenothing(byassumption) .
Thereferencetothe'Faithful'referstothosegroupsandindi-
vidualsthatobeytheirownvariouslawsandteaching .Also
withinthestatement of theYetziraticText'andalldwellerson
theeartharenearlyunderitsshadow'thereappearstobe
somethingofawarninginrelationtoallbeingsonearthbeing
subjecttocertainlaws.
LamedistheHebrewletterofthisPath,itmeansox-goadandhas
anumericalvalueof30 .OtherwordsofthesamevalueareBChK
meaning"nauseate".KHHmeaning"constriction"andKYmeaning
"restriction" .

Alltheseconceptsrefertosomethingrestricted
andunwell .ThewordLamedhasavalue of 74whichrelatesto
otherwordssuchasYSD"tocreatethefoundationof" .AaDmeaning
"beingbeyond"andNKDmeaning"posterity" .All of theseshowus
furtherinsightsintothemeaningofthisletterwhichgivesus
r
grammatical signitgivesthebasicideaofelevation,
L31/pg
additional conceptsofenlightenmentandthingsgetting
butonlyafterinitiahardship.
appendagethatunfolds,extendsorraisesitselfoutfrom
better
O'livetobservesthattheimageofLamedisthatofthe
arm ofaman,wingofabirdoranyotheranimalthathasan
the
mainbody.Whenusedas a consonantitisavocalsoundandasa
expansion
andpossession.

Italsoexpressesanyformofharmoniousmove-
mentorunionthathelpsorpropelsadesiredobject.
JusticeisthetitleoftheTarotcardassociated this
Path.Itshowsaseatedfigurebetweentwo pillars, holdingan
upraisedswordinonehandanda set ofscalesintheother .
Beneaththefeetofthisfigureisafox .Thisistosymbolise
theactionofcauseandeffect;whatwesowwereap .Theentire
concept ofthiscardisoneofbalancingup,togetridofthe
unwantedandaugmenttheneeded .Ifthisisnotdone,theup-
raisedswordwillthenbeputtogooduseasthereisnoescape .
TheEgyptianmythofthisPathisthatofMaat,thegoddess
oftruthandjustice.Sheisusuallydepictedeitherstandingor
sittingwithahugeplumeasaheadress .Thiswasinfactthe
featherusedintheHallofTruthwhichwasplacedonthescales
totestthedeceasedwhenpresentedtoOsiris.Ifthegooddeeds
outweighedthebadthescaleswouldtiltinfavourofthe
deceased. BudgeconsideredMaaatasapersonificationofboth
physicalandmorallawandinfactrepresentorderinitshighest
1
1
1
1
I
1
1
L31/pg 3
form. In the Egyptian Book of the Dead, Maat still would not let
the deceased enter the abodeof the blessed (even though they
passed the test of weighing of the heart) unless they knew the
magical' namest open the door . This shows that while Maat
expected fairness in the life of the individual it was still not
enough. She also expected that lessonswere to be learnt, which
represented having the knowledge to know the magical names onthe
door to thenext region.
Themis is oneofthe Greek goddesses associated here. She
was the daughter of Coelus and Teraand wife of Zeus (against her
will) . As a goddess she was held in greatacclaim in regions
such asAtticawhereshedirectedtheOracle ;shewasrenowned
forheraccuracy.DeucalionactuallyconsultedthisOracleand
wasinstructedinrepairingthelosstomankind .Themiswas
usuallyassociatedtotheseasons,thecycliclawofchange .She
presidedoverthevettingofthepetitionsmenmadetothegods
andonlyaskedforwhatwasjustandinreturnalsomadesure
thatthegodsfulfilledtheirpromisesinreturn .
TheRomanassociationothisPathisthatoftheFates
(sometimescalleddaughtersofthenight),thethreesisterswho
determinedthecourseoflifebyweavingandinterweavingthe
destiniesofmankind .TheRomansalsocalledthemtheParcae .In
moreeasterntermstheywould theweaversofkarmic
destinies.
LibraisthesunsignofthisPath.Asarulethoseborn
The constellation of Libra contains over 51 stars. The
Hebrew name for this constellation is Mozanaim meaning the scales
or something in the act of weighing . Its Arabic counterpart is
called Al
Zubenameaningredemptionorpurchase .TheLatinname
isLibra(meaningweighing)whichhasstuckasthegeneralname
throughouttheagesindescribingthisstarcluster .Some of the
starsinthisconstellationareZubenalGenubi(meaningthe
pricewhichisdeficient),ZubenalChemali (

th meaningeprice
whichcovers)andZubbenAkrabi(meaningthepriceofthecon-

'
flict) .

PtolemyobservesthatthestarsintheclawsofScorpio

'
(theoldnameforLibra)operatelikeJupiterandMercuryand
thoseinthemiddleoftheclawslikeSaturnandinsomedegree

'
likeMars .
ThemagicalweaponofthisPathisthescales
of balance.
Hereeverythingmustbeweighedandmeasuredbytheadeptbefore
itisacceptableforuse.

Theyaremainlyusedin alchemical

I
worksthattheadeptshouldstudyaspartofhisorheroccult
training,
banadeptinsolvingaproblemorrectifyingasituation.

In
buttheyalso-standfortheamountofforcetobeused
L31/pg4
under, this sign are persuasive but tactful individuals who are
sometimes referred to as the beautiful people . By nature they
are materialistic and somewhatsuperficial . Librans are also
romanticsand their confidence is easily upsurged. They are
flighty by instinct and try to be all things to all people. By
profession they tend to gravitatetowards positions of power
also act as mediators such as judges and diplomats.
S
and
1
I
I
I
I
I
I
L31/pg5
short the
scalesrepresentthejudgementoftheadeptinmaking
magicaldecisionsbasedonhisobservations.
ThemagicalvirtueofthisPath is rebirth.Heretheindivi-
dualhasevolvedfromaminorstateofawareness intoacom-
pletelynewlevelofunderstandingandassuchhispreviousviews
andoutlookswillnowhavetobediscardedandhewillhaveto
reorientatetowardsnewlevelsofgrowthandendurance.To
certain,extenthehasemergedatthislevelwith

child-like
attitudeandnowmustexperiencegrowthpainsashe
allhisoldconceptsintonewoutlets.Thekeyphraseofthis
virtueis"toknowonesplace"andthatisexperiencedatthis
levelwithgreateffect.
TheviceofthisPathissuperficiality .Heretheindivi-
dualcannotbreakthroughtheimportantbarriertowheregrowth
orrebirthcanoccur .Atthispointdriveislackingaswellas
depthandonefindsoneselfatthemerciesofmanipulativefates
iftrueWillisignoredandtheHigherSelfisnotlistenedto.
Depthcannotbereachedunlessonerealisesthatoneispartof
wholeandnottheotherwayaround .

Thisisthegreatest
obstaclethattheviceofthisPaththrowsup in frontofus,for
restructures
itappeasesouregoandtellsusonlywhatwewanttohear
.
thisinstanceoneknocksatthedoordemandingentranceas
rightandnotsomethingthatmustbeearned .
In
Themagicalattainment .ofthisPath is whentheindividual
becomesufficientlybalancedenoughtobeabletohandleboththe
h
negative and positive aspects of the energyo
this isthe path of equilibrium and balance.
not in relationto theirspecific karmicduties.
L31/pg 6
this Path, for
If one swaysto
either extreme the energieswillpickyouupandliterallydes-
troyyou.ToattaintheessenceofwhatthisPathrepresentsone
mustbealsoconfrontedortemptedwiththenegativeenergiesand
drawnonsothatonecanbetemptedwiththerighteousindigna-
tionwhenitistakentoanextreme .Thepowergiventothoseon
thisPathistheabilitytodiscernwhatiscorrectandwhatis
t
ThemineraldrugofthisPathisNaturumPhosphateandit
worksmainlyonintestinaldisorders,assimilationandwater
retentionsothatthekidneyscanfunctionmoreefficiently.
f the vegetable drugs related here as well is any extract
apple,whetheritbealcholicbeverageornot
.Alsoanyinfusion
of parsley or cucumber will help as they work on the purification
ofthebloodstreamandtheeliminationofwasteproducts.
IndiangodformwhoisrelatedhereisYamathejudgeof
men
.HewasthesonofTvashtarandVivasvatandwasmarriedto
hissisterYamiandbetweenthemtheywerethecreatorsofman-
kind
.YamaissaidtobebutareflectionofhisfathertheSun

'
andYamiisthepassivesideof-hisnature
.Betweenthemthey
One
holdthebalanceofpowerovermortalsgivingbothwarmth and
I
1
protectionaswellasfloodandfamine .Therearenumerous
titlesappliedtoYamasuchasjudge,kingofvirtue,punisher,
godoftheweatherandgodofdeathbutheisnotedasafairgod
who reunites loved ones after death in the invisible world beyond
I
t
the eyes of men.
One of the gemstonesofthisPathistheCarnelianwhichwas
consideredastonethatgavetotheindividualwheretherewasa
lackinstatureorspirit .Thosewhoworeitclaimeditmadethem
L31/pg 7
taller whilethosewithweakvoicesclaimeditmadethem more
resonant.Thecoloursofthisstonevaryfrompalepinktolight
orangeandit issaidtokeep
psychicillusionsorastralinterference .
thewearersafefromanyformf
I
Thiswasastonesaid
tohavebeenwornbytheprophetMohammedhimself(setinsilver
andusedasaring/sealcombination) .Thestonewaswidely
acclaimedasa symbolofvirtueandassuchwasusuallywornby
the pious of variousreligiousdenominations .
TheCarnation(Dianthuscaryophyllum)asaperfumeisthe
aromaticassociatedtothisPath.Itsmagicaleffectinritual
isan aidtoraiseonespiritualaspirationsandtoseekout
higherpowerstobeguidedby(ifthefloweriswhite) .

the
otherhandiftheflowerisredittendsto
vera)andisnottoconfusedwithAloe
agallocha)whichhasbeenusedasaromatic
makethings larger
thanlifeandproduceagreaterawarenessaroundone.Thearoma
ofthewhiteCarnationisidealforanytypeofinvocationwork
andissaidtobeagoodbalancerinanymagicalceremonyand
helpstokeeponesperspective.
One of theplantsassociatedtothisPathisthe Aloe (Aloe
thewood(Aquilaria
sincebiblicaltimes.
I
I
I
I
Itsmagicaleffectsarevariedbutaretoacertainextentvery
clearly.
'beingdrenched'whichwhen
TheArchangelhereisZuriel(Zuryal=254)whichmeans
L31/pg9
much likethoseofGarlic .Itsmostfundamentaltaskistoclear
theairofanynegativevibrationsandtokeepawaysicknessand
promotegood'health .Theplantissaidtohavethecharacteris-
ticsofretainingthe"statusquo"inahouseholdbydraining
awayallthebadvirbrationsandharmonisingallthingsaround
it .
TheHarpiesarethelegendaryorderofbeingsofthisPath
andaresaidtobethedaughtersofthesea(Neptune) .Theyare
regardedasbeingswhohavethedualityofbothpositiveand
negativeaspectstotheirnatures .Ononehandtheyhelpthe
oppressed and on the other they are merciless with thosewho have

I
wrongedothers.Theyarethebalancersoftheelementalworldsin
aneffortto try andhelpthefatesofmenastheyworkouttheir
destinies.
my
rockisgd". LegendhasalsoassociatedthisArchangelasa
curerofstupiditybymakingmanseehisspirituallessonsmore
ThenameZurielisfromtherootZUwhichrelatesback
itsArabicmeaningof"shininglight" .TherootRYmeans
addedtothepreviousrootrelatesto
beingdrenchedinashinnglight .

Bygematria,othermeanings
such as NDR "avow", RUMCh "Spear" and RUChUM "Merciful"
equatehereandshowsthatZurielisunderanobligation
upholdtheilluminationofman(theshininglight)with martial
aggressiveness (thespear)temperedwithmercy .
also
I
I
I
I
The animal of thisPath is the spider and its power is its
beautiful web. Thoughthereisastronglunarassociationtothe
spiderthelinktothisPathisthroughitsassociationtothe
greatmothersymbolwhoweavesthedestinyoftheworldandas
suchislinkedtothefates .Theperfectionofthewebshowsthe
interactionofthestickykarmicpatternsofmenwitheachother.
ASSOCIATIONS
YETZIRATICTEXT:

FAITHFULINTELLIGENCE
HEBREWLETTER:

LAMED
TAROT:

JUSTICE
.EGYPTIANDIETY:

MAAT
GREEKDIETY:

THEMIS
ROMANDIETY:

FATES
SIGN:
MAGICALWEAPON:
VIRTUE:
VICE:
MAGICALPOWER :
MINERALDRUG :
VEGETABLEDRUG:
INDIANASSOCIATION:
GEMSTONE:
PLANT:
AROMATIC:
ORDEROFBEINGS:
ANGEL - ARCH:
L31/pg
LIBRA
SCALESOFJUSTICE
REBIRTH
SUPERFICIALITY
BALANCE
NATURUMPHOSPHATE
APPLE,PARSLEY,CUCUMBER
YAMA
CARNELIAN
ALOE(VERA)
CARNATION
HARPIES
ZURIEL
ANIMAL:

SPIDER
L31/pg10
9
1
11
I
I
I
LESSON32
TWENTY-THI RDPATH
'Thetwenty-thirdPathistheStableI ntelligenceandisso
calledbecauseithasthevirtueofconsistencyamongallnumera-
tions. '
Thetwenty-thirdPath lies betweentheGeburah. andHodand
iscalled'StableI ntelligence'
. Theentireconcepthereisone
ofconsistency . ThetwosephiroththatbalancethisPathgive
risetoatypeofpunishment(fromGeburah)orrestrictionwhile
thelowersephiratellsofsplendour . Since Geburah isthefirst
ofthetwosephiroth,therestrictionorpunishmentmust
imposedfirsttoformthesplendouranditisthroughthisthat
thestabilityisformed . 'Nopainnogain',isamodernexpres-
sionthatappliesquitewellhereandremindsusthatnodevelop-
mentcanoccurwithoutbirthandgrowingpains .
MemistheletterofthisPathandhasanumericalvalueof
40 . OtherwordsofthesamevalueareGZLmeaning'totakeaway
byviolence',ChBL'tobindorconnect',YL'cryout',LAT'to
hideorcover'andLTA'keepclosetotheground' . Allofthese
reinforcetheharshaspectofMemsnatureandshowsthemerging
ofthehigherforcesintothelower . Asaword,Memhasavalue
of90andequatestowordssuchasPYmeaning'mouthofawellor
entrance'andSLmeaning'raise orexalt' . Thisrelates togoing
intoanopeningandbeingraiseduporexalted(inspirit)
.
L32/pg1
shows creativity and productivity .
that of thepassivefemininestateofbeing . Whenitisplaced
atthebeginningofaworditshowsapliablestatewhileatthe
enditbecomesacollectivesignwhichuniteswiththeabstract
essencesftheword . I tcanbedescribedasanexpressive
articleinwhichthenamesormovementofanactionismerelyan
instrumentwhichisdividedinessence .
TheTarotcardassociatedtothisPathistheHangedMan,
whichis a complexform . I tdepictsamaninarockycoveorcave
suspendedbyhisfeetwithhisheadinatriangle. Themost
obviousconceptatfirstglanceisthatthe
goinghardtimesandpossiblyevensomeformofpunishment . The
trianglearoundhisheadhowevershowsusthatheisbeing
immersedinasituationatypeofbaptism,whichresults in a
unionofbothlowerandhigherforces . CarlJungstatedthatthe
purposeofpainistomakemanmoreawareofhimselfandthisis
asituationthatfitsthiscard . Themanundergoesa
illuminationthroughordealandassuchtheoldconceptsof
psychearelostandanewreconstructedindividualemergesfrom
theseaofchaos .
TheEgyptiangoddessofthisPathisHeqetwho

usually
depicted withafrog'sheadandislinked
L'/pg
de O'livet considers that Mem as a consonant relates to
nasal sound.

a symbol it depicts that of the mother which


I tsgrammmaticalinfluenceis
individualisunder-
type
the
tobothdeathand
birth . Legendhasitthatshe(alongwithShu)werebornfrom,the
I
I
I
I
I
I
I
I
L2//g
mouthofRa
. Alsoshewasassociatedwiththemidwifeasshewas
presentatthebirthofthecreation . Heqetwasinfactagoddess
oftransitionandislookedontoeasethetransformationfrom
onestateofexistencetoanother(suchasindeathandrebirth) .
ThoughsheissometimesassociatedtoHathorHeqet,sheis
goddessinherownrightasafertilitydiety.
PoseidonistheGreekdietyassociatedtothisPathandis
the godoftheseaaswellaslakesandrivers . One particular
aspect

Poseidon'sadventuresapplieshereandthatisthe
battlehehadwiththegiantPolybutes(whomPoseidon
cliffat)thusdrowninghimintheoceanofftheislet
Nisyros. ThisaspectofPoseidon'sexploitsisshowninthetarot
cardthe'HangedMan'whoisinfactPolybutessubmergedinthe
theinletinwhichPoseidoncarvedouthisdoom . AnotherGreek
associationhereisthegodOceanus .
NeptuneistheRomangodlinkedhere . Hewasthesonof
SaturnandOpsandbrotherofJuno,PlatoandJupiter . His
usually shown ina chariot of shells drawn by dolphins or horses .
OneofthemagicalweaponsofthisPathisthecross
suffering. Though linked to the crucifixion, when used in the
termsoftheR . R . etA. C,inesotericterminologyitrelatestoan
aspectofthe5=6gradeceremonywhenthepostulantisliterally
boundtoacrossandmadetotaketheobligation . Duringthis
partoftheceremonythesecondAdeptsays(whileholdingthe
rosecrossoutinfrontofhim) ;
hurleda
L32/pg 4
strength . wherefore 'The symbol of suffering is the symbol of
boundd as thou art, strive to raise this holy symbol inthy hands,

'
for he that will notstrive shall not attain. '
The cup and wine,whicharealsoassociatedhereareacontinua-
tionofthecrossthemeandaretheinstrumentsfromwhichthe
boundpostulantisanointedonthehands,feet,heartandbrow .
ThevirtueofthisPath is spiritualinitiationandisthe
t
pointwhereallsufferingandhardshipstarttomakesenseand
thisrealisationisthefirstphaseofillumination . Thisis
whereunderstandingandappreciationcomeafterstress . I n
moderntermsitiswhereonereachesthebreakingpointthough
hereitsesotericsignificanceis realised forwhatitis,
initiation into thehigherrealms. Spiritualinitiation,like
theeasternconceptofsatorihasmanydifferentlevels .
TheviceofthisPathisestrangement . Hereonehassuffered
so
muchthatallthesufferingisblockedup . Allthelessons
thatonehascomebyarenowkeptfromdaytodayconsciousness
whichefffectivelypreventsamergingofthemindandbodywhich
wouldgiveillumination . Thisisbecausethepresentmodeof
consciousnessfindsitcannotcopewiththedaytodaypressures
andtriestoescapebyblockingthingsout . I tshowsthepsyche
isnotyetundercontrolorreadytoacceptthepresentlessons
onehasbeenlearning
. Theonlywayoutofitistotryand
consciouslycornerthepsychebyfacinguptoreality .
ThemagicalpowersofthisPatharequitevariedandcover
t
L32/pg5
suchsubjectsastalismaticworkandcrystalgazing
. Allofthese
ofcourserelatetotheimpregnationofthelowerforcesbythe
higher . Thisistheabilitytocommandthehigherpowerstocome
andmanifestthemselvesinthisplaneofexistence
. Tobeableto
dothisshowsthattheadeptcancallonhisknowledgeofspiri-
tualhierarchiesandyetstillbeabletocontrolanddirectthem
intoperformingadesiredtask
.
Amineraldrugassociatedhereispotassiumwhichaffects
thebodybytakingawayitswasteproducts . Alongwithother
elementsithelpsregulatethewatercontrolinthebody
. Funda-
mentallypotassiumisdiureticthatpurifiesthebody's
internalmechanism. Anytypeofmentalorphysicalstressdraws
heavilyonthebody'ssupplyofthismineralsoitisimportant
toregulateitsintakethroughliver,fruitandvegetables
.
ThevegetabledrugofthisPathisatinctureofArtemisa
(Artemisiadracunculus)orTarragonasitissometimescalled
.
Aninfusionofthisdrugissaidtoinducepsychicdreamsaswell
ashavingbothculinaryandmedicinalvalues
. Asanoilitis
usedintalismaticritualstoactasacatalystinbringingthe
higherforcesthroughtoimpregnatethetalisman
. Alsoiftaken
e
internally(asanoil)itproducesarelaxingeffectandallows
thehigherforcestoactthroughonesaurausingmuchthesame
techniqueasamediumdoes .
ThetattwaappliedtothisPathiscalledApaswhichrelates
tothewaterelementandisdepictedbya
silvercrescent . By
L'. 2/pg b
direction it is a downward movementwith the keyword to describe
its function being 'contraction' . I t relates to any type of
liquid formation and represents the sense of taste with the
tongue being the body organ that it is most related to.
The I ndian diety associated here is Sarasvati, who was
originally a goddess of the rivers and waters but later grew to a
diety who represents wisdom and music . As a form she. i s usually
shown as a beautiful woman
on a lotus .
withfourarmsandisgenerallyseated
ThegemstoneothisPathistheBerylorAquamarine
.
Legendhasitthatanyonewhowearsberylisunable
defeatedinbattle,andhashisintellectual_capacityexpanded
.
Other attributions
associatedtoitare,thatitcankeep
marriedcoupletogetherbybeingabletorekindlelostorwaining
love; Andreas,BishopofCeasareainthe5thcenturywrotethe
followingonthisstone :
'TheBeryl,imitatingthecoloursofthesea
andofair,andnot
unlikejacinth,seems
suggesttheadmirableThomas(St .
Thomas),especiallyashemadealongjourneybysea,andeven
reachedtheI ndies,wassentbyGodtopreachsalvationtothe
peoplesofthatregion . '
TheBerylalsogainedsomefameasashewstoneinwhichsome
couldmakeimagesappear .
I nthistypeofclairvoyantworkit
remainsasyetunsurpassed .
OneoftheplantsassociatedhereisWatercress(Nasturtium
I
I
I
I
I
t
I
I
high content of manganese in it which is used
purifier. Another plant that can classedhere is that kelp
which is found in the ocean and is used as a type of cleanser for
thebodyasithasahighiodinecontent,itworksmainlyonthe
thyroidandisanidealbodytoner .
WillowasanaromaticappliestothisPath . An - incensecan
bemadeupfromtheleaves,bark,orboth
. I tsritualassociation
is to
deathandrebirthbutalsoitisusedforlove,attraction
andfordivinationandprotection
. Willowincensehasoftenbeen
usedbymanycivilisationsinfertilityrites . Also ithasbeen
usedbyanumberofsageswhousetheshewstone(crystalball)
andissaidtohelppreventillusionaswellasobsession .
AnotheraromaticthatcanbeusedhereisVerbena,whichis
widelyusedasanenchantingaromaticandisoftenwornbya
womanwhowishestoattracttheattentions aparticular
individual .
Theorderofbeingsassociatedherearethevarieties
waterspiritssuchastheNymphs,UndinesandNereids
. TheNymphs
generallycomeunderthewaterspiritswhoresidenotonlyinthe
seabutinanyformofstreamorriver . Thoughthereareboth
maleandfemaleUndinestheyhavemainlybeendepictedbymenas
femaleswhowereyoungandbeautiful . Offeringsbyancientcul-
turestothemincludedmilk,honeyandoil .

TheNereidswere
mainlyassociatedtotheoceanandweresaidtobethedaughters
ofDorisandNereusandhadthepowertocalmroughseas,all
as
L32/pg7
officinale) which is usually found in streams and usually has a
a blood
TheDemonicKingofWateriscalledAritonwhoalsogoesbythe
nameofEgin(fromtheHebrewrootOGN"delay"or"hinder")which
issaidtobefromtheHebrewrootORH"tobearoneself"or"be
naked" . Mathersconsideredthatitmayhavebeentakenfromthe
GreekwordArhretonmeaning"secretor"mysterious"
L32/pgS
were under thewillofNeptunewhocommandedthemtoattendthe
needsoftheocean . Sailorsoftenofferedsacrificestothemfor
safeandprosperousvoyages.
TheSupremeElementalKing

thisworldis

called
ThahebyobeaatanwhiletheElementKingofthespirits isNiksa.
withan
emphasisonthenegativeaspect . TheGreekrootAix"goat"also
maybeapossibleoriginforthisword . Aritonhas22servants
underhim.
TheArchangelrelatedtothisPathisMichaelwhoisasso-
ciatedtothecardinalpointofthewest . Michaelisofcourse
thearchangelofbothwaterandoftheSephirothofHod . The
chiefrulerofwaterisinfactTharsis(ThRShI S=97n),this
relatestotherwordsofthesamevaluesuchasMLTzmeaning
'smoothness andslipperiness"andRAaNmeaning"flourishing
whichshowadistinctrelationshiptowater . TherootThRmeans
"turnaround"or"circulararrangements"whileShI whichmeans
"tribute, justice" . ThesecollectivelyshowthatTharsisrelates
t

wateryformthatnourishes(inthesenseof

giftor
tribute) . TheangelofthisPathisTaliahadwhilethe Cardinal
Directionthatwater represents intheWestandisknownbythe
HebrewnameofMaim.
I
I
I
I
I
L32/pg9
TheHoly River associated to this Path is Gihon : 'And the
name of the second River is gihon; the same is it that
thewholelandofCush(Ethiopia) .
compasseth
TheWhaleisamammalassociatedtothisPathandingeneral
relatestoanythingswallowed,

absorbedorconcealed . The
biblicalstoryofJonahandtheWhaleisagoodexampleofthis .
I moderntimeshowevertheWhalehasdevelopedawholenewset
ofsymbolsandrelatestothemergingofthehigherandlower
forceswhichalsohintsatresurrection,rebirthandregenera-
tion
. I talsorelatestothesoulincarnatepassingthroughits
karmicsufferings.
YETZI RATI CTEXT :
HEBREWLETTER :
TAROT:
EGYPTI ANDI ETY:
GREEKDI ETY :
ROMANDI ETY :
ELEMENT :
PLANET :
MAGI CALWEAPON :
VI RTUE:
VI CE:
MAGI CALPOWER :
MI NERALDRUG :
VEGETABLEDRUG :
TATTWA:
I NDI ANASSOCI ATI ON:
GEMSTONE:
PLANT:
AROMATI C:
ORDEROFBEI NGS:
ANGEL - ARCH:
ANI MAL%
CARDI NALPOI NT
ELEMENTALRULER:
DEMONI CPRI NCE
A_S_9O -CI-~T-10S-
L32/pg
10
STABLEI NTELLI GENCE
MEM
HANGEDMAN
HEQET
POSEI DON
NEPTUNE
WATER
NEPTUNE
CROSSOFSUFFERI NG,CUP&WI NE
SPI RI TUALI NI TI ATI ON
ESTRANGEMENT
TALI SMANI CWORK,CRYSTALGAZI NG,
ETC
POTASSI UM
TI NCTUREOFARTEMI SA(TARRAGON)
APAS
SARASVATI
BERYL,AQUAMARI NE
WATERCRESS,KELP
WI LLOW,VERBENA
WATERSPI RI TS
MI CHAEL
WHALE
WEST(MAI M)
THARI S
AZAEL
I
1
I
I
I
I
I
I
I
I
I
I
I
1
I
LESSON33
TWENTY-FOURTHPATH
'TheTwenty-fourthPathistheI maginativeI ntelligenceand
itissocalledbecauseit gives likenesstosimilitudeswhich
arecreatedinlikemannersimilartoitsharmoniouselegancies'
ThistwentyfourthPathconnectsTipharethandNetzachand
is called 'I maginative I ntelligence' because it isthe prototype
forthoseenergiesoflikemannerwho come afterit,forthe
outward formalwaysfollowsthehiddenlaw. Thusfromchaos is
produced harmony,justasabeautifulflowerisproducedfrom
decayingmatter . Thisadequatelydescribestheesotericconcepts
ofdeath . Allthingsthatdieinthisplaneofexistenceare
reallynotdecayedmatterbuttransmutedenergy . Usingthewords
ascribedtoHermesTrismegistos'Whateverisbelowislikethat
whichisabove',onecanconcievethatthespirituallevelin
whichthesoulresidesalsoundergoesatransformationofsorts
duringthephysicaldeath .
TheHebrewletterassociatedtothisPathisNunwhichmeans
fish. Nunhasavalueof50andrelatestootherwords

the
same valuesuchasBMChmeaning"tobehighor
L33/pgI
elevated",MTA
meaning "reach unto" or "come to", TMA "pollute" and k,L "comphre-
hend" . Alloftheseeasilyrelatetodeathandthestateofboth
thesouland . thebodyduringthisperiodofadjustment . Theword
Nun hasa value of 106 and equates to words such as BDQ meaning
L33/pg 2
'breach', DBG meaning 'close to or attained' and OV meaning
'threadorline' . Alloftheseshowvaryingaspectsofthetran-
sitionperiod .
AccordingtodeO'Livet,Nunissymbolicoftheimageofthe
sonof man. TheoriginalHebrewglyphactuallyrepresentedseed
or fruit (Nun is also the verb 'to sprout') and from this its
esotericsignificancehasdevelopedevenfurthersothatinmany
respectsithas hiddenassociationstobothYodandVau . As
grammaticalsignitrelatestobeingbroughtintoexistencewhile
initsfinalformitisaugumentative .
TheTarotcardassociatedhereis'Death'andisamplynamed
asit describesbeautifullythewholeconceptofthisPath's
energies. Thistrumpdepictedaaskeletonbrandishingareaper
and is a typical archetype concept for the "grim reaper", which
toacertainextentislatentinusall . Thescatteredbodyparts
inthecardrelatetothefactthathemakesnodistinctions
betweenkingsandcommoners. Theeagledepictedinthecardshows
thetransmigrationofthesouldepartingfrom
soaringtonewerheightsofexistence .
thebodiesand
TheEgyptianmythrelatedtothisPathisthatofApepiwho
isusuallydepictedasaserpent . I twashewhoattackedI : aand
wasbeaten eachday. Apepiwasinfactasymbolofthedarkest
hourfthenight . ThefighteachdaywithRawastotryand
prevent thesungodfromspreadinghiswarmthandgoodnessover
theland . Sincefawaseverythinggoodandlight,Apepiwas
I
t
t
I
I
I
I
I
I
L33/pg 3
everything dark and vile and was thepersonificationofevil .
OneoftheGreekmythsassociatedtothisPathisthetor-
tureofPrometheusonMountCauscasusbytheeaglesentbyZeus,
aspunishmentforhistheftsandtricksplayeduponthegods . The
legendstatesthattheeaglewouldfeeduponontheliverof
Prometheusbyday,whichwouldthenregenerateandgrowbackto
itsnormalsizeatnight . Thiswholeepisodewastoberepeated
dayafterdayontheTitanwhoneverwaveredinhishateforZeus
andhisdesiretooverthrowhim. Thesufferingwassaidtohave
lastedfor30yearswhenPrometheuswasrescuedbyHeracles(with
theconsentofZeus) .
TheRomanmythofthisPathrelatestoVertumnuswhowas
knownasthe'Changling' .

Hewasanagriculturediety

who
wanted

seducePomanabutinordertosurpriseherhehadto
becomedifferentforms,fromalabourertoanoldwoman
.

The
transformationsthatVertumnusunderwentisthemainpoint
considerationhereasitshowsvictoryorattainmentafter
successionofchanges
. Vertumnusisusuallyshownasayoungman
crownedwithflowersandcovereduptothewaist,holdingfruit
inhisrighthandandthehornofplentyinhisleft
.
ThoseindividualsbornundertheSunsign
thisPath,
Scorpio,arewhatonewouldcallnaturesinvestigators
. Theyare
individualswhodothingsataverydeeplevelandassuch
have
very strongintellectualtraits
. Becauseofthisdepthoffeeling
theydothingsinextremes.

Theyhaveastrongsenseofemotion
Akrabmeaning"conflict" .

I nArabicitis
"woundingtheonewhocomes"andinCopticicalledI sidis
"oppressionorattack"
. Thereareover45starsinthis
constellationwiththebrightestbeingCorScorpii(heartofthe
scorpion)whichissometimescalledAntares"ThewoundThestar
inthetipofthetailiscalledLesath"theperverted"
. Ptolemy
saysthatthebrightstarsinfrontofthebodyofScorpiohave
aneffectsimilartothatofMars,andalsoSaturn(inpart) . The
threestarsinthebodyoftheScorpionhavemuchthesameeffect
asMarsandalittlelikeJupiter . Thoseinthesectionsofthe
tailarelikeSaturnandasmall'influenceofVenus . Thoseinthe
stingofthetailarelikeMercuryandMars .
ThemagicalweaponofthisPathisthepainoftheoathor
obligation . HereoneisboundtoonesHigherGeniuswiththe
lantafirmcommitment . Thiscommitment
L'_' '_ .
/p g
4
andrarely forgiveanilldone to them; ifanopportunityarrives
they will
tryandseekrevengeandpaybacktheilldonetothem
multifold . OnthewholeScorpionsaresecretivebutimaginative
individualswhocanbequicktemperedifputtothetest .
TheconstellationofScorpio(Scorpion)inHebrewiscalled
calledAlAkrab
conceptbeingthatiftheoathisbrokenthehighergenius will
punishtheindividualconcernedinitsownway. Theobligationof
the5=6ritualoftheAdeptusminorgradeoftheR . R . etA . C.
(whichiswhatisreferredtohere)literallybreaksthroughthe
variouslayersofthekabbalisticsoulandanchors in thepostu-
alsosuppliesavital
linkwiththedeepestaspectsofthehigherself,whichisused
I
I
I
I
I
I
I
I
I
I
I
ThevirtueofthisPathistransformation . Hereindividuals
areliterallytransformedintoahigher echelon . This typeof
transformationisinfactafundamentalurgetomergeandcommu-
nicateonlevelsotherthan themundane . Thespiritualvalue
lyingdeepwithinusallmakesusslowlytransformtoahigher
codeofethicsandideals,andgraduallymergeintothearea
Jungianscallthe'collectiveunconscious' . Heredirectionsand
guidanceisseen andfeltasaunifiedformorpatternworking to
a groupplan . I tisinthisareainthebuildingofnewideas
andstructuresthatisbasedon,'intouchawareness',whichcan
only bebased ononespersonal experiences .
Theviceof thisPathisintroversion. Whilethevirtue
thePathopenstheindividualuptoawholenewlevelofexper-
iencetheviceobstructsthisbyfocusingandnarrowingthescope
oftheindividual . Onethenbecomesawareofhisownfarseeing
experiencesintermsoflust,controlandpower, all ofwhich
stemfromintroversionofthisPath's energies .
people notonlycausemiseryforothersbut

irrepairable
damagetotheirownkarmicexistence . - They getintoa
ofactionandthoughtfromwhichthereisvirtually no escape.
ThemagicalattainmentofthisPathis
ability

raise andconversewithaspirit

adesceased
L33/pg5
as a life line or beacon for the lower self to climb and merge
with its upper counterpart for thehigherinthelower(andvice
versa)andmustbeacknowledgedduetotheobligation.
Assuchthese
whirlpool
necromancy,the
control . This is notaveryappealingmagicalpowerbutit
stillapowerneverthelessandassuchmustbetreatedwith
certainamountofrespect.
Nephesch,Ruach,ChiahandNeshamahofthedeceasedandonce
againunitesthemintoanorganism . I nancienttimesthenecro-
mahcerusuallyobtainedabodypartofthedeceasedandusedit
asakeyorlinktobringbackthedeadbymakingthesoul
retraceitsstepstowardsunification . Thislinking,though,only
appearsinAssiahandcancausehavocforthespiritand
necromancer . Thoughthereisafinelinebetweenthisandevoca-
tion,thereisdefinatelyaline,andthatistheuseofabody
part(usuallyobtainedfromarobbedgraveinancienttimes) .
Evocationusesoneplaneonlywhilenecromancyusesseveralwith
Assiah as itsmanifestationpoint . Thereareanumberofother
pointsofdifferencebetweennecromancyandevocationwhichare
notbepertinenttothislesson .
ThemineraldrugofthisPathisCalciumsulphate(plaster
Paris) . Fundamentallythisisknownasahealingcellsalt
whicheliminateswornoutbloodcellsbywaterextraction . Apart
fromthisCalciumsulphateputsaliningonthestomachandother
organs. Thiscreatesformofprotectionfrom adverse body
acidity. I fthereisalackofthissaltinthebodysystemthis
L3/pg6
person. This is not to be confused with mediumshipwhichis
somewhatpassivestateinwhichthevehicleofthemediumisused
asareceptacleforspiritualenergiestocomethrough . I n
necromancyonedirectsthespirittoperformthedesiredtaskand
that is thedifference,whichcanbesummedupinonekeyword-
a
is
I nnecromancyonecalls,forththe
I
1
I
t
I
I
I
I
I
I
I
I
I
L33/pg 7
causesa disruption in the metabolic processes, resulting among
other things in all types of skin eruptions . Also if there is a
deficiencyofthiscellsaltinthesystemitcancauseimpotency
inmalesandbarrennessinfemales .
Oneofthevegetabledrugsassociatedhereisanextractof
Valerian . Thisisacompositeofalkaloidssuchasvelerineand
chatinewhichhavearejuvenationtypeeffectonthecerebral
z
spinalsystem .
. TheI ndianassociationtothisPathistheKundalini . This
isconsideredbysomeastheultimateforceinthehumanbodyand
hasbeencalledthe"serpentpower",atermcoinedbySirJohn
Woodroffe. Kundaliniwasinfactshownasadietyaswellas
vastterrifyingpowerwithintheselfwhichcanberaised to
travelthroughthevariouschakracenters,thusunblockingand
modifyingeachtoworkinharmonywitheachothersothatillumi-
nationoccurs
. Raisingthekundalineupthroughthespinalcolumn
canbeaterrifyingexperienceforanindividualwhether or
sheispreparedforitornot,andduringthistransitionperiod
itcancausealotofpsychicandphysicalillnesses . Oncethere
isunionwiththelotuschakrathekundalinethenreturnstoits
residenceinthebaseofthespine,butithasleftaclearpath
inthebodyforpotentialgrowthandspiritualdevelopment .
One ofthegemstoneshereisMalachitewhichisderivedfrom
theGreek word . "malackee"meaning"mallow" . I thasasoftgreen
colourthatresemblesthemalachiteplant . Legendhasitthat
intovariouspiecesandthusforewarninghim .
stonewasusuallycutinatriangularshapeandmountedinsilver
andwornasaprotectiveamuletagainstthe'EvilEye' . Thisgem
wasusedextensivelyinMoslemmosques as aformofrepelling
negativeinfluencesandkeepingtheareathatcontaineditpure .
TheCactusplantandflower(Cactusgrandiflorus)isasso-
ciatedherebecauseoftheitswateryinteriorwhichisalife
savingvirtueinthedesert,andforthepoisonousspikeswhich
canhavetheoppositeeffect . Aninfusionoftheplantcanhelp
inkidneyandbladdercomplaintsaswellascardiacconditions .
Generallythemagicalinfluenceofthisplantisaformofpro-
tectionagainsttheftandisoftenplantedaroundthehouse(ina
circle)withthisinmind . I tisafierymasculinesymbolthatis
saidtobeabletowardoffnegativeinfluences .
OpaponaxresinisthearomaticothisPath. Theword
OpaponaxcomesfromtheGreet; meaning"Healingjuice" . This
resinwasusedasahealingincenseforbadcasesofillness . I t
hasnotbeenusedinanymajorculturalritualsasitseffectwas
tocurethesick . I tsmagicalpropertiesissaidtodriveoutthe
evilcausingtheillness .
TheorderofbeingslinkedherearetheLamiaewhichwere
saidtobearaceofmonsters(inAfrica)whoresemblewomenfrom
thewaistupbuthavetheunderbodyofaserpent . Likesirens
L33/pgG
this stoneprotectschildrenatnightfromevilinfluences and
protectsthewearerfromanyapproachingcalamitybybreaking
I n I talythis
t
t
t
I
I
I
p
I
I
I
I
I
I
I
L'3/pg9
they attracted strangers to them with their hypnotic beauty and
the hissing-likesoundtheymade(theydidnothavethepowerof
speech)sothattheycoulddevourtheirprey .

Theywerealso
knownasdevourersofchildrenandweresometimesthoughtto
witches
. Legendstatesthattheyweredescendedfromtheaffair
ofJupiterandLamiaandthechildrenfromthisunionwereborn
deformedduetoJuno'scurseonthem.

Lamiabecameinsaneat
thishorrorandinhergriefdevouredallchildrenwhocameher
I
way.
ThearchangelofthisPathisBarkielwhichisanamethat
hasmanyvariationsbutprimarlymeans"LightningofGod",itis
saidtohavepowerofthiselementandhelpsthosewhoinvokehim
in any gameofchance . Barkiel(BRKYAL=263)relates other
wordsofthesamenumericalvaluesuchasSRSmeaning"breakt
pieces"andSGRmeaning"shutorlockup"
. ThisshowsBarkielis
abletoshatter(likethelightningflash)andshutawaythose
whodispleasehim . TherootBRmeans"topurify"whileBRK(F)
meansto"liedown,restononeknees"whichshowsthegodliness
ofthisangelsnature .
TheScorpionisoneoftheanimalsofthisPathand a
certainextentshowsthedestructionoftheloweraspectsofman
sothatthehighercandevelop
. Therearealsocertainself
destructramificationsinconnectionwiththeScorpion,forit
showsthemortalityoftheoutershellofmanwhichcanbeended
atalmostanytime(shownbythestingintheScorpionstail)
.
ASSOCI ATI ONS
L33/P9 10
t
li
YETZI RATI C TEXT:
HEBREW LETTER:
TAROT:
EGYPTI AN DI ETY:
GREEKDI ETY:
ROMAN DI ETY:
PLANET :
MAGI CAL WEAPON:
VI RTUE :
VI CE:
MAGI CAL POWER :
MI NERAL DRUG :
VEGETABLE DRUG :
I NDI AN ASSOCI ATI ON :
GEMSTONE :
PLANT:
AROMATI C:
ORDER OF BEI NGS:
ANGEL - ARCH:
ANI MAL :
I MAGI NATI VE I NTELLI GENCE
NUN
DEATH
APEPI
PROMETHEUS
VERTUMNUS
SCORPI O
OATH OR OBLI GATI ON
TRANSFORMATI ON
I NTROVERSI ON
NECROMANCY
CALCI UMSULPHATE
VALERI AN
KUNDALI NE
MALACHI TE
CACTUS
OPAPONAX RESI N
LAMI AE
BARKI EL
SCORPI ON
6
I
I
I
I
LESSON34
TWENTY-FI FTHPATH
'Thetwenty-fifthPathistheI ntelligenceofProbationor
L34/pg1
Temptation,andissocalledbecauseitistheprimary
tion,by whichtheCreatortriethallrighteouspersons'
tempta-
ThisPathliesbetweenTipharethandYesodandiscalledthe
'I ntelligenceofProbation'becauseitistheprimarytemptation
bywhichallpeoplearetriedinthislevelofexistence.Here
our :ideasofsensation(inYesod)mustbenowliftedtoseethe
higherspiritualvaluesinTiphareth .Thetemptationandpullof
YesodiseverpresentifwedivertourattentionfromTiphareth,
andtheonlywaytoavoidthepullofthislowerSephirais
simplysetourselveshigheridealsandgoalsandgforthem
withoutdistraction .Ourideasandactionsareinfact"ontrial"
withthefinal'Judgementbeingdeathitself .
eHebrewletterassociatedhereisSamekh(orSamech)and
means "prop" or "support"andhasanumericalvalueof60 .This
relates.to otherwordsofthesamevaluesuchasBNChmeaning
builda . house". ' BChN"triedbyfire"whichrelatestoSagittarius
asafierysign, .YKL"Powerorability" .

ThewordSamekh(SMK)
hasavalueof120, andequateswithotherwordssuchasNAa
meaning"tomove"or"beagitated",KMS"tostoreupthingsof
value",TzL"toshade"orshelter",SS"beingactive

This
entireconceptisoneofafierypursuitordisposition .
L.4 /pg
Samekh when utilisedas a consonant relates to all types,
hissing sounds. I n its primal outline form Samekh is said
representa bow with some emphasis on the sound the released
string makes.

a grammatical sign it relates to any type


circular movement . Like thedrawnbowitwillultimatelyreturn
to its original state when released. Some consider that Samekh is
anaspectofZainthathasturnedbackonitselfandthusbecomes
reinforced .
TheTarotcardTemperenceisthetrumpassociatedhereand
shows an angel standing with onefoot on land and another in the
seawhilepouringliquidfromonejartoanotheras

volcano
explodes in the background This is the distillation or merging
ofthehigherandlowerforcessothatacarefultypeofbalance
canbeattained.I tshowsthatacyclehasbeencompletedand
thenextlevelistobeascended .Mundanemeaningsofthiscard
relatetoco-ordinationandadaptation .
TheEgyptianmythofthisPathisthatofSati, orSatetas
sheissometimescalled.Hernameissaidtohavebeenderived
fromtherootmeaning"toshootorpourout" .
ingabowandarrows
I

earlytimes
Satetwasafertilitygoddessandwasconnectedwiththesprink-
lingofwater(overdryland) .Sometimeswasshedepictedcarry-
(andsometimeswaterpots)andwasalso
consideredadivinityofthehunt .Satetisoftenshownwearing
a crown of bullshornsandassuchisidentifiedwiththe I sis-
Hathorconcept .LegendhasitthatSatetwasthecounterpartof
t
t
1%
1
I
I
I
I
I
Khnemu and sister of Anqet,
southern part of Egypt.
The Greek myth associated here is that of Chiron, chief
the centaurs and son of Saturn and Philytra (when Saturn visited
herin the form of a stallion) .Chiron was possibly the only
noble centaur and as such was said to be the the perfect balance
between man and animal . He was married to Charicles, one of the
watergoddesses. Overall Chiron was a teacher of esoteric skills
that he knew man must have, if he was able, to try and rise above
himself .

Chiron died when he offered to tradehisimmortality


forthelifeofPrometheus.

TheRomangodformrelatedhereis
thatofDianabecauseofherprowessasanarcher .
TheSunsignofthisPathisSagittariusandthoseborn
underthissignaremostlyenergeticpeoplewhotakegreatpride
inwhattheyaccomplish .Thoughtheyareconsideredidealists
theyseemtotakethingsintheirstrideandareextremelyopen
andfrankindiscussingtheirideas.Sagittariuscouldalsobe
consideredthesignoftheextrovertastheseindividualsare
extremelyoutgoinginattitudewithapleasingdisposition .They
arewhatcouldbedescribedas "up frontpeople",whatyouseeis
whatyouget .Sagittariansaregenerallyopenairtypepeople
withaloveofsportsthoughtheytendtobealittleexcessive
intheirpursuits.
Theconstellation

Sagittarius(thearcher)iscalled
KesithinSyriac (which alsomeansarcher) ;inArabicitis
L34/pg
3
and was worshipped mainly in the
L74/pg 4
called Al Klaus "the arrow" and in Greek it is To>sotes "the
archer". There are over 70 stars in this constellation with the
main one beingNaim (Hebrew) meaning "gracious one" which is the
same as the Arabic nameAlNaim.

Thisconstellationisavery
oldoneasfarasrecordedastrologicalhistory goes,though
GreekmythologyrelatestheshapeandnametoChironwhileeven
oldercivilisationsstillrelateittoanarcher . Egypt
SagittariuswascalledPi-Maeremeaning"appearanceofgracious
t
beauty" .Ptolemysaidthatthestarsatthepointofthearrowin
thisconstellationhavemuchthesametypeofinfluenceasVenus
andMars .ThestarsonthebowandgraspinghandarelikeJupiter
andMars.ThoseinthewaistarelikeJupiterandalittleof
MercurywhilethoseinthefeetarelikeJupiterandSaturn .
ThemagicalweaponofthisPathisofcoursethearrowwhich
apartfromitsphallicrepresentationsisoneofpenetrationand
light(ofthehiddenknowledge) .Thearrowinthisinstanceisan
aspectoftheraysofTipharethandtheSunwhichhavebeenable
tobepenetratedbythosewhostayonthePath .I nesotericterms
thearrowisamergingandabalancingofmansforcessothathe
canbeletintothesecretmysterieswithoutdeviatingfromthe
path .I ntheritualofthePortalitstates :'Thereforeby
straightandnarrowPathofSagittariusletthePhilosophus
advancelikeanarrowfromthecenterofQesheth,theBow .'
ThevirtueassociatedtothisPathistoregulateorplace
the
inorder.

I tisherethatmanmustmergethelowerandhigher
aspectsofhisnatureintoasingleunitsothathecan advance
t
I
a
s
t
41
L34/pg 5
towards spiritual
progresstouncoverthenatureandessence of
hisrealself
.I tisaperfectlybalancedconceptofpowerand
directionforitisherethatmanmusttakethisnewfoundunity
andaimit aplacewhereitwilldothemostgood
.The
concept of regulationrelatesasmuchtotheunificationasit
doesforthedirectiononeisabouttake.Althoughjourneysof
thistypeforspiritualgrowthcanbeunconsciousonesandguided
bythespiritthayalsocanbeonesgovernedbyhermeticand
esotericorderswhohavemappedoutclearandsafePathformans
selfattainment .
TheviceofthisPathisPuritanismandisthestatewhere
orderforthewholetranscendstherights

theindividual,
whicharewavered, sothatthemassesareserved .I nesoteric
terms,individualswhoarecorruptedbythisvicefindthatto
k
imposethistypeofideologyplacesothersinsituationswhere
personalfreedomislostandeverythingisdecidedbythestate .
Oneoftheoffshootsofthisviceistsurrender these
forces,whichreducesanygrowthexperiencethatonehashadinto
hardship .I talsoregressesbackintopastexperiencsthatshould
havealreadybeentranscended.
TransmutationisthemagicalexperienceofthisPathand
relatestochange .
tionischangingoneformintoanotherformorsubstance .
Theoxforddictionarystatesthattransmuta-
hermeticterminology,transmutationrelatesstronglyto
thoughitdoesnotmeanitspecifically.I nthisinstance
transmutation is theabilitytotransmuteanaspectoftheself
alchemy
or unconscious
up

homeopathic
L?4/pg d
into a unified force (such as a merging

the
Nephesch and Ruach) so that a higher state of spiritual awareness
can be perceived .
The mineral drug of this Path is Silicea and is

white
powder that is classed as a type of quartz, though it is also
known as Silicis Anhydride, Rock Crystal, Flint and Oxide
Silicon . I t is a powder that has been used
(such as Paracelsus and Glauber) for medicinal
recent years it has beenmuch favoured in Homeopathy. This cell
salt travels throughout thebodyeliminating variouscongested
waste so that better elimination can occur . I ts fundamental job
is to rid the body of unwanted products, which usuallybringsout
thepoisoninthesystemaswellashelpingbonegrowthandteeth
enamel .Siliceaisalsofoundinthebrainandnervoussystem
andisconsideredoneofthebody'srepairmen .
BirchelixirisoneofthevegetabledrugsofthisPathand
ismadefromtheyoungleaves of theBirchtree;fromitismade
by many. alchemists
purposesand in
remedyofAnthroposophicalmedicineforthe
purposesofcorrecteliminationanddistribution

protein .
Betulacortexisanotherassociationhere ;
barkoftheBirchtreeandworkson
tionandactsagainstthedermatoses
itismadefromthe
theprocessofdemineralisa-
ontheskinwhichalsohelps
indiseasessuchassclerosis .TheBirchtreeishailedby
RudolphSteinerasoneofthebestsourcesofbalancingthe
body'sgoodhealthduetothenumerousactionsandinteractions
ofboththebarkandleaf .
t
r
r
t
i
I
r
r
f
I
L1lpcg7
The I ndian association to this Path is that of the Pragapati
who was known as lord of the creatures. He was a diety who was
abstract in form but known to beaunifierofforcesasthe
followingquotefromtheSataBrah',shows :
'SomecallthePragapatitheFatherwiththefivefeetandthe
twelveshapes,thegiverofraininthehighesthalfofthe
heaven:otherssaythatthesageisplacedinthelowerhalfin
thechariotwith seven wheelsandsixspokes .'
Thenumbers,hereofcourserelatetothefiveseasons,twelve
monthsthesevenplanetsandthesixmonths,whichrelateto
theSunpassingovertheequatortoboththesummerandwinter
solstice.

Thisdietyhoweverwasafireorsolardietyasso-
ciatedtoAgniandrelatestodispersingandspiritualgifts
thosewhodeserveit.
Jacinth'isoneofthegemstonesofthisPathandhasbeen
usedsincethebeginningofantiquityasanamuletagainstfever,
plagueandwounds .Thiswasastonemuchsortafterbytravel-
lersaslegendhasitthatanyonewhoworetheJacinthwould
alwaysreceiveacourteousreceptionwherevertheywent .Other
storiesassociated thisstonearethatitaugmentedones
richesandprotectedoneagainstlightning.Amongothers,this
stonewasasymbolofprotectionagainstphantomsandevil
magicalinfluences .Andreas,aBishopofCeasareainthe10th
Centurywrote:'TheJacinth,whichisofacelestialhue,signi-
fiesSimonZelotes,zealousforthegiftsandgraceofChristand
endowedwithacelestialprudence' .Thougharchaicinlanguageit
L
TheEldertree(Sambucuscanadensis)isthetree
L74/pg8
adequatelydescribes thespiritualaspirationsconnectedwith
thisPath .
associated
othisPath .ThenameSambucuscomesfromtheGreek"Sambuke"
whichrelatestoapipe-likeinstrumentwhichisusuallymade
fromthewoodofthistree .Therehasbeenagreatdealofmyth
surroundingthemagicalpropertiesofthisherbwhichissaidto
t
hideaspiritcalledthe'eldermother'whotriestoprotectthe
woodofhertreewhetheritbeapieceoffurnitureoranything
else.Thoughitwasconsideredbadlucktoownanythingmadefrom
Elderwood,thepointthat relates tothisPath(fromamagical
viewpoint)istheconceptofthespiritofprotection(ofthe
Themedicinalqualities(according tree)foritsvariousparts .
legend)attractedthegoddessFreygawhochosetoliveinthe
Eldertree .
andasuseasadiaphoretic .
ThearomaticofthisPathisNutmeg(Myristicafragans),
whichisextremelygoodforpsychicworkandhelpsconcentration
andmemory.I ftheoilisrubbedintothetemplesthearomatic
propertiestakeoveranditproduces mildhallucinogenic
effect .Whereverusedinternallyorexternallythisplantcanbe
extremelytoxicandcareisneeded .
Centaursherehaveadualassociationastheanimalsasso-
ciatedtothisPath(duetotheirspeed)aswellasthelegendary
orderofbeings.

ChirontheCentaurwastheexceptiontothe
Theleavesofthistreearegoodforskindiseases
t
1
t
I
1
t
l
i
I
a
I
I
I
I
I
I
I
r
I
I
I
I
YETZI RATI CTEXT:
HEBREWLETTER :
TAROT:
EGYPTI ANDI ETY:
GREEKDI ETY
ROMANDI ETY :
A_SSOC_I _ATI ONS
L34/pg9
rule regarding the behaviour pattern of Centaurs for they drank
when they could and were famous for their sexual encounters with
human females and wereconsidered nothing but wasters, though
theirphysical prowers as beings of both human and animal natures
gives themassociationhere .Theywereextremistsinwhatthey
didandbearmanyofthehallmarksoftheSagittarian.
TheArchangelofthisPathisAdvakiel(ADVKYAL=72),whois
sometimescalledAdnachiel .TherootADindicates single
powerfullobject .Thenumericalvalueof72relates other
wordssuchasChSDmeaning"abundance"andinanothercontest
"mercy",BCN"in", BSUD"secret" .,ThisshowsthatAdvakielisa
mercifularchangelthatgoesabouthisworkinsecret
.Hisreign
isavastonebuthegivesgiftstothosewhoseekhimoutin
abundance
.Byusingtheosophicalreductionhisnamereducesto9
andrelatestoAZA"makehot"
GAH"increase"andZBmeaning
"gushout"whichareofcoursemorerelativemeaningsofthis
archangelwhenusingthetarottrumpasadescriptivebasis
.
I NTELLI ENCEOFPROBATI ON
SAMEKH
TEMPERANCE
SATI /SATET
CHI RON
DI ANA
MAGI CAL WEAPON:
VI RTUE:
VI CE:
MAGI CAL POWER :
MI NERAL DRUG :
VEGETABLE DRUG :
I NDI AN ASSOCI ATI ON :
GEMSTONE:
PLANT:
AROMATI C:
ANGEL - ARCH:
ANI MAL:
ARROW
REGULATE/PLACE I N ORDER
PURI TANI SM
TRANSMUTATI ON
SI LI CEA
BI RCH ELI XI R
PRAGAPATI
JACI NTH
ELDER TREE
NUTMEG
ADVAKI EL
CENTAUR
L34/pg10
r
i
f
I
f
r
t
r
r
f
LESSON35
TWENTY-SI XTHPATH
'TheTwenty-sixthPathiscalledRenewingI ntelligence,
becausetheHolyGodrenewsbyitallthechangingthingswhich
arerenewedbythecreationoftheworld'
ThisPathliesbetweenTipharethandHodandiscalled
'RenewingorRenovatingI ntelligence'because,byit,theHoly
Spiritrenewsallchangingformswhicharerenewedbythecrea-
tionoftheworld .Takentoanotherlevelitshowsacontinual
changeinthegrowthstructure of theindividual,hisconscious-
ness.Huses.whathecananddiscardswhateverhecannot
utilise
.I nmanywaysthisPathisatestingorprovingground
inseeinghowthemindcancopewiththerapidchanges,yetstill
retainaformalstructure.I tbegins
universalconsciousnessthrough .Tipharethwhichisperceivedand
actedonbythestructurethatgovernstheindividual'sowninner
beliefs.
AyinistheHebrewletterassociatedtothisPathandmeans
eye.I thasanumericalvalueof70andrelatestootherwords
ofthesamevaluesuchasMLmeaning"pluckoff",SChB "pull by
force"andKNmeaning"honest" .Theserootmeaningsrelate
heavilytothebiblicalaspectsassociatedwiththeeye,suchas
if ithasseensomethingitshouldnothaveandistobeplucked
out .Onadeeperlevelthisshowsorrelatestotheall-seeing
L35/pgi
toemanateastream
eye that onecannothideonesactionsfrom.
.value

130andrelatestosuchwordsasKPL"t

doubleor
repeat",
tobotheyesandtheirfunction .
Accordingtothose like deOlivet,Ayinrepresentsby its
vocalcharacteristics theinnerearofamanandassuchrepre-
sentsthestateoftheconfusedordullandsoundswithout
harmony.consonantitrepresentsthebodycavity of the
upper chest .TheZoharstates:'TotheletterAyin,theinitial
wordAvon,thoughitisclaimedtheoriginofAnayana,theHoly
onesaid:'I shallnotcreatetheworldbythee'andforthwith
Ayindeparted.ByassociatingAvon(roughlytranslatedasan
evilact)toAyinitrelatesitveryheavilytoevilmanifesta-
tions.
TheTarotTrumprelatedtothisPathisthe"Devil ."and
shows a wingedgoatheadedsatyrlikedemonwhoselegsarehairy
andwhohasclawsforfeet .I nhislefthandheholdsadownward
eachsideofit .Theentireconceptistoshow
onearchetype.I t
spiritual forces
it .Whateverone
cannotbeignored.
L=am/pct 21
ThewordAyinhasa
andSML"imageoridol of worship"whichclearlyrelate
pointingtorchwhileinhisrightanelevatedhornof water .
i s perchedonanaltarwithamaleandfemale(demon)chained
ustheevil
He
negativesideoftheastralforcescollectivelygatheredunder
isverymuchthelustforthematerialoverthe
of lifewithastrongsexualthemeattached
attachestothiscarditisstillaforcewhich
or
t
t
r
r
r
s
f
r
11
I
r
L'5 /pry
Set (whose
namemeans"below")isoneoftheEgyptianasso-
ciationstoothisPath
.Thisgodisoftenshownasacamelshead
withlargeearsandaforkedtail
.HewasthesonofSebandNut
andthehusbandofNephthysandwasconsideredthearchetype
evilitselfandrepresentedthenegativeforcesofnature
.
reignnotonlyextendedtolandbuttowateraswellandanyarea
thatrejectedlight
.ThoughhewasthegodoftheunderworldSet
alsohad
kingdomintheheavenswhichwastypifiedasthe
constellationknownofinmoderntimesasthe'GreatBear'and
wasassociatedwiththeelementalforcesofcold,dampandmist
.
Pan(meaning"all"or"everything")istheGreekdiety
thisPath
.HewasthesonofHermesandPenelopeandresidedin
thewoodedareaofArcadia .

Legendhasitthathehadtwosmall
hornsonhisheadwitharuddycomplexion
His
templenamedafterhiminPalatinewheregoatswere
andthelowerbodyofa
goat
.Hewasontheoddoccasionabletochangehisformandin
onefamousincidentmanagedtoseduceSelenebyassumingtheform
ofawhitegoatanddrewherintotheforest .Panwasstrongly
associatedwiththeartofseductionbutonitsmorelustfulside
thanthatofanyoftheothergodsorgoddesses.I tissaidthat
whenheplayedonhisflutehecouldcaptivatetheheartofany
woman.
TheRomangodofthisPathisthatofFaunuswhowasknown
aschiefofthesatyrs .HewasthesonofPicusandCanenteand
wasalsoafertilitygod .HisothernamewasLupercusandhad
sacrificed .
AnotherassociationwhoisequallyathomeonthisPathis the
and Semele .
subjects
L35/pg4
RomanversionofBacchus(asthegodofwine),thesonofJupiter_
Pacchuswasoftenshownasayoungmanwithacrown
vineleaveswithathyrsusinhishand .Thoughmanyofhis
exploitsarenothingtodowiththisPathhisreligionofdrunken
orgiesdoeslinkhimwithFaunusandmasculinitywithdistinct
sexualovertones .
TheSunsignrelatedhereisthatofCapricorn .Thoseborn
underthissignareemotionallyimmatureandoftenshowit
beinganintrovert.Theyareforeverinthoughtandnever
anythingbeforethinkingaboutitfirst .Theycanbetimidpeople
whooftenbroodifthingsdonotgotheirwayyetwillmakeno
directattemptto alterthesituation . Asaresultofthisintro-
versiontheirentireresourcesaretunedintothemental
approachwhichistheirrealsourceofpower .Capricornianshave
powerfulconcentrationwhichcanbeusefulwhenturnedto
by
likeeconomics,inwhichtheyseemtohave

natural
affinity.Onthenegativesidetheycanbethe very voiceofdoom
itselfandaresaidtobefatalisticinattitude .
I ntheearlyzodiacsofEgyptthissignwasshowntohavea
goatsbodyandafishtailandwascalledHupenius'placeof
sacrifice' .TheHebrewnameforthissignisGediwhichmeans
thekid(orcutoff)whileitsname in ArabicisAlGediwith
virtually thesamemeaning.Thereareoverfiftystarsinthis
constellationsuchasDenebAlGedi'thesacrificecomes',Al
Debik'thesacrificeslain' .SaadalNaschira'recordofcutting
off'andMaasad'theslaying' .

Ptolemyobservesthatthestars
r
1
1
1
r
i
t
t
1
e
I
LTS/pg
in the hornsofthegoatarelikeVenusandalittlelikethatof
Mars.ThestarsinthemoutharelikeSaturnwith small
Venusianinfluence.Thosestarsinthefeetandbellyarelike
MarsandMercurywhile
Jupiter .
thoseinthetailactlikeSaturn
ThemagicalweaponofthisPathistousesexualenergyand
itsconversionforpracticalmagicaluse .I nI ndianyogathis
referredtothemanipulationoftheTantricprinciplewhilein
ChinaitwascalledTaoism.I nthewestthesexualactitself
andthetremendousauricpoweritgenerateswasutilisedfor
practicalends.Sexualenergyhoweverdoesnothavetospecifi-
callygeneratefromthesexactitselfbutcanbeharnessed(as
theTaoistshaveshown)andconvertedbackintothebodysystem
sothatadditionalpsychicpowercan generated,butit
requiressupremedisciplinetobeabletodoit .
ThevirtueofthisPathisassimilationandisthejumpoff
pointwheremanleavestheselfalonetoseekanothersourceor
centerofhispowerorpurposeoflife .I ntheinitialstagesof
thisPathheputstogetherhisstructureinawaythath

sees
that
gazewasstillontheself .Withcontactfromotherlevels
existencethesebordershavenownarrowedandherealisesthathe
must venture into this other area, but not only this for he must
discoverthecoreessenceofitandactaccordinglyforthe
largerplan.I nthelatterstageofthePaththeinformationhe
and
hisfarflungboundariesnowcanbeconfinesbecausehis
receivesmustbeassimilatedandthisisthe'pointdepart'into
the next level of spiritual growth .
The vice of thisPath is collectivisingenergywhichdiffers
fromassimilationonlyinitsuse .Whiletheformerworkedtoa
grand-plantheviceworksonanegoexpansionandignoresthe
purposeofthegreaterplanandcenterscompletelyonthe
Thisstilldoesnotignorethethegreaterplan,
steppingstoneoraglorification
seenofteningovernmenttoday .
Themagicalpowerassociatedhereisthepowerofthecurse
anditseffect .Thecurseisofcoursenotanegativeconceptbut
somethingthathaspolaritiesthoughitisdescribedinthe
WebstersDictionaryasatoolofevilintentbutonecaninfact
becursedwithbenefittinggiftsaswell .Theconcepthereis
thatanindividualcanaltercertainelementalandplanetary
aspectsandbendthemtosuithisorherownpurposes.Cursescan
infactbebrokendownintothefollowingcatergories:(1)using
thenameofaspirittoimplementtheprocedure;(2)usingones
ownpower .
ThemineraldrugisCalciumPhosphatewhichworks
vehicle,whichis
L'5/pg6
self .
butfocuseson
howtheindividualcanachievegreaterpowerby
itwithlittleregardtotheplanitselfotherthanthatof

I
participatingin
something
onthe
bonesofthebodyandsuppliesatypeofbonestrengtheneritis

'
commonlyreferredtoasthelimestoneoftheskeletalsystem.
Deficiencyinthiscellsaltcausesbonediseasessuchasrickets
andtoothdecaybutwhentakenitactsquicklyin helpingthe
r
I
I
I
I
I
food from being digested correctly and plays havoc
gastricjuices .
The vegetabledrugassociatedhereisatincture

Black
Cohosh(Cimicifugaracenosa)whichhasranunculin,
acid,tanninandresinamongitspropertiesandworksonhelping
toeasearthritisandrheumaticcomplaintsaswellaspreventing
crampsandhelpingtobalancethebodiessexhormones .
Thereareanumberofgemstonesassociated
L75/pg7
rebuilding of bloodcorpuscles. A lack of this salt also prevents
withthe
salicylic
thisPath
whichcanoverlapwithotherpaths.SomeoftheseareWhiteOnyx,
Moonstone,Jet,Sapphire,RubyandtheBlackDiamond .Somehave
consideredthatallstonesthatareblackincolouringbeapplied
here,whileothershaveconsideredallstonesthatbringbadluck
shouldberelatedtothisPathwhichofcoursecutsacrossother
associations.I fagemstonehadtosingledoutthathadallthese
characteristicsitwouldbetheBlackOpal .Thesebecamecommonly
minedinAustraliaandwereconsideredbadluck,soaBlackOpal,
thoughveryvaluablewastheconsideredtheworstpossiblestone
towear .ThissuperstitioncomesfromancientAboriginallegends
thatfilteredthroughtothosewhominedthestonelateinthe
lastcenturyandfoundtheirwaytotheoutsideworld .
TheplantsassociatedtothisPatharetheThornand
Thistle.ThebiblesaysinGeniii :'Thornsalsoandthistles
shallit(ground)bringforthtothee ;and thoushalteatthe
herb in the field' . This passage relates these two plants to both
They acknowledged
LAS/pgB
sufferingandsorrow.TheThistlehaslongbeenasymbol
vindictivenessandsufferingwhiletheThornrelatesheavily
Christssufferingwhencrownedwiththorns .TheThorn also
relatestotheRoseandguardsitagainstbeingpicked .I n
esoterictermsitisthesufferingoneundertakesbeforeachiev-
ingunionwithintheself .
Pine is the aromatic used on this Path as both anincense
andanoil .Asanincenseitismainlyusedtoaccumulate
materialpossessionswhilethepineneedleswereusedinpurifi-
cationandfertilityrituals(ofCelticorigin) .Thepinecones
were often burnt in houses to make the female pregnant and the
malemorefertile.Thepineoilhasmanyattributesrelated
fromprotectionagainstmagictobeingabletoattract member
oftheoppositesexwithonesvirility(throughbodyscent) .Also
pineneedleshavebeenusedinexorcism.
Thelegendaryorderofbeingsassociatedhere-arethe
satyrs,fauns,panesorsylvani .Theywerebeingswithanupper
bodylikementhoughcoveredwiththickblackhair,andhadtwo
hornsprotrudingfromtheirheadsandthelowerbodyofagoat .
Bacchusastheirchiefandattendedallhis
orgies.They notedasseducersofwomenanddespitetheir
extremeuglinesstheybecometheinspirationofdesireinany
womanmakinghercompletelyletgoofhersexuality .I tissaid
thatonewasactuallycapturedwhileasleepinacaveandwas
broughtttheRomangeneralSylla,whowasamazedthatit
closelyresembledtheabovedesribedcreaturesowelldocumented
I
I
I
I
I
I
I
I
I
by poets and painters alike .
The Archangel associated to thisPath is Hanael (HNAL=e6)
who also presidesovertheSephirahofHod .TheHebrew root HN
relatestoapainfulactexpressedthoughmeditation .I tlinks
withtheconceptofrelenting,clemencyandpity .
relates,throughitsArabicorigins,totheideaofbeingapart
andfixedinadefensivestanceagainsttheunexpected .Theroot
MUSmeans"Cup"(whichhasanumericalvalueof86)andpresents
theideaofmercyandprayer .
ThegoatandtheassaretwooftheanimalsofthisPath .
TheassinChristianterminologyrepresentstheanimalwho
carriedChristtosafetyinEgyptandalsocarriedhimon
triumphantentryintoJerusalem .I ntheEgyptian-Greekcultureit
waslinkedtoTyphon .I nfacttheassalongwiththegoathavea
dualsetofsymbolismassociatedtothemdependingentirely
thetimeandplace .Boththeseanimalshavealsobeenused
witchessabbathsinamannerthatwouldhaveraisedtheeyebrow
ofmany

ChristianorJew.Todaytherehasbeen
L35/pg9
Alsoit
his
on
distinct
leaningtowardsconsideringthegoatasymbolofevilandtheass
'

asitspositivecounterpartintheforcesoflight .
YETZI RATI C TEXT:
HEBREW LETTER
TAROT:
EGYPTI AN DI ETY:
GREEKDI ETY :
ROMANDI ETY:
SI GN:
MAGI CALWEAPON:
VI RTUE:
VI CE:
MAGI CALPOWER :
MI NERALDRUG :
VEGETABLEDRUG :
GEMSTONE:
PLANT:
AROMATI C:
ORDEROFBEI NGS :
ANGEL -ARCH:
ANI MAL:
LAS:pg10
ASSOCI ATI ONS
RENEWI NGORRENOVATI NGI NTELLI GENCE
AYI N
DEVI L
SET
PAN
FAUNUS
CAPRI CORN
SEXUALENERGY
ASSI MI LATI ON
COLLECTI VI SI NGENERGY
CURSE
CALCI UMPHOSPHATE
BLACKCOHOSH
BLACK OPAL
THORNANDTHI STLE
PI NE
SATYRS,FAUNS,PANESDRSYLVANI
HANAEL
GOATANDASS
i
I
1
1
mental andphysical
"union"
LESSON36
TWENTY-SEVENTHPATH
twenty-seventhPathistheActiveorExciting
Intelligenceanditissocalledbecausethroughitevery
existentbeingreceivesitsspiritandmotion . '
ThisPathjoinsNetzachandHodand calledExciting
Intelligencebecauseeverybeinginexistencereceivesits
impetus. AnothertitleallocatedtoitisActiveIntelligence
becauseitshowscontinuousactivechangesortransformations .
Thisofcourserelatestoafierydispositionbecauseofthe
constantchangingactivitywhichshowslittle
beginningofthePathshowsexcitementandstimulation
L36/pg1
ornorest .
energy,whileatitsmaximumpoint
The
both
this
energyinabundanceswellsandgushesforthsostronglythatit
reactssomethinglikeanexplodingvolcano .
HebrewletterassociatedtothisPathisPeh(which
meansmouth)andhasanumericalvalueof80 . Somerelatedwords
fthesamevalueareKSmeaning"throne"YAa"shovel",VAaD
and . YSUD"foundation" .

Thepositiveaspects

shows
throneandfoundationwhileshovelisneutralandGZAameaning
"tocut"worksonthenegativeside. ThewordPehhasavalueof
83andrelatestoYAaH"shovelaway",NLH"tocomplete"andMYLH
"circumcision" . Brokendownintoabstractconceptsonefinds
thatPehcanbeanalogoustoanobjectthatisafundamental
basis for mergingandsplittingandisphallicinshape(due
MYLH)whileashovelrelatesstronglytostoking(afurnace) .
ItisconsideredbydeO' livetthatPehhastwodistinct
articulations. The' firstisthatitreinforcesBeth(byvirtueof
itsshape)whichgivesitanoutlet . ThesecondisthatinPehin
itsfinalformwefindareinforcedVau . ThelinkbetweenPehand
Bethalsogoesbacktopronunciationwhichtiesincloselywith
ancientEgyptianusage . TheZohar says ofthisletter:' Iamthe
beginning(Peragina)anddeLiverence(Peduth)thouwillexecute
intheworld. . . . butthoualsogivestrisetoevil(Peshang),and
inthyformresemblesthoseanimalswhowalkwithbowedheads,
likewickedmenwhogoaboutwithbowedheadsandextended
hands. ' ThiswarnsthatPehcanbeadualedgedswordthatwill
quicklycutthewielderifheisnotcareful,andwarnsofthe
dangerbeneaththesurfaceofthings .
TheTarottrumprelatedhereisthe' BlastedTower' . It
depictsasingletower(withthreewindows)struckbythelight-
ningofMarswhichstakesoffthecrownedtopofthetower . From
thisdisastertwobodiesfall . Ontherighthandsideofthe
towerthereistheTreeofLifeandonthelefthandsidethe
TreeofEvil . Thewholeconcepthereistheapplicationofan
externalforce(heat)which is usedtoseparatethefactorinthe
tower. Thiscardisveryalchemicaland
L36/pg
relatesheavilytothe
anthorofthealchemist . Initsgeneralsenseitforetells
disasterandthesplittingupofaproject .
1
I
I
I
1
L36/pg3
Anher(Anhert)istheEgyptiangodfarmofthisPathandisa-
derivitiveofRatheSungodandpersonifies. hismostwarlike
attributes. Heisoftendepictedasabeardedwarriorholdingan
upraisedspear. Hisheaddresswasusuallyonewithfourtall
plumesmountedaboveit . Originallyhewasthegodofthedead
buthistitlewastakenoverbyOsiris. Anher' smainfunctionin
laterEgyptianDynasticperiodsseemstohavebeentheavenger
forhhunteddownthefoesofhisworshippersfromhisdivine
chariotandshowedthemnomercy. ThefestivalsofPapremiswere
inhonourofthisdivinityandwerenotedfortheirviolent
exchangesbetweenpriestsandworshippersalike .
AresisoneoftheGreekdivinitiesofthisPathandhas
alreadybeendescribedinthelessononGeburah . Anothersetof
divinitiesthatalsocouldapplyhereaswellaretheCyclopes,
whowereArges,BrontesandSteropesandrepresentedthevarious
elementsofdestruction(suchasthunderandlightning)anditis
theywhoinfactmadethethunderboltsofZeus . Theywereconsi-
deredtherepairmenofthegodsandbuiltfortressesforthem
thoughtheirownhomewasinHesiod. Legendhasitthattheywere
destroyedbyApolloafterhissonwaskilledbythethunderbolts
ofZeuswhichwerefashionedbytheCyclopes . TheRomanassocia-
tionisofcourseMarswhoisexplainedinthelessononGeburah .
TheMagicalWeaponofthisPathisthelightningflashwhich
intheoldtestamentwasdeliveredbyYahwehtodestroyhis
enemies. Thisisthetangiblespiritualdescentofpowerfrom
oneshigherselfwhichshowsboththedestructionofignorance
e
individual,andthegreaterthewrongthe
understandtheimpactofhurtandinjustice
L36/pg . 4
and truth. Inordertocontrolanddirectaforceofnature
thismagnitudeonemustbeabletobeincommunionwithones
higherselforatleastbeabletopetitionitandbehelpedin
return
. Itisinfactfarmorethanbeingablet

directan
aspectoftheelementsbutshowsthatoneisinharmonywithones
karmicdestiny,forapartfromthephysicalaspectofthelight-
ningflashitself,itisalsosymbolicasbeingrepresentativeof
flashesofillumination,withthisalsoaweaponinitselfthat
showsdeepinsightandunderstandinginasituationwhen
appearstobelostwhichcancompletelyreversetheoutcome
onesadvantage .
whichwhenplacedonamundanelevelhavelittle
all
TheMagicalvirtueofthisPathisforgivenessandrelates
forgivingthosewhohaveharmedyouorthosenearyou . To
forgiveisnotaneasythingwhenawronghasbeendoneto
holinessbutfirstappeartocomeundertheheadingof
an
greaterthevirtueit
istoforgivethosewhohavewrongedyouinthefirstplace . To
donetoanindividual
on
karmicleveliscloselyalliedtothedoctrineof
Catholicismongaininggracewhichamountsliterallytostockpil-
ingonesgoodtraits. Therearemanypracticalreasonsforthis
with
hedging
onebets
. Inshortweareallsubjecttothelawsofcauseand
effectandwhileweshouldtrytoprotectourselvesfromharmit
doesnotmeanwegoonavigilantehuntafterthosewhohavehurt
us . Therealhiddenconceptofforgivenessistounderstandwhy
thingshavehappenedtousandwiththatthoughtinmindturnto
1
L36/pg 5
workipg

wayatmakingthebestofabadsituationandnot
shiftingtheblameonpeoplewhoalsohavetheirkarmicact
playinlife .
to
TheviceassociatedhereisWrath,whichisacrossbetween
crueltyandvengeance,buthintsthatthemeaningoftheword
relatestohavingtoretaliateinaanoverlyzealousmanneror
rage . Wrathisthepointwhereindignationendsandvengeance
beginsbutitisavengeancesosouldestroyingandencompassing
thatitbecomesthefocalpointforalmosttheentireexistence
oftheindividualandgraduallyconsumeshimorher . Manyofus
haveheardthesaying' wrathofgod' andinsomewaysthisis
quitefrightening,fortheYahwehoftheOldTestamentsmitedthe
foesoftheIsraelitesleft,right,andcenterandusedevery-
thingfromthunderboltsandplaguestogoodoldcommonbattle
strategy. Thepointtobemadehereisthatonlythosewhoare
consideredomnipotent' canaffordtheluxuryofwrathandthere
arenottoomanyofthemaroundtoday .
magicalattainmentsofthisPathareworksofWrathand
Vengancewhichhavealreadybeendiscussedatlengthinthetwo
previousparagraphs. Themainpointofconsiderationisthat
likethecurseofthepreviouspath,worksofwratharean
attainmentandcanonlybeaccomplished(fromamagicalperspec-
tive)throughspiritualgrowth,it i s. an energythatisgivento
ussothatwemaycomprehendpoweranditsusesandmisuses,for
withoutourcomingintocontactwiththistypeofenergyonthe
pathoftheMagusitwouldneverbeabletobehandled
v
objectiVely .
L36/pg 6
AmineraldrugassociatedhereisSodiumwhichcanberepro-
ducedinmanyformssuchasSodiumChloridewhichistablesalt .
Thisdiffersslightlyfromtheesotericalchemicaldescription
whichdescribesthestatetheprimeamateriaisinandnotthe
effecttheingredienthas. Thismineralcanbefoundinthesea
andinkelpaswellasvegetables,fruitsandnuts,dairypro-
ductsandherbs. Itcanbeusedasadiuretic,anticoagulant,
analgesicandasanantidoteforsomepoisons . Saltisnecessary
fornerveandmusclerepairthoughtoomuchofitcancausemany
problems,suchashighbloodpressure .
GarlicoilisoneofthevegetabledrugsofthisPathandis
consideredasasulphideofallyl . Apartfromstabilisingboth
and high and low bloodpressuregarlicoilwillridthebloodof
excessglucoseaswellashelpingtoquellbronchialcomplaints .
Ithelpspromotebetterbloodcirculationandisgoodinhelping
toclearsinuscongestion .
OneofthegodsofIndianmythologyrelatedtohere is that
ofRudrawhowasconsideredavedicgodofstormswhosearrows
actedlikelightningboltstohisenemiesHeisalsocalledlord
ofanimalsafterbeingnamedassuchbyaterrifiedPrajapatiwho
wascaughtintheactofincestbyRudra . Inmanywaysanumber
oftheattributesofShivathedestroyerwereassociatedtoRudra
whosefamewasatanearlystagein . Indianhistory.
I
t
t
Lab/pg 7
One thegems associated to this Path is the Loadstone
which is a brownish red in colour and composed mainlyofmagne-
tisediron
. LegendhasitthatthisstonewaswornbyAlexandra
theGreatandsomeofhismenas - atalismanicprotectivedevice
thatattractedandgavepowertothe
magnetic . contentsthatLoadstonewasalsoassociated

the
reconcilingffriendsorloverswhichancientsconsidered
powerfulpullofattraction
. Withtherecentstudiesonmagnetic
auricfieldstheLoadstonecouldindeed(dependingonthe
strengthofthemagnetism)altertheaurasothatitcouldliter-
allyattractcertainethericforcestoit
. Onamedicinalpoint
thisgemstonealsowassaidtobringdownswellingsandhelp
gout .
plantassociatedhereisRue(fromtheGreekwordRuta
meaning"repentance")anditsbotanicalnameisRutagraveolens
.
Alargenumberoflegendshavesprungupaboutthisplantwhich
havebeenrecordedsinceHippocrates
medicinalplantthatactedonthenervoussystemandproduced
calming effect . Greek soldiers used it the night before
todispelltheirfears
. Theplantwasalsoawellknownantidote
againstpoisonandtheplague .
aromatic of this Path is Pepper. which is made from
crushedberriesandisassociatedhereduetoitsfierynature
whichwhenbroughtintocontactwiththenostrilsproducesa
violentreaction . Pepperisusualyusedasoneofthemainingre-
dientsfor any typeofMartianincense . Stories associated the
wearer. Because fits
whereitwasarecognised
a battle
L36/pgS
useof-Pepperinwitchesritualsfordispellinganevildemonof
sicknessfromthebodybyforcingit
nostrils.
TheOrderofBeingsassociatedhererelatetotheChimaera
whowasamonsterthatsprungfromTyphonandEchidna . Itwas
saidtobesoterriblethatithadthreeheads,
leavethroughthe
andgoat,butwaseventuallyslainbyBellrophonandPegasus . The
CalydonianBoarisanotherassociationtothisPath . Legendhas
itthatitwassentbyDianatoravagethecountryside(because
herworshiphadbeenneglectedbytheKing)andwentunchecked
becauseofitsgreatsizeandstrength . Eventuallyitwasslain
byMeleagerwhooffereditshidetoAtalanata .
TheOlympicplanetaryspiritofMarsisPhalegwhoissaid
to givehonourinwarfare . Heisoftendepictedas a kingarmed
andridingonawolf,horseorstag.
Thearchangel thisPathisSamael(Zamael)whorules
Mars. HisnameisderivedfromtherootSMmeaning"spiceor
poison" . Heisknownformoredarktraitsthangoodonesandwas
theangelwhowrestledJacobatPenielandhasoftenbeencalled
theangelofdeathanddestruction . Heisofteninterchangedwith
fallenangelsbecauseofthedestructionhecausesbut
a lion, dragon
thisis
becausehedirectlyorganisedthewrathofgod . Fortheignorant
thiswasmisinterpretedasevilandhewasassociated as anangel
ofhell . AmonghisbetterdutiesSamaelwastheguidingangelof
JohntheBaptistwhenheenteredthedesert . Heisconsidereda
I
I
I
I
I
I
a
The animal of this Path is thehorsedueto
andassociationt warasatooltocarrybothsoldiersand
weapons. Ithasavarietyofmeaningsassociatedtoitfrom
loftyspiritualtothelustful
the
Renaissanceconcept . Inmany
symbolsitiscloselylinkedwiththesolarpowerandthemascu-
line struggleforsupremacy. Howeverifoneismorediscerning
aboutitscolouronethengetsintoamaizeofassociations.
Y
YETZIRATICTEXT:
HEBREWLETTER:
TAROT:
EGYPTIANDIETY:
GREEKDIETY:
ROMANDIETY:
PLANET:
MAGICALWEAPON:
VIRTUE :
VICE:
MAGICALPOWER:
MINERALDRUG:
VEGETABLEDRUG:
INDIANASSOCIATION :
GEMSTONE:
PLANT:
EXCITINGINTELLIGENCE
PEH
TOWER
ANHER
ARES,THECYCLOPES
MARS
MARS
LIGHTNING
FORGIVENESS
WRATH
WORKSOFWRATHANDVENGEANCE
SODIUM
GARLICOIL
RUDRA
LOADSTONE
RUE
L36/pg9
teacher of theology and the guiding light of missionaries.
hisswiftness
AROMATIC:

PEPPER
ORDER OF BEINGS :

CHIMAERA
OLYMPICPLANTARYSPIRIT :

PHALEG
ANGEL - ARCH:

SAMAEL
ANIMAL :

HORSE
L36/pg1 0
I
I
I
I
I
I
I
I
I

LESSON37
TWENTY-EIGHTPATH
' TheTwenty-eightPathiscalledtheNaturalIntelligence :
by it is completedandperfectedthenature of allthatexists
beneaththeSun'
L37/pg1
The28thPathliesbetweentheSephiroth of Netzachand

Yesodandiscalled' NaturalIntelligence' becausethroughit,is


consumnatedandperfectedthenature of everyexistingbeing
. undertheorbofthesun .

Itisgrowth,pureandsimple,but
growththatdevelopsinitsownwayandisnotinduced. Anytype
of interferenceatthisstagewouldhaltitsdevelopmentand
alterthefinelybalancedpolarityofVictory
whichinthemselvesbringaboutsuccessfuldevelopment .
TheHebrewletterassociatedhereisTzaddi,whichmeans
"hook"andhasanumericalvalueof90 . Otherassociatedwordsof
thesamevaluearePYmeaning"mouthofawelloropeningina
garment",SLmeaning"raise"or"exalt"andMHMHmeaning"delayed
departure . Itisnottoodifficulttorelatethistothebaited
hookofafishermanreadytocatchanunsuspectingfish . Theword
Tzaddihasavalueof1 04 andrelatestowordslikeOD

divide
ortearlengthways",TzVL;H"tocryout",
andfoundation
andDO"beat" . These
alsoshowfurthermeaningsofwhatwillhappentotheunsuspect-
ingfishbecauseofthehook . Thoughtheanalogyofafishis
used,itcanbesubstitutedformanwhobecomesanactorforthe
withsevenminorstarsbelowit . Therepresentationisthat
restoredworldwhichfunctionsinbeautyand
LZ7/pg2
karmicdestinythathookshimonsomethingwhichonlydeathwill
separatehimfrom .
As a consonant Tzaddi relatestothehissingofwindandair
and all such associated objects. The Zohar states: ' Tzaddi went
beforeHim,saying:"BecauseImarktheZaddikim(righteous),and
alsoitiswritten,therighteousLordlovethrighteousness,it
willbecomeTheetocreatetheworldbyme" . ThensaidtheHoly
One :"Zadai,Zaddithougharttruelyrighteous,butthoughmust
keepthyselfconcealed,andtheoccultmeaningmustnotbemade
knownorbecomerevealed ;andthereforethoumustnotbeusedin
thecreationoftheworld . Thyoriginalformwasarod,symbolof
themaleprinciple,surmountedbyaYod, letteroftheHoly
nameandalsotheHolycovenant,andtheemblemofthemale
principlebutthetimewillcomethatthoushaltbedivided , and
Thyfacesturnedtowardseachother" . ' Thisrelatestothe
cyclicnatureoftheletterwhichstartstoturninonitselfand
relatestotheinwardspiralwhereman,bylookinginwardstarts
tobeinharmonywiththoseexternalandinternalinfluencesboth
inandaroundhim .
TheTarotTrumprelatedtothisPathistheStaranddepicts
anakedwomanpouringwaterfromtwojugswhilekneelingbya
pool . Oneachsideofheraretwotrees,thetreeoflifeandthe
treeofknowledge,whileasevenpointedstarshinesaboveher
harmonyas
of
the
watersoflifeflowfromthejugs . Itisthemergingofthevital
1
1
I
I
I
~
4 ~. i
colouring haivnggoldenstarsoverherbodywithbothhandsand
I
I
I
I
I
L37/pg 33.
forces

thekundalinesothatallisrevealedandonegains
accesstothedeeperresourcesofthedivine within usall .
TheEgyptiangodform of thisPathisNuttheskygoddesswho
oftenshownasanakedandarchedelongatedwomanofblue
feetleaningontheearth . Nutrepresentstheheavensornight
skyabovetheregions of theearth. Therearemanydifferent
versionsofNut,somehaveher as aholycowwhileothersshow
herunitingwithShu . ShewascalledthedaughterofRaandand
alsoMut . IntheWallisBudgebook' GodsoftheEgyptians' there
isacolouredillustrationofMutsitting in asycamoretree
pouringwateroverthesoulofthedeceased . Thishasvery
definedlinkswiththe' Star' andonecaneasilyseethedeve-
lopmentsfromthismyth .
bathe . Hebehadavitalpowerdespiteherdiminutivestatus and
thatwastobeabletorestoreinbothmenandgodsthevigourof
youth. SomefthelegendsofJunorelatetotheRomanmyths
associatedhere .
J
Hebe theGreekgoddessassociatedtothisPathandwas
thewifeofHeraclesanddaughterofZeusandHera . Shewas
consideredthegoddessofyouthandthecupbearerofthegods .
Thisofficeshelostwhenshepresentedanindecentposturewhile
pouringoutthenectartothegodsatoneoftheirvariousfesti-
vals. Herotherdutiesweregeneralhouseholdonessuchaspre-
paringhermotherschariotandassistingherbrotherAresto
L?7/pg 4
The Sunsign thatthis Path relates to is Aquarius. By
nature the Aquarian is emotional, temperamental and very active,
they are individualswhoareingeneralfairlywelllikedfor
theiroutgoingnatures. Theyareextremelycleverpeoplewho
usuallygravitatetowardscareersintheartsandsciencesand
aregenerallycalledthefreethinkersofsociety . Theirnegative
traitsshowtheycanbeextremelyselfopinionatedandsuperfi-
cialwhenconfrontedwithideasthattheydonotlike . Oftenthey
canbeveryunpredictableandtheirfriendsandpartners
sufferbecauseofit .
can
TheconstellationofAquariuswhichiscalledDeliinHebrew
meaning"bucket"or"waterurn"andDeluinArabic,withmuchof
thesamemeaning. Thereareover1 08starsinthissystemwith
thebrightestbeingSaadalMelikwhichmeans"the' recordof
pouringforth"andissituatedintherightshoulder. Inthe
leftshoulderanotherstarofinterestisSaadalSund"whogoes"
or' poursout' . IntherightlegisastarcalledScheat"who
goethandreturneth"whilethestarintheurniscalledMeon
"urn" . Ptolemyconsidersthatthestarsintheshouldersgiveout
aninfluencelikeSaturnandMercury,asthoseinthelefthand
andface . ThestarsinthelegsarelikeMercuryandtoalesser
extentSaturnwhilethoseinthewaterflowarelikeSaturnand
toalesserextentJupiter .
TheAspergillum(fromthelatinaspergeremeaningto
sprinkle)isabrushorametallicinstrumentusedforflicking
holywaterduringritual . Thisisthedirectingofforcesthat
t
1
1
L37/pg 5
one has alliedoneselfwithtoclearoutnegativevibrations
otherethericentitiesbyliterallysaturatingtheareawith
familiarethericforces
. Itisbringingneworfreshenergies to
onesaid.
ThevirtueofthisPathisliberationanditi

herethat
onecomestoapointofemergingwiththestreamofenergy that
i

futuristicinformandaction . Inmanywaysthosewhoawaken
tthevirtueofthisPathwillbeliberatedandbecatipaulted
into totallynewmodeofthoughtandideaswhichmayappear
radicaltosomebutareinrealitythefirstseedsorvibrations
thataccompanychange . Someonehastobefirstinthemodeof
thoughtandthosewhomergewiththeenergiesofthisPathwill
be . Themainpointofreferenceisthatthosewhosharethe
virtueofthisPathareinstepwithharmoniouschangeand, any
criticismsorpreventivemeasuresimposedonthemwillonlybe
transitory.
TheviceofthisPathisinsecurityandrelatestothe
individualwhooutwardlyappearstohavethevirtueofliberation
butonacloserinspectiononefindsthatheisunabletotake
thatfinalstep(withintheself)whereheisfreefromthe
confinesofadyingsetofvalues,andrefusestogowiththe
wheelofchange . Theindividualcannotadvanceandyetcannot
retreatandappearstoremainmotionlessastheinsecurityarises
withinmakingitimpossibleforhimtomake a commitment . Atthis
pointtheseindividualsslowlybegintodestroythemselvesas
theyarefirstpulledinonedirectionandthenanother .
excessivedrynessinthebodyandisagoodcold
whereanexcessofmucusbuildsup .
L37/pg6
. Themagicalpowerorattainmentassociatedhereisboththe
studyandapplicationofastrology . Heretheadeptmust
conversantwithastrologicaltimingforitisavitalpartof
studyofthemagicalarts .

Fromittheadeptcanlearn when,
whereandhowonecanapplythemselvesorwithdrawtowaitforan
appropriatemomentinwhichtobeginaproject . Fromastrology
theadeptcanlearnofhisowninnerworthandthatofthe
positiveandnegativecurrentsgeneratedbytheheavensbutmost
importantofallhelearnstolivewiththeseenergiesandabide
bytheirinfluence .
Themineral-drugrelatedtothisPathisthecellsalt
calledNaturumMuriaticum . Oneofthefunctionsofthissaltis
toregulateacidinthesystemsothatcorrectbalanceof
digestioncantakeplace(wherethereisalackofit) . Alsoit
helpsregulatethewatersupplyinthesystemcorrectingboth
overorunderbalancesofthisvitalfluidaswellashelping
cleanoutdepositsinthearteriespreventinghardening . Ithelps
preventative
Thevegetabledrughereisassociatedtoalldiureticswhich
relatestoalmostanydrugthatbringsonthesecretionofurine .
Thisofcoursecutsacrossotherpathsaswellbutsomeofthe
plantsusedforthisare :Blackberry,Strawberry,BarleyWater,
Dandelion,RedClover,Mulberry,Onion,{Garlic,Thyme,Cornsilk,
Sageandnumerousothers .
I
I
1
1
1
thesamefunctionsasthe
, Gg
TheIndianmythsrelatedherearethose-oftheNasatyaswho
werethegoldentwinswholightedthewayforboththedawnand
twilight . They are thehealersofthegods(andmen)andare
especially notedforrestoringyouth. Anothermythclosely
alliedwiththeNasatyasisthatoftheAsvinswhoperformedmuch
Nasatyas. Onedaytheysawabeautiful
womanbathinginastreambutwereappalledthatshehadanold
husband . Onofferinghereternalyouthifshechoseoneofthem
sherefused. Theybecamesoimpressedwithherdevotionthat
theyallowedherhusbandtobatheinthesacredstreamwiththem
thusrestoringhislostyouthandbeauty .
The Garnet is one of the stonesof this Path . Garnets are
smallstonesofavarietyofcolours . Theywereconsideredstones
that could heal any type of blood disease as well as keep lovers
together.
One o the plants or trees associated here is that of the
Coconut . ThisisbecausethefruitoftheCoconuttreearemilk
ladencontainersthatprovidenourishmentforthosewholivein
thetropics. Anotherassociationofthecoconuthereisits
relationshiptochastity . Thegrapevineisyetanotherassocia-
tionwhichprovidesthenectarofthegods(whenfermented)or
wine . Almostanyothertypeof . fruitbearingtreeorvine
appliesherethatproducesaberryorfruitwithahighwater
content .
Th legendary order of beings
Mermaids.
L37/pg Q
Spikenard is an aromatic that could apply here and wasone
of those used bytheancient Egyptians to farewell their dead on
their astral boat in the sky.
associated here are the
These water breathing creatures are said to behavealot
like Sirens and Water Nymphs andare always on the lookout for a
husband to help continue theirspecies. They are seductive indi-
viduals who are said to play amajorpartingoverningthework-
ingsoftheoceans .
TheArchangelofthisPathisKambriel(KAMBRIL) . Thisis
takenfromtherootKAwhichrelatestoatypeof"contraction"
or

"condensedform",

MB(fromtheArabic

form)

means
"remittance",andRI"Spiritualemanation" .

Thisshowsthat
Kambriel is associated to the essence of giving out spiritual
emanation . Usinggematt-iawefindthatKambrielhasanumerical

valueof304 .

Otherrelatedrootwordsofthesamevalueare
SMDR "buds on a vine , ROD "leap about " s ShAG "roar" and ShGA
increase" . TheseshowthepositiveaspectsofthisArchangel' s
naturewhichrelatetotheconceptofpotentialgrowththatis
abouttoburstforthinaquantumleap . Thenegativeaspectsare
DOR"stii",DSh"breakup",andShD"destroy"whichshownquick
i
destruction .
TheanimalassociatedtothisPathisthepeacockwhichhas
amultitudeofmeaningsrelatedtoit . Generallyitisasymbol
thestarsatnight whicharelikenedtothemanyeyesonthe
I
I
I
I
I
I
I
I
I
tent fact is that it
theheavensandmans
YETZIRATICTEXT:
HEBREWLETTER:
TAROT:
EGYPTIANDIETY:
GREEKDIETY:
ROMANDIETY:
SIGN:
CONSTELLATION :
MAGICALWEAPON :
VIRTUE :
VICE:
MAGICALPOWER:
MINERALDRUG :
VEGETABLEDRUG:
INDIANASSOCIATION:
GEMSTONE:
PLANT:
L37/pg9
birdstailandassuchalsorelatestoimmortality . Althoughit
had . manydifferentmeaningsineachcivilisationtheoneconsis-
was a symbol of importance and related with
soul . Inalchemythepeacockstailiscalled
caudiapavonisandrelatestothesevencolours
cycleofanexperiment .
AS~SQQJ. flQr
NATURALINTELLIGENCE
TZADDI
STAR
NUT .
HEBE
JUNO
AQUARIUS
AQUARIUS
ASPERGILLUM
LIBERATION
INSECURITY
ASTROLOGY
NATURUMMURIATICUM
BLACKBERRY,REDCLOVER,THYMEETC
NASATYAS
GARNET
COCONUTTREE,GRAPE
in a complete
AROMATIC:
ORDEROFBEINGS:
ANGEL - ARCH:
ANIMAL:
SPIKENARD
MERMAID
KAMBRIEL
PEACOCK
L?7/pg1 0
1 1
1
d
1
LESSON38
THETWENTY-NINTHPATH
'TheTwenty-ninthPathistheCorporealIntelligence,so
calledbecause'itformseverybodywhichisformedinallworlds,
andthereproductionofthem'
ThisPathliesbetweenNetzachandYesodandiscalled
CorporealIntelligencebecauseitformstheverybodywhichis
formedbeneaththewholeorderoftheworldsandtheincrementof
them.Inmoderntermsthismeansaconsciousnessofthematerial
orsimply_bodyconsciousness.Itisthelifeblueprintwithinthe
selfmuchthesameconceptastheDNAfactor .CarlJungoncesaid
thepurposeofpainistomakemanmoreawareofhimselfandthis
canonlybedoneonthephysicallevel(emotionsareclassed
underthisheading) .Anysubtlebodychangethatdoescauseany
type of reactioninthisinstanceisrelatedtoagrowthfactor
orCorporealIntelligence.
TheHebrewletterassociatedtothisPathisQophmeaning
"backofthehead"whichhasanumericalvalueof100.Asan
ancientheiroglyph,Qophrelatestoanaxeorothertypeoflike
weapon .OtherwordsofthesamevalueareAaL"high"or
"exalted",TzY"dryness"andPK"flask"or"bottle" .Theword
L38/pg1
Qophhas a valueof186whichrelatestoMUSP"increase"
"place" . AlltheseshowvariousassociationstoQophwhich
andMQUM
can
helpdefinethelettermorefully.Inthefirstinstancewehave
r
1-%nal PV d.
the'referencetoahighdryareawhereonegainsnourishment(the
waterflasks) .Inthesecondinstance(byinterrelatingwiththe
first)wehaveaplacethathasnourishmentontheincrease .
Thisisaletterrepresentingrepressedforceandisconsi-
deredamaterialisationoftheletterKaph,foritisthemeaning
oflifeitselfexpressedinshowingthestruggleforlifeonthe
materialplane.
TheTarotcardofthisPathistheMoonwhichshowstheMoon
ontheincreasewithfourYodsbeneathit .Belowthisaretwo
towersandtwodogsseparatedbyawinding streamwhichleadsto
apoolatthebottomofthecardfromwhichacrayfishappearsto
beemerging. Thisrelatestotheconceptofthestruggle of life
and shows thepitfallsonehasafterleavingthesafetyand
protectionofthewomb,typifiedbythepond .Itisacardof
hardship,fornothingwillcomeeasybutitis . notnecessarilya
cardofdefeat,justdifficultyintryingtoaccomplishtask .
Itisalsoagrowthcardinwhichlessonsaregivenandlearned .
Upuautmeaning"openeroftheway" is theEgyptianwolf
headedgodofthisPath .T .is-ancientgodwasLordoftheunder-
worldandNecropolisandwasawarriorgodofsomeconsiderable
powerandwasconsideredoneoftheprinciplegodsbeforeOsiris,
whowasinlaterperiodsofworshipamalgamated-with Osiris .
OftenheisshownintheboatofRaasitgoesacrossthenight
sky .AlongwithAnubis,heisaguardianofOsiris .Upuautwas
theguideofRaandwasalsoconsideredthescoutofthe
nrw-
11
f
r
1
1
6
I
for all came after him.
The Greek Myths

this Path relate

the voyage
Odysseus ashejourneyedtoAeaeawhenhehadtopreventhimself
fromsuccumbingtothecallofthesirensbylashinghimselfto
themastofhisshipandkeepingtohiscourse .Anotherstory
whichalsorelateshereisthemythofHeroandLeanderwhowere
twoloversthatwerepartedbyastraightofwater .Shelivedin
a tower and shone a lighttoguidehimasheswamtowardsherin
thenightbutthewindblewoutthelightandhedrownedaftera
valianteffort.Shealsoplungedintothewaterwheretheywere
unitedindeath(someendingsofthismythsaythatshe
survived) .
TheRomanmythrelatestoVenusandCupidsittingonthe
bankofariver(theEuraphrates),whenduetotheshockof
seeingTyphonapproachingtheyleaptintotheriverandwere
savedbytwofisheswhotowedthemtosafety .
TheSunsignassociatedtothisPathisPiscesandthose
bornunderitaresaidtobepsychicandinhibitedindividuals
whoseemtotheoutsiderasbroodersbutinfacttheyarepeople
thathavedifficultyinadjustingtochange.Therearestrong
occulttendenciesinthissignandthosebornunderitgenerally
havesomeleaningtowarditsmanyhalls.Piceansarenotorious
procrastinatorsbutoncetheygetintogeartheycovertheir
L38/pg
relatedsubjectsinconsiderabledepthduetotheir versatility
andreligiousdevotiontotheircauses .Thissignaffectsthe
L39/pg 4
lower body parts (such'as the feet) as well as the skin hair and
lungs.
The constellation Pisces means "the fishes" . The
Hari
whichmeans 'the fishes of he that comes forth' . In Hebrew this
is called Dagim and Nuno in the Syriac language. There areover
113 stars in this constellation with two of interest being Okada
meaning "united"and Al Samaca "upheld" . Ptolemy considers that
thestars in the headof the southern fish have the same influ-
ence of Mercury and to a lesser extent, Saturn. Those in the body
are like Jupiter and Mercury while those in the southern line are
likeSaturnandmoderatelyMercury.Thestarsonthebackboneof
thenorthernfish are likeJupiterandVenuswhilethoseinthe
northernlinearelikeSaturnandJupiter .
ThemagicalweaponofthisPathistheshewstoneorcrystal
I
usedinskrying.Thecrystalballhaslongbeenthejokeofthe
laymanabouttheoccultistbutinfact,whenusedcorrectly,isa
verypowerfultoolintheadeptsarsenalofweapons.Ithasbeen
usedbythosewithpsychicabilitysincethebeginningofanti-
quitywhenanyreflectedsurfacewouldsuffice .Asaroundshew-
stone,usuallymadeofcrystalorcolouredglass,itcanthrough
theoperatorsabilityproduceavisionofthepastpresentor
future.Italsocanbeusedtocontactbeingsfromanotherdimen-
sionsuchasitheworksofJohnDeeandEdwardKellywho
obtainedthroughthebasisoftheEnochiansystemofmagicas
usedintheGoldenDawn,throughusingthecrystal .
Egyptian zodiac of Denderah called this constellation Picot
t
I
I
1
1
1
L38lpg 5
The virtue of this Path is psychic transcendence. It refers
to the state of awarenesswhentheindividualmustgoitalone
andfollowthenewperceptionshehasdevelopedwhichwillulti-
matelyleadtobreakingfreefromhispreviouslylimitedperspec-
tive.Whatheultimatelyshedsishisoldidealismandthe
structurethatwentwithit.Becausethisshatteringeffectis
partoftheevolutionaryprocesstheindividualgrowsinthe
mannerhewasdestined .Thiswayisusuallydifficultatfirst,
likeallbirths,butastheindividualbeginstoseethenew
conceptsaroundhimhewillgraduallygrowtoacceptthemfor
whattheyareandwithnoneoftheoldpreconceivedvalues.
Thviceassociatedhereisthatofpsychicinversionthat
relatestothepentuppsychicforcesnotbeingreleased,which
thenturnbackontheindividual,creatingproblemswithboth
mentalandbodilyhealthasthenegativeforcestrytounleash
theirhavoconthesafetymechanismthatinfacthastriedso
hardtreleaseit.Heretheindividualissoboundupinthe
selfthatatypeofselfdestructiondevelops.
onehaslearneduptothispointisturnedawayfromitsgoal, to
presenttheultimaterealityandisthensentbackontheself
so thatrealitycanbeavoided .
magicalattainment thisPathiswhathasbeen
Everylessonthat
commonlycalledabewitchmentwhichisinfactnothingbutan
illusion.Theabilitytocreateanillusionissometimes
linked
tohypnosisandistheconceptofanadeptbeingabletocontrol
L38/pg6
the -aura of an individualor group to see a desired object or
vision . Theadept in fact sends out a boost-o4 his auric power
that forces an entry into the aura of the person one wishes t
control and simply takesoverthethoughtsandactionsofthe
individual .Thisistheabilitytobeabletocontrolthose
aroundoneandwhileitisnotanareathatoneshoulddabblein
too much, it is still a fact that the adept muststudy and
abletocontrol,ifheorshewishestocontinueonwiththePath
of magic .
ThemineraldrugrelatedhereisFerrumPhosphatewhich
helpsinstoppinginflammationandregulatesthewaterbalancein
thebody.Ithelpsagainstrespiratoryinfectionandfeversand
helpsstrengthenthewallsofthebloodvesselsaswellashelp-
ingproduceredbloodcellstoguardagainstanaemia.Itisalso
helpfulininjuriessuchassprainsandseverebruising
.Italso
canbeplaceddirectlyonanopenwoundtohelpstemtheblood
flow.ThevegetabledrugsofthisPathrelatetoanytypeof
narcoticdrugorplant .
OneoftheIndianmythsassociatedtothisPathisthat
Matsya,thefishavatar .Thismythrelatestothe
foundasmallfishinhishandwhichpleadedforlife.
movedbythelittlefishanditswilltolivesoheplaced
timeManu
was
itin
ajar.Thefollowingdayhefoundthatthefishhadgrowninsize
andwouldnotsurviveinthesmalljarsohecarriedittothe
lake.IngratitudeforsavinghimthefishtoldManu fthe
comingdelugeandsenthimalargeshipwheretwoofevery living
11
I
t
I
Thereareanumberofgemstonesassociatedheresuchas
Moonstone,Topaz,Amethyst,HyacinthandTourmaline.Mostof
thesehavealreadybeenexplainedinotherpaths, for thisPath
isoneofoverlapsingemstoneassociation .Tourmalinehowever
istheexceptionanditcanbefoundinavarietyofcoloursand
hasbeenusedinpressuremeasuringinatombombs.
ship-herethoughislessdramaticandisbecauseofitsuse

opticsthatitisplacedonthisPath .
OneoftheplantsofthisPathisErgot(Clavicepspurpurea)
andismoreofafungusthanaplant,itgenerallyreplacesseeds
onryegrass.Ergotisinfactthebaseforthehallucinogend-
lyergicaciddiethylamide(LSD) .Allotherplantswhichcausea
hallucinogeniceffectcanalsoapplyherewhichcutsacross
associationstootherpaths.Ambergrisisaperfumeassociated
herewhichhasalreadybeendescribedinpreviouslessons .
OneofthelegendaryorderofbeingshereistheWere-Wolf
becauseofitsdirectlunarassociationtochangeatthefull
moon .Theseareordinarypeoplewhotransformatthefullmoon
intoabeast.Thetransformationinfactcanb
involuntaryandrelatestoamagneticinfluenceintheaura
isinempathy withthelunartidestosuch
LZB/pg7
creature were to be'taken .Withthehelp of Vishnuasagiant
golden fishandthesnakeVasuki,Manugottheanimals
boatandallthatmanagedtogetaboardweresaved .
onthe
Itsrelation-
anextentthatthe
moontakesoverthebody'smentalandphysicalcharacteristics .
voluntaryor
that
The archangel
The root AMNmeans
meaning'growth' .
MYPPRUNwhichrelates
power,AChRChYQ
theconceptoflongawaitedgrowthalongcorrectlines .
TheanimalassociatedhereisanytypeofShellfishbecause
itstands
organismtoreachlandandexistoutofitsenvironmentthrough
slowadaptation.
YETZIRATICTEXT :
HEBREWLETTER:
TAROT:
EGYPTIANDIETY:
GREEKDIETY:
ROMANDIETY:
SIGN:
CONSTELLATION :
MAGICALWEAPON:
VIRTUE:
VICE:
MAGICALPOWER:
MINERALDRUG :
L"S/pg8
ofthisPathisAmnitziel(AMNYTzYAL=323) .
'firm'or'faithful',YTz is anArabicroot
Otherwordsofthesamenumericalvalueare
toShekinahandthefemininecharactericof
meaning'long-absentbrother' .Thisrelatesto
forthebeginningoflifeandthebase for thesea
AS29GIOU0_NS-
CORPOREALINTELIGENCE
QOPH
MOON
UPUAU
ODYSSEUS
VENUSANDCUPID
PISCES
PISCES
SHEWSTONE
PSYCHICTRANSCENDENCE
PSYCHICINVERSION
BEWITCHMENT
FERRUMPHOSPHATE
1
1
1
1
1
t
I
VEGETABLE DRUG:
INDIAN ASSOCIATION:
GEMSTONE:
PLANT:
AROMATIC:
ORDER OFBEINGS:
ANGEL - ARCH:
ANIMAL :
L38/pg9
ANYNARCOTIC
MATSYA
TOURMALINE,MOONSTONE,AMETHUT,ETC
ERGOT,HALLCINOGENS
AMBERGRIS
WERE-WOLF
AMNITZIEL
SHELLFISH
LESSON39
THIRTIETHPATH .
'The Thirtieth Path is the CollectiveIntelligence
and
astrologers
deducefromitthejudgementofthestarsandceles-
tialsigns,andperfecttheirscienceaccordingtotherules
themotionofthestars' .
ThisPathliesbetweentheSephirothofYesodandHodandis
calledCollectiveIntelligencebecauseitutilisestheprinciples
f themacrocosmshowninscienceslikeastrology .Italsogoes
furtherbecauseitshowstheharmony of thecelestialspheresor
planetsastheymovefromoneorbittothenextwithoutcolli-
sion.To certainextentthisisperfectionofatypewhich
revolvesaroundtheprincipalsphereofthesunwhichprovides
themagneticfields ofour solarsystem.TheThirtiethPathin
factreflectsthistypeofharmony'accordingtotherulesofthe
motionofthestars' .
TheHebrewletterassociatedtothisPathisReshmeaning
"face"andhasanumericalvalueof200.Otherwordsofthesame
valueareKNPIMmeaning"wings",YTzQ"pourout",PTzL"peel
off",AaLQ"clingfast"andQLAa"acastingnet" .Allthese
alludetotheconceptofsomethingmovingandpouringforthits
energieswhichcapturesallinitspath .AsawordReshhas
valuef510whichequateswithotherwordssuchasShIRmeaning
"song",YRSh"gainbysuccession",LPTh"turnasidefrom"NThS
L39/pg1
i
1
I
I
I
I
"destroy" or "spoil". 'These alsoshow us the negative aspects of
the word as well which illustrates that to much of this force can
destroy, peel or turn aside one. It is also fairly evident that
this letter hasa close relationship with the Sun for the
tive and negative attributes
influence.
The abstract concept of Resh isa mans head which relates to
his development. Some authorities, suchasBoeheme, consider that
1-1
Resh is analogous to fire while others relate it directly to
solarinfluence. The whole aspect of this letter though is one of
renewal, growth and generation.
L39/pg-
posi -
clearly brings out the Sun's
The Tarotcard of this Path isthe Sun and depicts the Sun
shining its influencethrough12zodiacraysover a wallof72
stones which stand for the holy angelic boundary of the Schem-
phamphorash Angels. Below this and where appears to be outside
the stone boundary, are two children next to a pool of water .
This entire theme is the warmth of the Sun bestowing its benefi-
cient rays which have created life and the elements. It is the
period of growth and prosperity as the initial phase of a project
is entered into on a newplateau of existence.
The Egyptian godform associated here is Aten who was the god
of not only the Sun but also its spirit as well . The Aten-R&
relationshipis best described when Nekht says toRa: 0thou
beautifulbeing,thoudostrenewthyselfandmakethyselfyoung
againundertheformofAten
.'InmoderntermsAtenwasthe
a
Lv9/pgz
archetypeorphysicalvehicleofRa,theSolargod .Thereisthe
analogyintheChristianconceptwithRaasGodtheFatherand
AtenasGodtheSon(withapossibledualroleastheHolySpirit
as well). It alsomustbeconsideredthatgodslikeAtenroseto
prominenceduringcertainperiodsandthenwerereplacedwith
othervariationsofthesolartheme .Atenwasaveryoldversion
oftheSungodandatoneperiodwasevensaidtohaveupstaged
thesupremacyofRaasSungod .
TheGreekassociationtothisPathisHelios(nottobecon-
fusedwithApollowhorepresentedtheelementalformoftheSun),
a dietyoftheSunitself .LegendhasitthatHeliosdroveacross
theskyinagoldenchariotuntilhefoundthegoldencupof
HephaestusontheislandofHesperidesattheendofthedaywhen
hwouldsailallnighttoreturnitscontentstohiswife,
childrenandmotherontheislandofAeaeaandthenextdaycon-
tinueonhistimeless .journeybackagaintoHesperides .Hehad
manychildren,andthe - attributetoseeandknoweverythingthat
wenton in boththeabodeofthegodsandearth,whichalsohasa
strongrelationshiptotheallseeingeyeofHorus.TheRoman
mythsrelateheavilytovariationsoftheexploitsofApollo.
ThezodiacassociationhereistheSunwhileitsAngelis
MichaelanditsIntelligenceisNakhielanditsSpiritisSorath .
ThenumericalvalueofNakhiel(NKYAL)isiiiandrelatesto
otherwordssuchasQVH"stretchout"MHULL"mad",ADMUNY"red
andASN"ruin"whichshowvaryingaspectsofthisAngel'snature
anditssolarroots.Sorathontheotherhandhashadaless
1
l
1
bringsrelieftoinflammationsandbronchialupsets
.
OneofthegemstonesofthisPath is Jet (a formoflignite)
whichwasagemstonewhichhadremarkablepowerattributedtoit
.
Becausethiswasafavouritegemofthegodsmanyassociatedthe
controlofthenaturalforcesofnaturetoit,somethingwhich
onlygodscouldd . Itwasalsousedasanamuletfortravels'
overwater
.Itwassaidthatanyonewhoworejetwouldhaveitas
partofthebodyforitwasbelievedtogainitspowerfrom
livingorganisimsandassuchattacheditselftothem,provided
itwaswornagainsttheskin
.Alsoitwasoftengiventoladies
whomonewishtoplaceundertheircontrolasitwasbelievedit
hadthispower
.Oftenonestonewasseparatedintotwopartswith
thecontrollerhavingtheoriginalpartandthepersonhewished
tocontrolhavingtheother.Ingeneralitwas gemthat
protectedtheweareragainstallevilspellsandenchantments .
TheanimalassociatedtothisPathistheCherubofearth.
ebiblicaldescriptionsoftheCherubofearthisabeingwith
4facesand4wingsthoughinrecenttimesmostuseasimplified
explanation
L25/pg7
eachCherubhavingonlyoneface(dependingon
whichelementitrepresented)andonesetofwings
.Theearth
Cherubisdepictedashavingabullshead .Theywerethefigures
placedatthecornerofthetabernaclewherethetabletsofMoses
werekept.TheCherubsarereferredtoinboththeoldandnew
testaments(Ezii,1andApociv,6-7) .Theyarementionedinthe
GreaterKeyofSolomon"WhowasmadetheguardianoftheTerres-
trialParadisewiththeSwordofFlame" .Theirfunctionsare
still not clearcutthoughmostscholarshavealignedthemwith
forcesrepresentativeoftheelements .
AnincensetoassociatetothisPathisCinquefoil
strengthensthesensesbynotonlyincreasingthevibrational
pitchoftheaura(sothatmoreperceptionoccurs)butalso
reinforcestheaurawithadditionalstrengthdirectlyfromits
ownvibratorylevel .Inevocationworkitisagoodbasearomato
workwithtogivesubstancetotheastralbodyofthespiritin
thetriangleandassuchactsasaholdingorbindingfactoron
it.ThoughCinquefoilcanbeusedonitsownitisgenerally
mixedwitharomaticstogiveitafineredge .

Thisappliesto
workingsnotonlyofthisPath .

Thebest
Cinique#oilisasatypeofuniversalbasearomaticasfaras
magicalworkgoes.
Theangel of thisPathisAraziel(ARZYAL=249),meaningmy

I
moonisgod,andwasoneoftheangelsmentionedinthebook of
Enochwhowassentfromheavenbecausehe
women .TherootARZrelatestotheearthorsomething
likefoundations.ThisofcourseshowsthatArazielwasanangel
whogrewmoreandmoreintomatteruntilitappearshemayhave
beentrappedinithence,theterm
matedwithmortal
permanent
fallenangel .Thewholeconept
4thefallenangelsifviewedinthislightshedsaslightly
differentmeaningonthesubjectthanthestandardbiblical
texts.BeingtrappedinmortalformmeantthatArazielandthe
otherfallenangelssimplycouldnottakebacktheirformerstate
of pre-existencewhichwasanonmanifestedone.

Theironly
L2Z/pg8
waytdescribe
which
1
wouldnothavetolookat
Minotaurusasitissometimescalledwasacombination both
manandbullandwassaidtohavebeenformedfromtheunionofa
whitebull(fromNeptune)andPasiphae,wife4Minas .The
Minotaurwasconfinedtoalabyrinthwhereeachyearsacrifices
(ofyoungmenandwomen)wereofferedtoitfromAthens.
themdirectly.TheMinotauror
L2S/pg`9
method

salvationwastoreworktheir way backthroughthe


evolutionaryprocessofmankind .
ThelegendaryorderofbeingsassociatedtothisPathare
theGorgonsandtheMinotaur
.Theformerwerethreesistersbythe
nameofMedusa,EuryaleandSthenowhowerethedaughtersofCeto
andPhorcys
.Allofthese(exceptMedusa)wereimmortalandwere
saidtohaveliveserpentsinsteadofhairwithscalescovering
theirbodiesandwingsofgoldandhandsofbrass.Theirlooks
weresaidtoturnpeopleintostonebuttheyweredefeatedby
PersuswhokilledMedusabyusinghisswordasamirrorsohe
YETZIRATIC TEXT:
HEBREWLETTER:
TAROT:
EGYPTIANDIETY :
GREEKDIETY :
ROMANDIETY :
PLANET :
MAGICALWEAPON :
VIRTUE:
VICE:
MAGICALATTAINMENT :
MINERALDRUG :
VEGETABLEDRUG:
GEMSTONE :
PLANT:
AROMATIC:
ORDER OFBEINGS:
ANGEL:
ANIMAL :
L25/pg 1 0
TRIUMPHAL/ETERNALINTELLIGENCE
VAU
HIEROPHANT
APIS-HAPI
HERA
VENUS
TAURUS
LABOUROFPREPARATION
PRODUCTIVITY
MATERIALISM
SECRETOFPHYSICALSTRENGTH
KALIPHOSPHORICUM
NAT.SULPH.
JET
MALLOW
CINQUEFOIL
GORGONS/MINOTAUR
ARAZIEL
CHERUBOFEARTH
1
1
I
i
L39/pg 4
than , friendly nature and has a valueof666relatingtothe
traditionalnumberofthebeastoftheApocalypseinthevisons
ofJohntheDivine.
ThemagicalweaponofthisPathisoftheGreekCross .It
statesinthePracticusritualofthe30thPath : 'TheSolarGreek
Crossisformedof13squareswhichfitlyrefer theSun's
motionthroughtheZodiac,thesesignsbeingfurtherarrangedon
thearmsofthecrossaccordingtothe - fourelementswiththeSun
inthecenterandrepresentingthatluminaryasthecentreofthe
whole.'Whenwornasalamenonthebreastthisproducesa
balancingeffectintheaurabutwhendirectedasaforcefrom
thesolarcenterofTiphareth(theheart)itbecomespotent
weapontoprotectoneselffromnegativity .
ThevirtueofthisPathisartisticaldevelopmentand
relatestothestateofharmonywithintheselfthatoften
expressesitselfinsignsandsymbols.Thetypeofartistic
temperamentheremustnotbeaforcedonebutanaturalprogres-
sionofdevelopment,forexpressionalusethroughsymbolsand
signsisasteptowardsunderstandinguniversalconsciousness
andunravellingitsmysteries .Themostimportantthingabout
thisvirtueisthatitmustoriginatefromwithinasaformof
expression,foronlythenwillonebeabletoadapttothelan-
guageoftheWesternmysteryschools .
TheviceofthisPathisbewildermentandrelatesto
rejec-
tion
bytheselfofthenewconceptsthatarebeginningt
t
L39/pg5
emanatefromtheHigherSelf,whichifacceptedwouldmean
shatteringeffectfortheLowerSelfwhichwouldhavetorelease
itsholdontheindividual .SincetheLowerSelformindhas
limitedfacultyofexpressionandunderstandingitputsoutan
automaticejectionsignaltoanythingthatisnewandbeyondits
level of acceptance.ContinuedpressurebytheHigherSelfwill
eventuallyshattertheseboundariesthoughnotwithoutsomeun-
pleasantsideeffects.
purgehimselfofhisnegativityandtoreleasethestored
Themagicalpowerorexpressionhereissometimescalledthe
redtincturewhichinalchemicalterminologyisthealbedo
-the
reddeningprocess
.Transferredbacktorealtermsonefindsthat
itrelatesto(1)theemotionalstateofexpression(2)gratifi-
cation(3)corestimulation, all ofwhichhavesexualovertones .
Thisisthefieryemotionalstatethepostulantwillgo,through
p
psychicenergywithintheselfthatnormallyhastobecontrol-
led
.Theseenergiesinturnprovideuswithourdrive,the
abilitytogetthingsdoneandarethestimuliforourmotivation
onthislevelofawareness .
ThemineraldrugofthisPathisIodinewhichisbetter
knownunderitssyntheticnameofPotassiumoxide
.Thisrelates
stronglytothethyroidglandwhichhelpsregulatebody_weight,
producemoreenergyandmakeonemorementallyalert
.Itissaid
tohelpinkeepingdowntheeffectsoftoomuchradiationthrough
stimulation of thethyriod
.Asatraceelementitkeepstheskin,
hairandteethhealthyaswellascontrollingthecholesterolin
1
t
r
thebloodstream.
Thevegetabledrug'hereisalcoholwhichiftakeninsmall
dosesbecomesastimulant,
relaxantwhich,dullsthesensesand
effect.Itcanalsotakesometothe
L39/pg6
butiftakentoexcessbecomes
canproduce

stupor-like
stageofdelirium .
The'IndianmythofthisPathisSuryawhoisoftendepicted
as redman(withthreeeyesandfourarms)seatedonalotus
withraysemanatingforthfromhishands .Legendhasitthathis
wifeSanjnahadtoleavehimbecauseofhisbrilliantradiance
butarrangedforasubstituteintheformofShaya(knownasthe
shade) .AfteratimehewasreunitedwithSanjnabuthadpartof
hisbrilliantradiancetoneddownsohiswifecouldlivewith
him.MythologydictatesthatSuryahadtwelvenamesthatare
analogoustothezodiacsigns.
OneofthegemstonesofthisPathisGarnetwhichhasbeen
usedbycivilisations,suchastheEgyptians,foravariety-of
curesfromsnakebitetobloodpoisoning.Theiresotericconsid-
erationistopromotehealingofthebodyandreconcilerifts
betweenfriendsandlovers .Othergemstonesassociatedherealso
cutacrossassociationstootherpathsandSephiroths .Theseare
theChrysolith(thegoldenstone),Alectoria,Aetites(eagle
stone)Amber(Lyncurius),Hyena,Goldpyrites,andThenarcus.
TheHeliotropeisoneoftheplantsrelatedtothisPathand
alsohasdualassociationstootherpaths .Thisplantwasorigin-
ally introduced from South America into
L39/pg
Europe though Greek
mythology is also linked with it in the form of the legend
Adonis. This relates to a woman who was in love with him who
watched forhisgoldenchariotacrosstheskysooftenthatshe
eventually turnedintotheHeliotrope.Itsmedicinalqualities
arethatofanervine.Themagicalpropertiesofthisplantare
forpropheticdreamsandinexorcismrites .
of
TheincenseassociationtothisPathisnumerousandrelates
allincensesthatbringonstrongethericinfluenceswhich
increases vitality.SomeoftheseareFrankincense,Cloves,
.Camphor,LaurelBerriesandMastic,allofwhichhavedual
associations.
TheOlympicPlanetarySpiritofthisPathisOchwhohas
36536legionsofspiritsunderhim.Hisruleissaidtolast600
yearsandisbasedonarotationalbasisandissaidtoteachall
thosewhosummonhimwisdomandtheuseofmedicines .Heisone
ofthepowerful'alchemicalspiritsthataidinthetransmutation
ofbasemetalintogold .Ochissaidtoteachthewaysofangels
andissaidtoappeartothosewhocallhimintheformofaking
oralion.
ThelegendaryorderofbeingsassociatedherearetheImams
whowere .twelveinnumberandwereassociatedtoAliandhis
descendantsinMoslemmythology.Theywerebeingsoftimeand
eachgovernedanhourofthedayandtheywereoftendepictedas
livingflames.Betweenthemtheycoveredmansentireknowledge
1
1
I
I
I
I
I
I
One oftheanimalsassociatedhereistheLeopardwhichis
generallyassociatedtoaggressiveness .InEgypttheLeopardwas
symbolofOsiris
YETZIRATICTEXT:
HEBREWLETTER
TAROT:
EGYPTIANDIETY : '
GREEKDIETY :
ROMANDIETY :
PLANET:
MAGICALWEAPON :
VIRTUE:
VICE:
MAGICALPOWER:
MINERALDRUG :
VEGETABLEDRUG :
INDIANASSOCIATION:
GEMSTONE:
PLANT:
transmutationfromonelifetothenext .
QjgSQQIAjjQN_S
forthethespotsonitshowedthe
COLLECTIVEINTELIGENCE
RESH
SUN
ATEN
HELIOS
APOLLO
SUN
GREEKCROSS
ARTISTICALDEVELOPMENT
BEWILDERMENT
REDTINCTURE
IODINE
ALCOHOL
SURYA
GARNET
HELIOTROPE
L39/pg a
and a prayer to them would impart this knowledge if it was said
at the appropriatehour.
AROMATIC:

FRANKINCENCE
OLYMPIC PLANETARY SPIRIT:

OCH
ORDER OF BEINGS:

IMAMS
ANGEL - ARCH:

MICHAEL
ANIMAL :

LEOPARD
L39/pg 9
I
I
I
I
I
I
which means "tooth" and
L40/pg 1
LESSON 40
THI RTY-FI RST PATH
'The Thirty-first Path is the Perpetual I ntelligence, but
why is it so called? Because it regulatesthemotions of theSun
and the Moon in their proper order, each in an orbit convenient
for it . '
This Path lies between the Sephiroth of Hod and Malkuth and
iscalled 'Perpetual I ntelligence . . . because it regulates the
motions of theSunandMoon' . Tomakesense of thisonehasto
look at the Sun and Moon from a magical viewpoint, and to look at
theprinciple of bothpositiveandnegativeandtheirvarious
associations . I n addition the Moon's orbit is the closest to us
andactslikeasortoffiltertrap of theplanetaryrayswhich
areof courseinturninfluencedbytheSun . I tisacombination
of boththeseenergiesthatgivesuslife for theMoonreceives
the Sun and we receive theirmixture by their emanations
cojoined .

TheMooninfactshelters us fromtheSun'sharshness
byuse of abarometereffectwhicharecalledtheLunar
These produce an ebb and flow of the Sun's emanations .
tides .
Theletter of theHebrewalphabetassociatedhereisShin,
has a numerical value of 300 . Other words
of
the-samevalueareSTI R"tostandupright",OR"springout"or
"emanate"andRU"evacuate"or"drawout" . Thevalueoftheword
Shinis360andequatestootherwordssuchasROMI M"thunders",
L40/pg2
KMSh "swift" or "penetrating", NShGHH "attaining to higher know-
ledge" . TzRAa "smite" and QRS"shoot forth" . The first group of
words relatetosomethingthat is emanatingandisdrawingforth
i much the same way the HolyGuardian Angel will draw us forth
at death. The second group relates to attainment butalso cau-
tions usagainstthenegativeaspectwhichafterdeathwillbe
thekarmicwheel of rebirthandretributionforthosewhoneed
it .
ThTarot card associatedhereiscalledJudgementwhich
showstheangelwhichsomehaveassociatedtoMichaelwhoblows
histrumpetthroughthetriangle of firecausingthegrowthf
thesevenstages of development . Belowarebodiesrisingoutof
theearthatthesoundfromthetrumpetwhichalsoheraldsthe
beginningofanewage . Heremandoesnothavetorisefromthe
clayofearthbutmeets,throughevolution,thestageofdevelop-
mentwhenthekarmictiesarenolongerneeded . Thiscard
stronglyshowsrebirthandregenerationintoahigherechelonof
developmentthaneverbefore .
TheEgyptianmythrelatingtothisPathisthelegendof Mau
thecatgoddess(avariationofRa),whofoughtwithNeb-er-tcher
whichisanotherversionofthebattleofnightagainstday,with
thevictoriousMaurosethefirstraysof thedawninglight .
Takentoadeeperlevelitshowsthebirthof neweraof
knowledgethatdrivesawayignorance
. Otherassociationshere
areThoum-aesh-neith,Kabeshunt,HorusandTarpesheth
. Allof
thesearevariationsofthesolarthemeandhenceastrongrela-
1 1
1
1
I
t
tionship to the fire element .
The Roman association here isPlutowhowastheson
SaturnandOpsandistheGreekcounterpartofHades(whohas
been discussed in previouslessons) . Hiskingdomwashelland
anythingbeneaththeearth . LegendhasitthatPlutosatona
throneofsulphurandhadthehoundofhell,Cerebus,ashis
watchdog . DuringthefightbetweenthegodsandtheTitansthe
CylopesmadeaninvisiblehelmetforPluto to wearsothathe
couldstrike . unexpectedly . . I tisPlutowhoisoftendeemedthe
oneresponsibleforwinterwhenhecarriedawayProserpineand
madeherhiswifeforsixmonthsoftheyear .
TheastrologicalassociationtothisPathisthatofPluto
whicheffectsthingsonagrandscale . TheeffectofPlutoonus
hereonearthisverymuchliketheseasonsasitgerminates
slowlyandgraduallyuntilacropisharvested . Thisharvestin
thespiritual'"senseisdeeperawareness . I tsenergiesinthe
humanracewillbedeeplyrootedandhighlyconcentratedwhich
couldcausepossibleexplosiveeffects .
ThisPathalsohasadualassociationtothefireelement
whichisruledbytheGovernorSeraph . Thecardinalpointwhich
isassociatedhereistheSouthandisruledbytheArchangel
Michaelduetohisassociationtofire . TheangelunderMichael
isArael(ARAL)andis from therootARmeaning"strongand
vigorous" .
L40/pg 3
L40/pg4
ThemagicalweaponofthisPathistheUniversalFirewhich
isutilised - inboththepracticalandesotericsense,andis
symbolisedbythepyramid
. I ntheritualofthe31 stPaththe
Hierophantsays
:'TheSolidTriangularPyramidisanappropriate
hieroglyphofFire
. I tisformedofthreetriangles,three
visibleandoneconcealed,whichyetisthesynthesisfthe
rest . ThethreevisibletrianglesrepresentFire,Solar,
VolcanicandastralwhilethefourthrepresentsthelatentHeat -
AUD,active-AUS,passive-AUR,equilibrated-whileASCHisthename
ofFire ' . Thespiritualaspectitrelatestoisthedivinepower
called down by theadeptwhich is theastralandtheninturn
activatesthelatentwhichinturnbecomesactive . Thethree
visibleaspectsoffirearethenbroughtintoplaybypractical
workwiththeelementitselfutilisedformagicalpurposes . Fire
initspracticalusageisheatappliedtoanexternalimpetus
overagradualperiodtobringabouttransmutationwhichthenin
turnimpregnatesthematterwiththesaidUniversalFire . Thisis
notactuallycharginganobjectbutmoreinlinewiththetool
oneusessothisendcanbeaccomplished . Thefireprovidesthe
meanstoaccomplishthetaskwhilethesourceoftheaccomplish-
mentmustcomefromhigherspiritualessences .
virtueofthisPathisreformation,andisnottobe
confusedwithrebirthforthisisatypeofchangethatistotal .
Heretheindividualwhoreformshimselfplaceshimselfoutside
normalconcepts,forreformationoftheselfisdoneundercons-
ciousdirectionwhiletherebirthprocess,thoughnatural,is
doneonafardeeperlevel . Toreformis a completeturnaboutin
t
t
1
L40/pg 5
direction and requires a
tremendoussourceofwillpowerthat
stimulatestheintellecttodirectitsvastenergiesinachan-
nelled format .
TheviceofthisPathisentanglementandrelatestoan
individualwhoactuallybeginstostartreformingbutcannot
completetheprocessorreturntohowheoncewas
. Hisspiritual
andmentalfacultiesthenbecomeboggeddownbecausenotenough
energyisavailabletocarryhimthrough
. Hefindshimselfin
semipermanentstateofchangewhichcanonlyhavedisastrous
consequences . Thisconstantstateofunbalanceisanogrowthno
winsituationwithonemerelymarkingtime .
Themagicalpowerorexperienceassociatedhereisthatof
evocation(nottobeconfusedwithnecromancyorraisingofthe
dead)whichgivesonethepowertoassertoneselfinanother
dimension,thencontactaforcerequiredandbringitthroughthe
veilto,thetriangleandcommandofitaservice . Experience
thistypealsoappliesaswelltothespiritsofouranimaland
vegetablekingdomandarchangelicanddemonicspirits . Though
almostanyonecanperformthemechanicsofevocationthereal
featistobeabletodoit .
OnemineraldrugassociatedhereisSeleniumDioxideand
relatesheavilytothemetabolicprocess .
vitaminEandhelpskeep
I tpartnerswith
oneselasticityasanantioxidant . I t
helpskeeptheredbloodcellsfrombeingdestroyedtooquickly
byoxidation
. Thisisadrugthatcouldwellhelpsolvethe
L40/pg 6
ageing'process
. Anothermineraldrugthatapplieshereaswell
is Sodium in its varying forms
disorders and generalweakness .
andhelpspreventnervous
AvegetabledrugofthisPathisAtropineandisanalkaloid
obtained from plants suchasBelladonna . Atropine is astimulant
tothenervoussystemworkingthosenervesprimarilyabovethe
neck .
TheTattvaassociatedtothisPathisTejas(Agni)andisa
redtrianglewithitsapexpointingupwardswhichrelatestoits
upwardlifting vibrational characteristicwhichisalliedtothe
principleofexpansion . Thisrelatestothefireprincipleand
bybreakingTejasdownintofivesubdivisionsonecanpinpoint
thedifferentdegreesofheatandexpansiveenergythatthis I
tattva produces .
OnegemstoneassociatedtothisPathisAlmadinewhichis
darkredincolourandissaidtoprovideenergytothoselacking
inenergy . I talsoreducesfevers . Otherattributionsassociated
toit are thatitcuresimpotencyandbringsdowninflammation .
Thestoneissaidtotransferitsenergiesbackandforthtothe
weareran -' willonlygiveoutitsrayswhencalledontodoso .
OtherstonesrelatedtothisPath
whichcutacrossassociationstootherpaths .
TheplantofthisPathistheHibiscus(Hibiscusspp . )which
hasredcolouredflowers
. Thisflowerissaidtoproducepassion
arebloodstoneandredagate
t
1
t
t
r
I
L40/pg 7
and l ustandassuchrelatestothefireelementduethe
sexualstateofarousalitissaidtobring'oneto . Thiswill
alsoshareadualassociationtoVenusandthewaterelementas
wellbutitismorefieryininstigationandwateryinapplica-
tion
. Anyaromaticthatisfieryinnaturerelatesherewhich
alsocutsacrossassociationstootherpaths.
TheSalamandersaretheFireElementals(sometimescalled
Jinni in Arabic) and are saidto be seenasbeingscomprisedof - a
smokeyhue
. TheirkingiscalledDjinnanditissaidthatthere
areover3,000divisionsofthemovertheearthandaccordingt
ArabicmythologytheyliveinarealmcalledOaf,whichisan
invisiblekingdomwhichsurroundstheearth
. The,Supreme
ElementalKingofthisPathis0hooohatan .
TheArchangelofthisPathisUrielwhichmeans"fire
God"andistheArchangelwhogavebothalchemyandanunder-
standingofthe . kabbalah toman . TheI ntelligenceisAbaddon
whichmeans"destroyer"andaccordingtolegendistheangelof
thebottomlesspit .

TheSpiritisArkhas"firmheavyandred"
whocommandsdivisionandfromthisdivisioncamethebirth
creationitself
. PaimonistheDemonicKingofFireandhisname
isderivedfromPOMNmeaning"tinklingsound"I
:'letherootPOM
means"tostrikePaimonisdirectlyunderLuciferandanswers
onlytohimandhas200legionsunderhim
. Theanimalofthis
PathwhichalsocutsacrossotherassociationsistheLion .
The Holy River relatedhereisPishon .

I nGen . ii . 1 1 it
which compasseth the whole land
This relates to the essence of pure spiritwhich circles
elements .
ASS_OCI A_T_-I QNS
YETZI RATI C TEXT :

PERPETUALI NTELLI ENCE


HEBREW LETTER:

SHI N
TAROT:

JUDGEMENT
EGYPTI AN DI ETY:

MAU
GREEK DI ETY :

HADES
ROMAN DI ETY :

PLUTO
PLANET:

PLUTO
ELEMENT :

FI RE
MAGI CAL WEAPON:

UNI VERSAL FI RE
VI RTUE :

REFORMATI ON
VI CE:

ENTANGLEMENT
MAGI CAL POWER :

EVOCATI ON
MI NERAL DRUG :

SELENI UM DI OXI DE
VEGETABLE DRUG:

ATROPI NE
TATTWA:

TEJAS
GEMSTONE:

ALMADI NE
PLANT :

HI BI SCUS
AROMATI C:

ANY OF FI ERY NATURE


ORDEROF BEI NGS :

SALAMANDERS
ANGEL - ARCH:

URI EL
L40/pg 8
says= 'The name of the first river is Pishon : and that is it
of Havi1 ah where thereisgold' .
I
t
t
I
ANI MAL :
CARDI NAL POI NT :
SUPREME ELEMENTALKI NG :
DEMONI CKI NG :
ELEMENTALRULER :
HOLYRI VER :
LI ON
SOUTH
OHOOOHATAN
PAI MON
SERAPH
PI SHON
L40/pg 9
------

-------
t
1
1
I
1
LESSONS44-46
LESSONS 44-46CONSI STOFTHELECTURESONTHETREEOFLI FEANDTHE
EGYPTI ANGODS(GOLDENDAWNTAPESERI ESI I I ) . UNFORTUNATELY,THESETAPES
ARECURRENTLYOUTOFSTOCK . THEYWI LLBESENTTOYOUASSOONASTHEY
AREAVAI LABLE . YOUMAY,HOWEVER,CONTI NUEWI THTHENEXTGROUPSWI THOUT
LOSSOFCONTI NUI TY .
THANKYOU,
THEGOLDENDAWNTEMPLE
1
1
t
1
1
a
t
s
1
1
Assiah, the material world which is
by the seven churches . I t refers to
Kerubim
plane . Overallit
theMaterial
andtheircounterparttheQlippothalongwiththeastral
and
passesthroughthe
theshellsofthedead .
LESSON41
THI RTY-SECONDPATH
'The Thirty-second Path is the Administrative I ntelligence,
and is so called because it directs and associates the motions of
theseven planets directing all of them in their proper course' .
ThisPathisplacedbetweentheSephirothYesodand
Malkuth . I t is called Administrative I ntelligence . because it
directs and regulates the actions of the seven planets . To it,
therefore, is attributed the due knowledge of the seven abodes of
L41 /pg1
symbolisedintheApocalypse
theAngelicChoircalledthe
representstheconnectingbindinglinkbetween
FormativeWorlds,AssiahandYetzirah, and
astralplane,theabodeoftheelementalsand
TheHebrewletterassociatedhereisTauorThwhichmeans
"mark" or "cross" and it has a numerical value
wordsofthesamevalueareShAaL"Hollow,
ShQ"pushingforward",QSh"gathertogether"
Whenviewedfromanoverallconceptwe
formthatispushedforwardinahumble
400 . Other
ofaconcaveform",
andK?Sh"humble" .
haveaholloworconcave
manner .

Asaletterthe
ancient Egyptians attributed Tau to Thoth which related to the
universalorcosmicmind,whichhasbeenlikenedtothecollec-
L41 /pg 2
tive unconscious . I t constitutestheideaofperfectionandfrom
anesotericconsiderationislikenedtotheAnkhasthesymbolof
life .
TheTarotassociationtothisPathistheWorld . This
depictsanudewomansurroundedbytwelvelargespheresand72
smallerones . Shehasa'scarfsurroundinghereandholdstwo
batonsin each hand and has a seven pointed star beneath her . I n
eachcornerofthecardarethefourKerubs . Thisrefersto
very high spiritual plateau where ones mind is in harmony with
thatofthemacrocosmandallbeatasoneunifiedpulse . Thisis
thelastcardofdevelopmentandshowsanareawheremanhas
transcendedhiskarmicdestinybeforehegoesontoanewlevel
ofexistence .
The Egyptian goddess related here is Mut which means
"mother" . Thisgoddesswasknownundera'varietyofnamesandis
usuallydepictedwithavultureasacrownwiththecrownofthe
northaboveit . MutwasthewifeofAmen-Ra
ciatedtotheSephiraofBinah .

Sheisthepersonification
thegreatmotherthemeandwassaidtohavebeenformedfromthe
godNu . Asagoddessshehadthetitleof'Ladyofthetwo
lands'whichindicatedthedepthofherreigninbothupperand
lowerEgypt .
TheGreekassociationtothisPathisthelegendofGaea .
WhethersheappearedfromChaosornotisnotclearbutshewas
fertilityitselfandboreUranus(thesky) . Oneofthetitlesof
andisalsoasso-
1
1
t
a
1
1
r
1
the festivals of Saturn wasthe removal of chains
L41 /pg
Gaeawas 'deepbreasted' and was possibly a fertility goddess in
heroriginal form . Also she not only had the distinction of being
self created but was the mother of the human race . Her attributes
are many and those wishing the gift of prophecy, or a lasting
marriage and honour would offer sacrifices to her, in later years
she was also said to have had the power tohealthesick .
RomanmythologySaturnisthemythrelatedhereandthe
__partthatrespondsmoretothisPaththanotherlegendis
Saturn'sreignonthethroneofI talywithJanuswhichwascalled
thegoldenagealthoughhumansacrificewasofferedtohim
stoppedbyHercules . Oneoftheimportantthingscelebrated
from
until
the
statuesofthevariousgodformssoillustratethatfreedomand
independencecouldbeenjoyedbyall . Ontheflipsideofthecoin
Saturnwasalsothedevourerofchildren,butthisaspectofhis
naturewasapparentlyonlytransitoryandhelpsremindusthat
positiveandnegativeattributesmustgohandinhandinrelating
tovariousgodforms .
The planetary association here is of course Saturn with its
AngelbeingCassielfromtherootCASmeaning"unity"or"gather-
ing"(whoshowstheunity theeternalkingdom) . The
I ntelligenceisAgiel(fromtherootAGI whichrelates its
Arabicoriginsandmeans"spreading")andthespirit isZazel
(from the root ZA meaning "dart" or "arrow") . I t is said that
ZazelwasoneoftheangelsusedbySolomontohelpcreatelove
potionsthoughheisalsoassociatedwithpreventingsuddendeath .
The cardinal point associated this Path is North
(Tzaphon) and is related to earth which shares a dual association
to Saturn . The Archangel of this Path is Auriel and means "light
of God" . The Angel under him is Phorlak who shares earthwith 7
otherAngels - Admael, Azreil,
Harabael,thoughthese are said to be on a rotational basis with
Phorlak being the Angel who is currently theone to call .
TheTattva here is Prithivi which is often depicted as
yellow square . This Tattva . relates to the senseof smell and its
keywords are cohesive resistance which tends to act as

type
solidification process .
The magicalweapon of this Path is thesickle which relates
to the varying myths of Saturn as aslayer . I n apracticalsense
itissymbolicoftheharvestthathastobecut . Asaweaponit
slaysinordertofeedandallowsregenerationinmuchthesame
processasdepictedintheTarotcardDeath
.
thatareto,beusedin
usuallydoneinoneslashingmotion .
ThevirtueofthisPathcanonlybedescribedasSuper
consciousness,andrelatestothemagicalinfluencesworking
directlyonthementalstimulibygiving_thementalityfthe
individualashotinthearm,sothatonecanperformmental
tasksthatwerepreviouslyimpossibleorextremelydificultto
do .

I tisnotstrictlyspeakinganI Qboostbutanewdimension
L41 /pg
Arkiel,Arciciah

Arieland
Herbsandplants
ritualarecutbythesicklewhichis
I
1
1
of mentality . Old values are thrown away for new ones when the
old ones are too outdated forthis new outlook . This is a striv-
ing andbalancing period for the mental regionsasthe spiritual
impetus uplifts and retunes the mind on both a conscious and
unconscious level .
Hereonegainsaccesstounchartedregionsof
theselfwhichwhencoupledwithgreaterawarenessresultsin
superconsciousness .
Thevice

thisPathisschizophrenia

psychosis'
withdrawingfromreality), whichinthisinstanceisapart
thesuperconsciousmechanismthathasstartedtoinjectintothe
mentalprocesswhichsomehowbecomesoverloaded,(possiblydueto
somestructuralweaknessthathasnotbeenrepaired),andconcen-
tratessomuchonthementalstimulithatonelosestouch_with
realitylivinginafantasyworldtryingtocaptivatetheindivi-
dualspsycheandpreventthemassiveamountofchangethatshould
betakingplaceduringthetransitionofthespiritualenergies .
ThemagicalattainmentorpowerofthisPathis
change
theshapesofthingsthroughinvocations . Theadeptswhohave
thispowerareknownsimplyasshapechangers
. Theyhavethe
abilitytodirectpowerfromoneareaandtransformittoanother
whichbecomesforallintentsand
purposesmattertransference .
the
Thisisnotmerelyanalteringoftheaurawithoutchanging
objectitselfbutacompletealterationofthesubjectmatter
.
ThemineraldrugrelatedhereisCalciumandrelates
variousdrugssuchasCalicumCarbonateandCalciumGluconate
L41 /pg 6
etc . . Calcium is responsible for maintainence of the skel etal
system,bonesandteeth . I nthebloodstream . Calciumhelpsmain-
tainthecorrectbalancebetweenacidandalkalineandalsoin
celldivision . Fluorineisanothermineraldrugrelatedtothis
Path,especiallyinitssyntheticformofsodiumflouridewhich
helpsreduceteethcavitiesaswellasstrengtheningtheskeletal
system . ,
ThevegetabledrugsofthisPathareallthosethatarethe
buildersofthebodytissueandmaintainencerepair . Thiswillof
coursecutacrossassociationstootherpathsandisrathera
group associationthan a single one . Some of these are tinctures '
ofYarrow,CelerySeed,ValerianandPassionFloweretc .
TheI ndianassociationhereisthethreeGunnaswhoare
Sattva,RajasandTamaswhichinfactreflectthementalstateof
theindividualinthreedivisions . TheGunnathatisrelatedhere
isTamaswhorelatestowhatisknownastheTamasicstatef
mind,whichconcentratesmainlyondesireandisthematerial
aspectofmind . Tamasisconsideredasaformofignorance,and
delusionthatonebreaksoutoftoachievetheRajasicstate
whichismoreoutgoingandthenextlevelontheevolutionary
scale . TheBhagavad-gitasays :'Tamasisthedeluderofall
creatures ; it imprisoneth the Ego ina body through
folly,sleep,andidleness . Tamas,surroundingthe
judgementwithindifference,attachesthesoulthroughheedless-
ness . Tamasproducethonlysenselessness,
indifference' . Chapter1 4 .
1
t
L41 /pg 7
Spinel or Balas Ruby is the gemstone associated to this Path
and generally forms octehadral crystals which have a variety of
colours which change underartificial light to adeepviolet . The
psychicvibrationsofthisstonerelatemainlytoitscolour
whichcanbelinkedtosomefundamentalplanetarycolours,though
it stillis associatedtoSaturnbecausethevibrationsofthat
planetseem controlitspowerthroughitsastrological
aspects .
Hellebore(bothblackandgreen)istheplant of thisPath
andhasadualassociationtothearomatic of thisPath . Asa
herbitisastimulantbutiftakeninlargedosescankill . On
thepositivesideitissaidtohavecuredsomeformsofmadness
bybringingtheindividualbacktoreality . Asan i ncense. i t is
usedinritesofexorcism,whereithastheeffectofconsolidat-
ingtheareaarounditwiththeearthelement(whichitdrawsits
ethericforcefrom),andforcesthenegativespiritualinfluence
backtoitsownplaneofexistence .
PhrathistheEternalRiverassociatedhereandrepresents
thephysicalplane . SweedenborgconsideredthatPhrathmeantthe
ultimatestateofthesenseswheresciencewasformed .
TheLegendaryOrderofBeingsofthisPatharetheGnomes
whicharetheelementalsofearthwhoaresaidtolivein the
subterraneanareasoftheearth . Thefeminineaspectsofthese
beingsarecalledgnomidesandaresaidtobeofsmallstature
.
L41 /pg8
TheirElementalKing is called Ghob and the Supreme . Elemental
King is Thahaaotahe .
1 1 1 spirits under him .
The Demonic King of this region is called Amaimon is taken
from the Greek "Maimon"meaning"violence"or"vengeance"andhas
TheanimalofthisPathisaCrocodilebecauseofitsSaturn
likenaturelinkedtothedevourer . I tissaidthatwhenthe
crocodileswimsagainstthecurrentwithanopenmouthitrepre-
sentsthelimitationsofthematerialplane . Beingareptileit
shows a firmentrenchmentinthephysical . Otherassociationsto
it areas aguardiantohell(ifsallowed)anddeceit .
I
1 1
1
I
00990002
Lil/pg 'I
1
YETZI RATI C TEXT : ADMI NI STRATI VE I NTELLI GENCE
HEBREW LETTER: TAU
TAROT : WORLD
I EGYPTI ANDI ETY : MUT
GREEK DI ETY : GAEA
I
ROMAN DI ETY : SATURN
I
ELEMENT : EARTH
PLANET : SATURN
1 1
MAGI CAL WEAPON : SI CKLE
VI RTUE : SUPERCONSCI OUSNESS
1 1
VI CE : SCHI ZOPHRENI A
1 1
MAGI CAL POWER: TRANSFORMATI ON
MI NERAL DRUG : CALCI UM
I
VEGETABLEDRUG : YARROW, CELERY SEED,VALERI AN ETC
TATTWA: PRI THI VI
1 1
I NDI ANASSOCI ATI ON : THREE GUNNAS
I
GEMSTONE : SPI NELORBALASRUBY
PLANT : HELLEBORE
1 1
AROMATI C: HELLEBORE
ORDEROFBEI NGS : GNOMES
1 1 ANGEL - ARCH : AURI EL
ANI MAL : CROCODI LE
1 1
CARDI NALPOI NT: NORTH
I
SUPREMEELEMENTALKI NG : THAHAAOTAHE
ELEMENTALKI NG GHOB
1 1
DEMONI CKI NG : AMAI MON
ETERNAL RI VER :

PHRATH
I
LESSON42
THE FOUR COLOUR SCALES
The colouring of the four worlds of the Kabbalah is some-
thing that has been onlypartlypublishedinbooksaboutthe
GoldenDawn
.Theformationandblendingofthesescalesisavery
intricateandtimeconsumingtaskthatissofinelybalancedthat
errorsincolourmixingareeasytomake .I talsomustbepointed
outthatintheGoldenDawnthereweretwoschools

thought
regardingthecolourgeneratingprocess .Thefirstviewisthat
coloursinthefirstscale(calledtheKingScale)-should
translucentandgraduallyattainbrightnessasoneworkedthrough
tothefinalscale .Thesecondconceptisthatthecoloursofthe
firstscaleshouldbeasbrightaspossible,fortheseareinthe
highest-echelonalliedtotheworldofAtziluth,and as suchare
freefromthetintsofthelowerscalesandtheir
papersforaneasierexplanation .Theformation
L4/pg
associated
worldswhichwouldgraduallymakethecoloursdull bycomparison
tothefirstscale .
Thesecondmethodofcolourdevelopmentistheoneutilised
inthis courseandhasbeenupdatedfromtheearlyGoldenDawn
thefour
scalescolourwasoriginallyI nnerOrdermaterial,butwas
broughttotheOuterOrderlevelsothatmoretimecouldbespent
onsuchacomplexsystemoflearningandunderstanding .
F
THE FORMATI ONOF THE COLOURS OF THE KI NG SCALE
The first three Sephiroth have definite colours associated
and are not generated colours .
The Generation of the Sephiiroth- of the King Scale
KETHER - This is allocated Brilliancebecause it isstrictly
speaking no direct colour but is designated by spirit which is
brilliant white .
CHOKMAH -This is butterfly blue and represents the feminine
passive principle that has evolved fromspirit .
BI NAH - Thecrimson of this Sephira is saidtorepresentthe
masculineprinciple .
DAATH - ThecoloursofthisSephiraareformedfromtheprevious
threeontheratioofKether3,Chokmah2andBinah1 .
CHESED - ThedeepvioletofthisSephiraisformedfromthe
mergingofChokmahandBinah .
GEBURAH-TheorangeofthisSephiraisformedbecauseitisthe
complementary of theviolet of Chesed .
L4 /pg 71
I
and Binah .
NETZACH - The amber colour here is formed from the orange
Geburah and the rose pink of Tiphareth .
HOD - The violet purple here is the complementary of the amber of
Netzach .
YESOD- The butterfly blue of Chokmah unites with the rose pink
of Tiphareth to form the indigo of this Sephira
MALKUTH - The citrine yellow of this Sephira is areflection
the brilliant white of Kether on the top of the tree . Since
brilliance is not a colour, the first colour must be citrine
yellow which is a full colour manifested from what Kether repre-
L42/pg
TI PHARETH - The rose pink of this Sephira is,formed from Kether
sents (this is not a generated colour buta placed one) .
_ The_ Generation of thePathsofthe King gSAI R
Theformationofthepathsisaverysimpleonethatone
couldrelatetheprincipleofthebookSepherYetzirahto .Simply
imagineacolourcircle witheverycolourinthespectruminit,
whichwouldappearbrilliantwhite .Divideitintothreeandyou
havetheassociationtothethreeMotherlettersandthethree
elements .Dividethesecoloursyetagainintosevenpartsandyou
havetheplanetaryassociations .Againdividethesevencolours
bytwelveandyouhavetheassociationtthetwelvezodiac
signs .
NOTE :Thefollowingcolourscalesareconsideredmoreuptodate
versionsofthoseoftheoldGoldenDawnandassuchthoseofyou
whoarefamiliarwiththeoldcolourscaleswillnoteanumberof
changesinthecoloursandtheoddcolourreversalofthepaths,
whichwasneededtobalance
L42/pg4
uptheharmony.Thesescaleswere
developed bymembersoftheThothHermesTempleinNewZealand
andwerechecked(bypracticalandclairvoyantanalysis)by
variousI nnerOrdermembersofthenowdefunctWhareRatemple
whohavebeenexperimentinginstudyofthecolour'scalefor
over50years .
t
FORMATI ON OF THE COLOURS OF THE QUEEN SCALE
The Generation
of the Seehir-oth of the Queen Scale
KETHER - This is againbrilliant white for formlessness contain-
ing all things .
L42/pg 5
CHOKMAH-This colour is described as bluish grey and is the
intermediate colourbetween white and blackish red, the

ast
colourin the spectrum.
BI NAH

This is blackish red, the final colour before black


(which is not really deemed a colour but simply space) and
appears black to the naked eye. (note that black must not be used
here for when one begins to generate the paths blacks basic tint
throws the colour generation completely out of sequence and
roducesa different set of scales .) .
DAATH- This is formulated from Kether working through Chokmah or
a mixture of white and bluish grey and becomes a grey white .
CHESED -The rimary blue of this colourre resents the watery
rinci le and is an allotted colour a shade darker than the blue
of the ath of Mem intheKingScale .
GEBURAH - The rimaryredcolourofthisSe hiraisalsoan
allottedor lacedcolourandrelatestofireandisashade
L4?/ g6
darker than the colour of the ath of Shin in the King scale .
TI PHARETH -The yellow of this ath is also a laced colour and
is said to re resent air, it was originallya colour darkerthan
the ath of Ale h of the King Scale but because it is on the
central illar the brilliance will shine through it
gold effect .
roducing
NETZACH -The green of this Se hira is formed from the merging of
theblue and gold of Chesed and Ti hareth .
HOD - The red of Geburahand thethe goldenyellow of Ti hareth
formtogether to make the orange of this Se hira .
YESOD - The blue of Chesed'andred of Geburah unite with the
golden,yellowof Ti hareth toformthevioletbrownofYesod .
MALKUTH - The colours of this Se hiraare made u of com osite
rays,each forming a se arate section of the Se hira . The red
blue and golden yellow of the second triad form the citrine . The
green, golden yellow and blue colours of Chesed,Ti hareth and
Netzach then unite to formthe olive green section . The red,
orange and violet brown colours then form the russet brown
section . Theblackk_ sectionofthisSe
hiraisanallottedcolour
fortheearthelement(whenconsideringthe rinci leofdescent,
greenisgenerallyonlyusedfortheearthelementwhenthinking
intermsofascentwhichdoesnotreallya
lyhere) .
I
I
1
Generation of the Paths of the Queen Scale
,The aths of the Queen Scale are formed from the following combi-
nation of the Se hiroth .
L42/ g 7
Path SyMbgl Colour combination
11 A KETHER AND CHOKMAH
12 KETHER AND BI NAH
13 KETHER AND DAATH
14
T
CHESED AND DAATH
15
T BI NAH AND CHOKMAH
16 CHOKMAH AND CHESED
17 1-~ BI NAH AND TI PHARETH
18 BI NAH AND GEBURAH
19
1
GEBURAH AND CHESED
20
Crz
DAATH AND TI PHARETH
21
4
BI NAH AND CHESED
22 CHESED AND TI PHARETH
23 NETZACH ANDHOD
24 0-0 GEBURAHANDTI PHARETH
25
10 KETHERANDTI PHARETH
6 HODANDYESOD
GEBURAHANDHOD
28
o YESODANDKETHER
29 NETZACHANDOLI VEOFMALKUTH
30
O
TI PHARETHANDHOD
31 Q HODANDRUSSETOFMALKUTH
32 YESODANDCI TRI NEOFMALKUTH
FORMATI ON OF THE COLOURS OF THE PRI NCE SCALE
King Netzach +

Queen Netzach
King Hod

Queen Hod
King Yesod

Queen Yesod

=
King Malkuth +

Queen Malkuth =
L42/ g a
Prince Netzach
Prince Hod
Prince Yesod
Prince Malkuth(allfour
cornersmixedwithits
counter art)
I
ThisscaleisformedthroughtheunionoftheKingscaleand
theQueenscale .

Forexam le :

Thecoloursfromthefollowing
Se hirothand aths aremixed toformthecolourothePrince
scale .
Generation_ oftheS_ eghi_ ro_ th_ ofthePrince_ Scale
KingKether

+ QueenKether= PrinceKether
KingChokmah Queen Chokmah= PrinceChokmah
KingBinah QueenBinah PrinceBinah
KingDaath QueenDaath PrinceDaath
KingChesed

+ QueenChesed PrinceChesed
KingGeburah+ QueenGeburah= PrinceGeburah
KingTi hareth+ QueenTi hareth= PrinceTi hareth
1
I
King
King
King
King
King
King
King
King
King
King
King
King
King
King
King
King

V/
King

LJ
King
King
King
O
King 0
King
T
17

Queen

Queen

Queen
Queen

Queen
Queen

Queen
Queen
Queen
Queen
Queen
Queen

Queen
Queen

Queen
Queen

Queen _

Queen
Queen

Queen O=
Queen

A_
Queen

I
I T
PrinceScale
PrinceScale
PrinceScale
PrinceScale
L4/ g9
GenerationofthePathsofthePrinceScale
The

followingPathsareillustratedbytheirastrological
associationfora uickandeasyreference .
I D
Prince Scale

T
PrinceScale

b
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale
PrinceScale CT
PrinceScale

0
PrinceScale
PrinceScale
PrinceScale
PrinceScale
Prince Scale, and a heavy influence of Kether
King Scale's Bin zh
invisibles here .
L42/ g10
FORMATI ON OF THE COLOURS OF THE PRI NCESS SCALE
Gener--ation ofthh -e Seehirot-h of the Princess Scale
KETHER, CHOKMAH and BI NAH - are formedfrom the to triad of . the
King, Queen and Prince Scales, the influence of Kether dominating
the colour formation .
KETHER -is brilliant white, rayedwith the
A
(yellow) of the
King Scale in Malkuth (because it is Kether Manifested) .
CHOKMAH - is a combination of Chokmahof Binah and the Prince
Scale with a heavy influence of Kether and flecked with the blue
V)
of the King Scale Chokmah, yellow ( A) of the Maltruthof
the KingScaleandred ( A) oftheKingScale'sBinah . Chokmah
was originallyconsidered the s here re resenting the zodiac
althoughit is thoughtUranusisre resented,inthiscasejust
the
0
ofthetriadcouldbesatisfactory .
BI NAH - is formed by Binah of the Queen Scale and Binah

the
fleckedwiththe
DAATH - isformedbyDaathoftheQueenScaleandDaathof the
PrinceScale .

Daathisneitherfleckednorrayedbeingthe
1
1
I
L4 / g 11
CHESED, GEBURAH, TI PHARETH, NETZACH and HOD are formed from their
res ective Se hiroth in theQueenandPrinceScales .Theflecks
againarefromtheirres ectives heresintheKingScale,but
wherecoloursaretoodarkorsimilartothePrincess
colour,com lementarycoloursareused .
Scale
CHESED - QueenScaleChesed+PrinceScaleChesedfleckedwith
com lementarygoldyellow - whichinturnisanemanationfrom
theKingScale .
GEBURAHQueenScaleGeburah+PrinceScaleGeburahfleckedwith
com lementary.
TI PHARETH - QueenScaleTi hareth+PrinceScaleTi hareth .

NOT
fleckedorrayed .
NETZACH - QueenScaleNetzach+PrinceScaleNetzachfleckedwith
theKingScalecolourofNetzach .

HOD - QueenScaleHod

PrinceScaleHodflecked

with
com lementary.
YESOD

Yesod'scombinationofQueenScaleYesod+PrinceScale
Yesodisasmuchlikethecoloursitwasformedfromthatthe
com lementarycolourwas lacedinYesod
com lementarycitrinealsoseemstore resentthecombinationof
theQueenScale'sMalkuthcitrineandthePrinceScale'sMalkuth
citrinerisingu intoYesodofthePrincessScale .
instead .

This
Yesodis
L42! g 12
flecked with Sagittarius of Atziluth coming from Kether according
to western conce ts .
MALKUTH -being the final stage is the black of the Queen Scale
and Prince Scale Malkuth rayed with Malkuth of the King Scale .
The attern of flecks and rays goes thus :
two end Se hiroth, Kether and Malkuth are rayed holding the
ends of the s ectrum, all the other s heres are flecked exce t
Ti hareth which is neither flecked or rayed .
I
Generation of the Paths_ of the Princess Scale
The zodiac aths are all formed bymixingtheirres ective
athsintheQueenscaleandPrinceScale .These athsare
neitherrayedorflecked .
Theelementsarerayedandnotfleckedas .mentionedin
earliertexts,duetotheattributionofUranus,Ne tuneand
Plutotothese aths .
The athsofthe lanetsandelementsareformedandrayed
thus :-
QueenScale +PrinceScalerayedwithKingScale A
ath .
QueenScale+PrinceScalerayedwithKingScale

ath .
QueenScale+Ketherrayedwith

oftheKingScale .
KingScaleBinah+KetherrayedwithgreenofKingscale ath,:
QueenScale+PrinceScalerayedcom lementary .
0
QueenScale+PrinceScalerayedcom lementary .
LJ
0
0
L421'/ g1Z.
QueenScale+PrinceScalerayedKingScaleNetzach .
QueenScale+PrinceScalerayedKingScaleTi hareth
QueenScale+PrinceScalerayedcom lementary.
QueenScale+PrinceScalerayedKingScale ath .
Com lementarycoloursareusedwhenthereflectionfromtheKingScale
istoosimilartothecolourofthePathinthePrincessScale .
------------------------------------------------------------------
TABLES OF CORRESPONDENCE
(Note :Acolour descri tion has been given alongside the colour
name . This has been given to hel in identification of colour .)
COLOURS OF THEKI NG SCALE
L4 / g 14
t
Path No . Colour Name
-------------------------
ColourDescri tion
-------------------------------
BrilliantWhite
PureWhite
Butterflyblue PaleSoftBlue
3 Crimson
Crimson
Dee Violet Dee Violet
5 Orange OrangePeel
Flamingo ClearRosePink
7 AmberYellow AmberGreyishYellow
ClematisBlue Dee VioletPur le
9 I ndigoBlue
I ndigodarkviolet
10 PrimaryYellow
VividYellow
11 PaleYellow PaleYellow
1 PrimroseYellow GreenishYellow
13 PaleSilveryblue PaleBluishGrey
14 P-irisGreen EmeraldGreen
15 BloodRed Dee Brownish red
16 FlameRed ReddishOrange
17 PersianOrange MarigoldOrange
18 DarkAmber BrowntolightYellowBrown
19 PoisonYellow GreenishYellow
1
-----------------------------------------------------------------
L42/ g 15
20 Yellowish Green Yellowish Green
21 Vivid Violet Violet
22 Grass Green Dee Green to Greyish Green
23 Dee Blue Dee Blue
24 Blue Green Bluish Green
25 Reddish Blue Dee Blue with hidden Red
26 Dee I ndigo Bluish Grey
27 Scarlet Vivid Red
28 Amethyst Violet
29 Ruby Red Ultra Violet Crimson
30 Maize Yellow ReddishYellow
31 Pa rika Red GlowingOrange Red
32 Light I ndigo Dull Violet
Daath Lavender Light Lavender Grey
------------------------------------------------------------------
Path No .

Colour Name
----------------------------------
White
.Bluish Grey 2
COLOURS OF THE QUEEN SCALE
L42/ g 16
Colour Descri tion
-------------------------------
White
Bluish Grey
1
I
Reddish Black Reddish Black
Primary Blue Vivid Blue
Primary Red Vivid Red
Daffodil Yellow Soft Yellow
7 Primary Green Vivid Green
Dee Orange Dee Tawny Orange
9 Dark Petunia Violet Brown
10 Tertiaries (Black, Dee Black, Olive, Citrine,
Tur uoise, Gra efruit, Russet
Venetian Red)
11 Pastel Grey Pale Grey
12 Greyish Violet Light Violet
13 Silver White Silvery White
14 Sky Blue Light Blue
15 Dull Violet DullViolet
16 PorcelainBlue LightGreyishBlue
17 GreyishRed MauveRed
18 OxideRed RedBrown
19 DarkViolet DarkVioletPur le
20 PaleGreen SoftGreen
21 UltramarineBlue VioletBlue/RedBlue
22 Dee Tur uoiseGreen BlueSeaGreen
Daath Verylight Grey GreyWhite
-----------------------------------------------------------------
L4 / g 17
23 Greyish Green Olive Green
24 Jas er Red Orangy Red Brown
225 LightYellow Clear Pale Yellow
26 Olive Brown Greenish Brown
27 Po y Red Orange Red
S Violet Grey Light Grey tinged with Violet
29
t

30
Signal Green
Melon Yellow
Green
Golden Yellow
1 Co erRed Brownish Orange
32 Chocolate Brown Very dark Violet Brown
Path No .
2
6
10
11
12
13
14
15
16
17
18
19
20
21
Colour Name
-----------------------
White
Grey Cadet Blue
Garnet Red
La is Lazuli
Lobster Red
Peach
Green
Greyish Ruby
DarkBluish Grey
Olive, Brilliant Green,
GreenGrey, Brownish
Orange
Greenish Grey
Khaki
Tur uoise White
Co er Green
Old Rose
Se ia Brown
Cinnamon Brown
Mahogany Red
Dark Olive Brown
Lime Green
Dee Blue
COLOURS OFTHE PRI NCE SCALE
L42/ g 18
Colour Descri tion
-------------------------------
White
Greyish Blue
Dee Red/VioletBrown
VeryDee Blue
RedOrange
PastelRed
FernleafGreen
GreyishRuby
DarkBluishGrey
YellowGreen,VividGreen,
GreenGrey,TanBrown
VerylightGreenishGrey
GreyishPur leGreen
BluishWhite
GreyishGreen,moreGreen
than Grey
ReddyVioletBrown
Dee warmOliveBrown
BrownishOrange
ReddishBrown
DarkOliveBrown
LightYellowGreen
VerydarkDee Blue
I
r
I
t

L42/ g 19
22 . Chrome Green Bright Bottle Green
23 Dark Tur uoise Blue Grey Green
24 Teak Brown Dark Brown
25 Oriental Blue Dull Greyish Blue
26 Dee Violet Brown Dee Red Brown
27 Madder Red Madder Red
28 Light Amaranth LightAmethyst
29 DarkMagneta GreyPur le
30 Orange GoldenYellowOrange
31 VenetianRed RedBrown
32 BrownishGrey BrownishGrey
Daath VeryLightBluishGrey VeryLightBluish Grey
10
11
12
13
Path No .
COLOURS OF THE PRI NCESS SCALE
------------------------------------------------------------------
Colour Name
--------------------------
WhiterayedGold
Whitefleckedred,blue,
yellow
LightRedLilacflecked
withCrimson
Verydee BlueAzure
fleckedLemonYellow
CurrantRedflecked
withGreen
ButterYellow
GreenfleckedwithAmber
Ruby Grey fleckedwith
YellowishGreen
OlivefleckedwithBlue
BlackrayedwithYellow
PaleGreenishGreyrayed
withPaleYellow
Sallowrayedwith
Primrose
BluishWhiterayedwith
SilverBlue
L42/ g20
ColourDescri tion
-------------------------------
WhiterayedGold
Whitetingedwithblueflecked
withred,blue,yellow
Pur lishPinkfleckedwithRed
Violet/RedBluefleckedwith
Yellow
RedFleckedwithFernleaf
Green
SoftA ricotYellowOrange
Yellow/Greenfleckedwith
MustardYellow
Dee MaroonGreyflecked
withYellowishGreen
YellowOliveGreenflecked
withBlue
BlackrayedwithYellow
PaleGreenishGreyrayed
withPaleYellow
GreyishPur leGreenrayed
withYellow
BluishWhiterayedwith
SilverBlue
t
I
L42/ g 21
I
14 Cerise rayed with Emerald
Green
Dee RedPink rayed with
Emerald Green
0
I
-15 Greyish Magneta Violet Red Grey
16 Dark Green Dee Grey Green
I
17 Mahogany Brown Dee Red Brown
I
18 Ca ut Mortuum Dee Brown
I
19
I
Green Black
Greyish Yellow
Very Dee Green
Yellow Lime Green
I
21 Violet Blue rayed with
Yellow Gold
Strong Royal Blue rayed with
Gold Yellow
2 Dee Green Dee Green
23 Dull Green rayed with
Cuba Red
Grass
Red
Green rayed with Cuba
24 Agate Rich Brown
5 .Water Blue Greyish Tur uoise
26 Very Dee Olive Brown Very Dee Olive Brown
I
27 Cherry Red rayed with
Amber
Cherry Red rayed with Amber
8 Greyish Violet Pale Violet
I
29 Dull Green Dull Pine Needle Green
I
30 A ricot Yellow rayed
with soft Pink
Orange Yellow rayed with
light Pink
I
31 Russet Red rayed Green Red Russet rayed GrassGreen
I
32
Daath
Greyish Brown rayed Blue
Very light Bluish Grey
Greyish Brown rayed Royal Blue
Very light Bluish Grey
I
I
gxe_ r_ c_ is_ e
L42/ g
Draw u five Trees of Lifeidentical to the exam le attached .
four of them aint each of the four scales, one scale er Tree .
0 the fifth aintthe s heres thecolours of the s heres in the
Queen Scale, and the athsthecoloursofthe athsintheKing
Scale, andthereyouwillhavetheMinutumMundum .
The Minutum Mundum is generally referredto as the Paths of the
King Scale and the S here of the Queen Scale,buttechnically the
MinutumMundum is all colours of creation in their formation
generation .
I
r
I
t
r-rrr~ "Mm-m-rm-do=--
chemeia
LESSON43
ANI NTRODUCTI ONTOALCHEMI CALTHEORY
Whenever the subject ofalchemy is discussed the inevitable
uestionofhowdoesitdifferfrommodernchemistryarises,so
thefirstas ectthatshouldbestudiediswhatalchemyexactly
doesmean .TheOxfordDictionaryconsidersthatthewordalchemy
relatestochemistryofthemiddleages,es eciallyinthe ur-
suitofthetransmutationofthebasermetalsintogold .Afur-
therinvestigationintothenamealchemyshowsthatitisclosely
alliedtotheGreekwordkhemia,whichisthenameforEgy t,is
oftenusedintryingtorelatealchemytoanEgy tiansource .
Unfortunatelythisa earsto beablindas therealfocusof
attentionshould ontheGreekwordKhumeiawhichmeans
ouring .I t
Khumeiaorchemeiawasusedtodescribetheworkofwhatcould
describedto-dayasmetalurgists .

Some400yearslater
L43/ g1
isfoundthataroundthethirdorfourthcenturyA .D .
orkhumeiawasalteredunderArabianinfluencebyadding
the refixAl,formingalchemiaasitwasthencalled .Alisa
refixwhichinjectsuniversalforceintoaword,thedivine,and
is from the Persian root-
:"/
.
Anotherinterestingstoryontherootmeaningoftheword
alchemycomesfromtheAlexandrianGreekalchemistbythenameof
Zosimos(4thcentury)whoconsidereditsoriginslayinthe
legendsoftheBookofChemuwhichre utedlycontainedthe
secretsoftheangelsandwaslatergiventoman .Thisofcourse
t
t
1
1
t
t
i
1
L4'/ g
runss arallel withthebiblicalbookEnochwhichthe
traveller,Bruce,broughtbackfromAbysinniainthe18th
century.
Alchemy,as a science,notonlydevelo edinancientEuro e
and Arabia but in I ndia and China (where it develo ed inde en-
dentlyfromWesterninfluence)aswell .I tisinChinahowever
thattheTaoistdoctrinescombinedthe racticaltaskoftransmu-
tation

metals(asshownbyMarcoPoloinhistravels)but
devotedthemselvestos iritualalchemyaswell . I ndiaalsohad
the
inner
similarconce tsthoughtheiroverallteachingswentmoreto
s
iritualsideandlikethaTaoistsinvolvedthestudyof
transmutation(bymani ulationofthechakracentresinthe
ethericbody) .Atthis oint,whenreferringtothetheoryofthe
ancientsinconnectionwithmetallurgythereisaveryfine
betweenalchemyandchemistryasweknowittoday .Alchemy
transmutationthroughconsistentheatoverlong eriodsoftime,
sometimesyears,onjustoneex eriment .
Though alchemy is most commonly associated to metals it does
infactcoverthethreebasicworldsofanimal,vegetableand
mineral .Theanimalworldismanandrelatestoorganictransmu-
tationthroughmeditativemeansandthisiscalleds
iritual
alchemy
.Thevegetableworldisonewhatcouldbedescribedas
herbalismbutdiffersconsiderablyfromthemundanemeaning
theword .I nthevegetableworldwefindourfirstmajoralchemi-
caldivision .Thisisthe racticaluseoftransmutationofbase
herbsandtheirextractswithoutthes iritual ualitiesusedin
theanimalworld,andthe racticalcombinedwiththes iritual
line
is
the highest as iration

f the alchemistin this world is to turn


L43/ g7
(usingmeditationand or ritual for the im regnation of the vital
forcesofnature) .I nthemineralworldwecometothemeccaof
thealchemistwho,likehis redecessor,usesboth racticaland
ractical/s iritual conce tsinhiswork .I thasbeensaidthat
basemetal
theelixiroflife,forinthe hysicallife,
nothingso reciousasimmortality.
Egy t,alchemyofasortdidexistthoughnooneis
certainhowadvancedtheyweresavefortheseriesofdocuments
binded togetherunder the title of the LeydenPa yrus which
contained an a roximate total of 75 rocesses which mainly deal
withthemineralworld . I tis herethatalchemicalterminology
such as mercury, uicksilver, owdered earth, blood of the
ser ent, seed of Hercules etc are first noticed in any uantity
whichshowsthatthe rocessesweremorethanjuststandard
chemicalreactions .
into gold, however the main goal of the alchemist is
asman,thereis
Thoughearlydevelo ments inalchemyareobscure,their
terminologyismultifaceted .Notonlycanita ly-e uallytothe
recisemomentofanex eriment,ortotransmute a substance,but
itcanalsobeused-in sychologyaswell .BothCarlJung's
mammothworksonalchemyand sychologyandI sraelRegardiesbook
'Philoso hersStone'usea yschologicala roachwhichcanb
tiedinwithWesternhermetic hiloso hy .
Whenstudyingmanyoftheoldalchemicaltextsthestudent
willconstantlyfindhimselfinamaizeofsymbologywhichis
1
t
f
t
r
1
L43/ g 4
often, contradictory due to thefact that (a) alchemists often
used their own sets of rivate symbols, which if com ared with
other sets of alchemical symbols would show overla s, and in many
instancesthe same figure would have a number of different mean-
ings, and (b) certain alchemical manuscri ts were written about a
articular stage anex eriment was at,
to guess what it is or reach it himself on a
before he can understand it correctly.
and thestudent will have
ractical

evel
A good exam le of this are the various 'ste s and stages
cited by alchemists . Some use aseven, eight or a twelvestage
system but this de ends entirely on the alchemist and the ex eri-
ment, seven and twelve stages are the most common though these
even differ in ste allocationwhen laced side by side with
other alchemical texts . At first glance one will think that they
cannot all be rightbut most of them do work, but the ste
allocation is often due to astrological timing which a lies not
only to the timethe ex eriment starts but also must harmonise
with the astrological birth time of the alchemist as well .
I n astrology you have the four elements, in alchemy you have
the four stages which are denoted by their colourings and are
analogous to each other . These are the blackening,reddening,
yellowing (this stage was dro ed about the 16th century in
favour of only three because it was atransition stage and diffi-
cult to observe) and the whitening . For the ur oses of balance
the yellowing state has been reintroduced though modern
alchemists consider it a art of the reddening .
L43/ g 5
Th

e next ste is a seven stage system made famous by


Paracelsus who linked each alchemical ste to the energies of the
seven lanets . Some of the ste s have been laced in varying

order by alchemists but this


ste s a ly to the workings on a articular metal which they
start to transmute that have a direct bearing on the order of
ste s taken . I f one started to transmute iron then co er
would adjust his re aration to start with the energies of the
metal he is to start with . The following seven stage system is in
ismainlyduetothefactthatthe
factanam lificationofthe reviousfourstagesystem . This
can be identified by colour which showed that a more discerning
eyewasneededtoidentifythesevenste sthanthefour .
1 .Calcination
2 .Sublimation
3 .Solution
4 .Putrefication
5 .Distillation
b .Coagulation
7 .Tincture
Wenowcometoatwelvestagesystemofalchemywhichisa
furtherrefinementofthesevenstagesystem .Againcolouriden-
tificationis aramountandatwelvestagesystemevenmore
com licated .Theseenergiesarealliedtothezodiacsignswhich
areasfollows :
1 .Calcination
2 .Dissolution
3 .Se aration
t
I
4 .Conjunction
5 .Putrefication
6 .Congealation
7 .Cibation
8 .Sublimation
9 .Fermentation
10 .Exaltation
11 .Multi lication
12 .Projection
I nalchemythereareinfactthreebasic rinci lesthatall
alchemy attains to and this is the se aration of the sul hur,
saltandmercuryfromthe rimeamateria.Thisnotonlya lied
tothe hysicalex erimentsbuttothealchemistaswell,because
transmutationisa rocessofgiveandtakewithnotonlythe
rimea materia of the ex eriment undergoinga change but also the
director thatforcewhichisofcoursethealchemist .I n
KabbalisticterminologytheYechidahrelatesPhiloso hical
mercury,Chiahtosaltandthesul hurtotheNeshamah,allof
whichare uitea artfromthefourortwelvestagesofalchemy .
SomeyearsagointhebookPhiloso hersStone,I srael
Regardieex oundedthemagnetictheoryofalchemywhichinfact
isthecoreessenseoftransmutationa lyingtowhatha ensto
thealchemistaswellastheex eriment .
L43/ g6
Thealchemistofold
when erforminghisex erimentwouldstart revitaliseand
change artofhisaura (i .e . itsmagnetic uality)whichwould
literally assonamagneticchargetothemetalor lantbeing
mani ulatedandwhichwouldgivetheneededlinkbetweenalche-
the control mechanism to transmutation . The
tender care and devotion, and in many
L43/ g7
mist and ex eriment . This as ect of alchemy is vital and it is
forging of the magne-
ti'c link during the ex eriment was not always done on a conscious
level by the alchemists of old and in modern times alchemical
ritual work has been introduced to establish this link on
conscious level to control and mani ulate it . I t isusuallyt
this ointthatthefailureoccursinanex erimentevenwhen
astrologicaltimeshavebeencarefullyworkedoutbeforestart-
ing .Fromasim listicview ointtheauracanbebrokendowninto
sevensheaths(ortwelveforthatmatter),andwhenthelink
duringtheex erimentiscorrectlycontrolled(suchasduring
ritual)eachoftheseinturnestablishes a ra ortorlinkwith
the lant or metal to be worked on .
I fonewasusingametallikeco erhewouldactivatethe
artoftheaurathatwouldbeinem athywithco erandthe
ste sorstageswouldstartfromthis oint .Theoldalchemists
usuallyunconsciouslyestablishedthisra ortatfirstduring
lantormetalselectionasitwasdonewithgreatcare .The
resultbeingthattheselectedmaterialwouldbecaredforwith
instancesforthealchemist
itbecamealivingbreathingorganismthathenameda ro riately
(whichwasusuallyafigurefrommythology) .
SUGGESTED READI NG LI ST
Philoso hersStonebyI .Regardie
AlchemistsHandbookbyFraterAlbertus
Alchemy re-Egy tianLegacy,MillennialPromisebyR .Grossinger
AlchemytheGreatWorkbyCherryGilchrist
i
t
I
Gold ofa Thousand Mornings by Barbault
The Alchemist of the Rocky Mountains by Frater Albertus
Alchemists and Gold by Jac ues Sadoul
Suggestive I n uiry into the Hermetic Mystery by Mary Anne Atwood
Metal Magic by Mellie Uyldert
Lexicon of Alchemy by Mar
I r
in Ruland
L49NI aL TRAI NI NG
THOUGHT CONTROL (continued)
_ execsi_ s_ e
By now you should be ade t at controlling your thoughts at will,
even to thestage of stilling your mind, and have taught youself
to focus on a single oint,thoughtorimage.

Donotenteror
L43/ g8
looseyourselfinthatthoughtorimageasthatisweakness of
Will,foryoumustmakeallmovementsorthoughtsthroughWill
alone . Now dothefollowingexercise :
Youmustlearntostillyourmindand reventanythoughts'atall
fromentering .Youmustnotoccu yyourselfwithanyinruding-
thought
.Theymustbedissolvedimmediatelyuntilyouattaina
selfinvoked fully consciousblankness(stillness)ofyourmind
withatotalawarenessandalertness .Setasideyourown rivate
timeto racticethisuntilyoucaninvokethisstate of mindat
aninstant .Thefollowinglectureswillassistyouinthis
exercise .Kee thisexerciseforthes anofyourlifeasit
shar ensyourmind,strengthensyourmemory,awarenessand
consciousness .
1
1
1
LESSONS 47TOSb
GEOMANTICDIVINATION
Geomancyis methodofdivinationusingrandomdotsor
dashes. withinaframeworktoformulateasynchronisticconcept
alliedtothe16subdivisionsofthefourelements . Bystudying
themeaningsofthefourelementsandandapplyingthemtothe
randomanswersgeneratedbythedotsanddashes
a logistical
conceptofmeaningisgraduallydeveloped . ThetermGeomancy is
from'Ge'meaningEarthand'Manteia'or' Mancy'whichmeans
divination. thoughitwaswellknowninAfricaandAsiaundera
varietyofothernames .
ThestructureandmethodofGeomanticDivinationasgivenin
thesecombinedlessons is infactanupdatedversionfromthose
givenintheoriginalGoldenDawndocuments(seetheComplete
GoldenDawnbyI . Regardiefortheoriginallectures)whichhas
beenformulatedoveranumberofyearsbymembersoftheOrder .
Thoughgeomanticfiguresareasociatedtoplanetsandsigns
itmustb

understoodthatthemeaningofthefigureis
combination_

theelementfirstthentheplanetandsignto
lesserdegree . Toexplainthis,considerthatGeomanticrays
comeupfromtheearth . Theseraysarenottheraysofthesolar
system or anythingexternaltothisplanet . Nownothingisfixed
in theheavensoronearthandastheearthspinsdifferentrays
emanate from it and meet those coming from the heavens at
different times. This is very similar totheaspectsbetween
planetsorfusionsbetweencertainelementsorchemicals,withall
creatingdifferentreactions . Examplesofthesereactionscanbe
seenbycertaineventsontheglobe,suchasflashfloods,
revolutions,earthquakes,increaseordecreaseinthefinancial
economyand so on . Otherlesshappeningsarealsotheinfluences
ofthemeetingsoftherays .
ThefollowingsigilofMalkuthisappliedtotheSephiroth
andisusedinconjunctionwiththeGeomanticfiguresasthe
KabbalahisneitherplanateryorTerrestialinapplicationbutis
aunifiyingconceptinwhichcanbefoundbothenergies. Whenthe
processofthemacrocosmandthemicrocosmisutilisedsuchasit
ishere,theearthelementandtheastrologicalhousedivisions
becomeatypeofsynthesiedoutletfortheseenergies .
Undertheoldsystemthespiritoftheplanetswereutil . ised
asthepresidinggeniuswhichtendedtogroundorpartly
immobilisetheirnegativeinfluencesbydirectingittolinkup
withtheearthelements. Thedivinenamesactingthroughthe
sigilsawakenedtheelementoftheplanetaryraywithinthemthus
synthesingtheircurrentorforce . Thiscreatedsomethingofan
imbalanceasthesigilsorsealswhichdidnotcomefromthe
planetarysquares,notbeingcompatiblewiththeGeomantic
figureasitworkedfromanentirelydifferentstructure . The
sigilofMalkuthisobtainedthroughtherayoftheRoseCross
(tobeexplained in laterlessons)whichisperfectlybalanced
1
1
1
1
l
1
t
1
and utilises the energiesof this Sephirah through the World
Assiah thuscontaining and limitingthe astrological influence.
Before a working is begun the studentmust decide what
planetary catergory the questions falls under then drawing the
invoking pentagram of earth (remember you invoke my going the
oppositedirection to banishing whichis from northtsouth
west) vibrating ADONAI ha-ARETZ then trace the sigilthe
Malkuth inthecenterofthePentagram . Bydoingthisthestudent
opensupwithinhimselfthevitalforceswhichlinktotheearth -
fortheprocessofdivination .
SUN

- Vitality
MOON

- Emotionalmatters
MERCURY

- Relationshipsandcommunications
VENUS

-Sociallife,love,artiisticpursuits
MARS

Energy,quarrels,action
JUPITER

Wealth,health
SATURN

Consolidation,disapointment,duty
URANUS

Unexpectedchanges
NEPTUNE

- Deception
PLUTO

- Death
ft
THESIGILOFMALKUTHASAPPLIEDTOTHEBODYOFMAN
AnadditionalmethodofutilisingthesigilofMalkuthisonceyouhave ,
tracedthesigilinthecenterofthepentagram,thenthroughcreative
visualisation,tracethesigilofMalkuthwithinyourownbody . Thismakes
surethattheautomaticforceswithintheselfthatformulatethefigures
workentirelythroughMalkuthanditisagoodsafeguardto'groundingthe
figuresandpreventingoutsidedisturbance.
t
1
GeneralMeaningsofGeomanticFigures
The followingmeaningsofthefigures,. ,ebasedonthemoderninterpret-
ationofthe

Geomanticaspectofthefigures . Theyarecompiled
fromamixtureoftheearthelementsandtheastrologicalmeanings.
Purer
Thisfigureshowstheinitialthrustofenergyinanewproject . There
isacautionthatthisthrustwillbeshortlivedaspeoplewiththis
typeofenergytendtoburnthemselvesout . Thisintensifiedtypeof
energyifdirectedcan push againstalloddsandwin. Theimportant
thingtoconserveisthatthisenergydirectedtowardsanobjector
projectistheinitialimpetusonlyandisgenerallyusedbyan
individualwhohasmadehismarkand who isalreadyinapositionof
powerandauthoritytodoso .

0
TV
8
Amisso ~ ,
Thisfigureshowsnotonlyalossofgoodsbutalsoin. anemotional
sense,beingcutofffromoneshomesandlovedonesaswellasinthe
businessaspectalso . Theretendstobeajealousstreakinthe
individualwhowillcausehisownproblems .
Albus~ ~

0
Thisfigureshowsatremendousenergyofintellectandwhoisconsistantly
onthegoinsearchofintellectualpubsuits
. Warningsareindicated
thoughduetonervousexhaustionbecauseofthisintellectualcuriousity
whichtendstobogtheindividual down . in thepartwhileforgettingthe
whole. Alsothisfigureshowsalackofpracticaleffort
.

Q
I
Populus

'Pr9
Thisshoesmaterialemotionstakentotheextremeresultinginau
extremesensitivityoftheindividual
. Alsothereisstronghintsof
psychicability
. Whilethereisagreatdealofinstabilityherethere
isastructureofsortsthatshowssometypeofpossibleoccultmode
oftransformationtakingplace. Duetothe reflective natureofthe
waterelementPopuluscanactasatypeofpsychicconductor
. Atany
rateitshowstremendousunderlyingpowerattributedtotheunconscious.
FortunaMajor
Thisisagenerousfigurewhichshowsgoodfortunecoming to theindivid
ual .
Thesunherebestowsitswarminfluencetothoseunderit
. Itis
warmthfromabovedescendingbelowwhichhasatypeofconducive
qualityaboutit.
3
Conjunctio
Puella

. '
Is

0
side of mans nature.
T
'P? A
This shows success in thecommunicative field as well as financial as the
practical outlet for intellect. There is a great deal of precision and
analysis indicated by this figure of partnerships and meetings.
0 -A-
1
Adornment of beautyis the key phrase surrounding this figure,hence
beautiful things and people are showntorepresentPuella. Wealth,artand
intellectareshownhereasthe individualtriestoachieve themthrough '
atremendouseffortofwillbyadheringtohistruewantsanddesires .
Thereishoweveraverystrongsuperficialqualityattachedtothewaythe
wantsanddesiresareachieved.

f
0
Rubeus

Thetraditionalmeaningofthisfigurewaspassioa,viceandafierydispos-
itionwithanemphasisonsexualoverindulgence . NormallyMarstookthe '
placeofthisfigureinitsRetrogradeposition(consideredadversefor
Geomanticpurposes) . Rubems however relatestoPluto,oneoftheslower '
movingplanetsandrecentlydiscoveredin1930 . Because=o fRebeus's
association toPlutoitsadverseeffectswillnotbehighlighted,theovCl
allmeaningwillbeconsideredwhencombinedwiththeGeomanticraysof
theearth. Rubeusisafigureofregeneration,goingthroughthepains
ofrebirth,averynecessarypartofthegrowthstructure . Itsignifies
1
endofamatterornearitscrucialpointwhickcausesalot o4 stress.
is anecessary evil toput up withifthegrowthfactoristocontinue. Thl
raysofPlutoheregomuchfurtherthantheMartianinfluence,itshows
painbutgivesushopeforthefuturebyimmediatereliefbutonlyafter
suffering. Thisdoesnotmeanthatonehastobeamatyrbutrathershow#e
outcomeofouractionsifwetakeaparticularline. . Thereismuchis
commonheretothepenetrationofthe virgin, painbeforeextacy,each

'
neededforpersonadevelopment .

Acquisitio .
Thisshowsspiritualgainandinsightasthefigure represents mansques~
forhisspiritualtruth
in theformofesotericideas,heavilyinfluenced
byreligion. Thisfigureshowshowmanappliesstructureandordertothe-t
beliefbyhisintellect . Thereisnoindicationofmaterialgain. here,on: 1- - I
spiritual . Ifmaterialwealthdoescomeitwillonly be throughthespir--_ . ual
1
I
Carcer
This figure shows drive and energyputintoaction as thestrugglefor
attainmentofonesgoalsbegins . Theoldmeaningofthisfigurewas
boundorprisionbutthisshowedmerelyoneaspectoftheGeomantic
figure. Thestruggleforsuccesswithitslimitationsimposed. Herewe
seeastrugglebutwithasenseofpurposebehinditwhichisconsiderable
alongwithaseriousmindeddignity,
. .
Tristitia ; ;
Thereisatendencyforthisfiguretodiscardtheoldinsearchofthe
thenew,reformationasakeywordofwhatthisfigurerepresents. This
isacertainhumanitarianaspectassociatedherebuttheoldmeaningonly
consideredtheupheaval,partofthereformationstructurebutnotthe
reasonbehinditnoritsbentfitswhichisusuallyfor all toben2fit fro . -t .
.
Laetitia
T
7 V
Thisshowsthedevelopmentofanewageofthoughandfeelingonahigher
evolutionarycyclethanbefore. Herealltheintellectandmaterialface~ . a
expandwiththenewawareness . Everythingisnowrecognisedforitstrue
value.
v~ e
CaudaDraconis

;
Thisshowstheobjectivityoftheindividualwhoisabouttogointo
anotherareaofdevelopment. Manhasachievedhisstatusthroughpastefforts
Thereishoweveratypeofrestrictionherebecauseofmanspastcondition-
ing whichheshouldaltertosuitthecircumstance . Thispastconditioniu,~ ,
canholdtheindividualbackthoughfromthispointonifheisnotcare Vi. ; . .
Thepersonheremustmasterhisowndestinyifhewishestoadvancefurtbnr .
CapntDraconis
v
n
ThiswascalledEnteringthethreshold ' andwhileCauda-Draconisshows
thepreparationoftheexitthisshowstheactualspherewhenoneenters
asituation. Ithasanexpansivequalityaboutitwheretheindividual
has arrivedatthegivensituationwhichhintsatafavourableoutcome
butstillitisuptotheindividualtomakethebestofhissituation
FortuneMinor ,
I
. . o Vt
Thisfigureshowsacontrolledandwellbalancedmentalandphysical

'
aspecttowardsagivensituationaswellasanabundanceof energy to
followtheprojectthrough. Itshowsgoodaspectsandleadershipqualitie
butwarnsaboutpossibleproblemswithegooverinflation.
Via )---~

,
Thisshowsastrongemotionalintensitymakingswiftchangesintemp'keaent
andlocation. Itindicatesthatpastconditioningwillbeamajorproblem
toovercomeaswellasadjustingtotheeverchangingemanationsemitted
bythisfigure .
1
MethodofConstruction
The figures of Geomancyconsist of various groupingsof odd
and even points in 4 lines . Ofthese thegreatest possible number
ofcombinations is 16 . Thereforethese 16 combinationsof odd and
even points arranged onfourlines are the 16 figures
Geomancy . These are again classedunder the heads
elements, planets and signs while the
Caput andCauda Draconis or the Head and Tail of the Dragon (the
North andSouth Nodesof the moon) . Furthermore,toeach planet
and sign certainplanetary spirits are attributed .
Roughly speaking, the mode of the firstfour Geomantic
figures, from which the remainder of the Divination is
calculated, is by marking down on paper with a pencilheld by
loosely tensed hand 16 lines

f points or dashes, without


counting the number placed in each line during
should be done very rapidly. When the 16 lines are completed,
the number of points in each line should be aded up,and if the
result be odd, a singlepoint or cross should be made in the
first of the three compartments to theright of the paper . If
even, two points or crosses. The 16 lines are presented below .
a
remainder are attributed to
the
theoperation . It
QUESTION :
HOUSE :
LEFT WITNESS RIGHT WITNESS JUDGE
These yield fourGeomanticfigures . Theresults,oddand/oreven, oflines1 to4
inclusivecomprisethefirst figure,ofFortuna Minor. Oflines 5 to8thesecond
figire ; . oflines 9to12thethird ; oflines13to16,the4thFigure,asshowninthediagram .
s#6
3
I
15pointsodd
15pointsodd
16pointseven
14pointseven
15pointsodd
16pointseven
15pointsodd
14. pointseven
12pointseven
f6pointseven
9pointsodd
. -7pointsodd
10points - even
11pointsodd
10pointseven
10pointseven

.
PLANOFGEOMANTICDIVINATION
ii
FortunaMinor
Amissio
FortunaMajor
Rubeus
Apencilispreferabletoapenforthistaskoftracingthedots . Otherwise,usea
contemporaryfeltpenormarkingpenwhichisidealforthispurpose . It is practicallymore
convenienttodraworrulefourlinesacrossthepaperbeforehandtomarkoffthespace for
suchfourlinescomposingaGeomanticFigureasshownonthepreviouspage .
ThefirstfourGeomanticfiguresformeddirectlyfromthe16linesofpointsarecalled
TheFourMothers. Itisfromthemthattheremainingfiguresnecessarytocompletethe
Geomanticschemeofdirectionarederived .
Theseshouldnowbeplacedinarowfromrighttoleft,forthegreaterconvenienceofthe
necessarycalculationthoughmuchpracticemayrenderthisunnecessary . Thefirstfigure
willbe. attributedtotheSouth,theSecondtotheEast,theThirdtotheNorth,andthe
FourthtotheWest.
THEFOURMOTHERS
4th

3rd

2nd

1st
Rubeus
Albus
Fort. Maj. Amissio

Fort. Minor
FromtheseFourMothers,fourresultingfigurescalledtheFourDaughtersarenow tobe
derived,thus: TheuppermostpointsoftheFirstMother,willbetheuppermostpointsof
theFirstDaughter. Thecorresponding,thatisthefirstlineof,pointsoftheSecondMother
willbethesecondpointsoftheFirstDaughter. ThesamelineofpointsoftheThirdMother
willconstitutethethirdpointsoftheFirstDaughter . ThesamepointsoftheFourth
MotherwilllbethefourthpointsoftheFirstDaughter. Thesameruleappliestoallthe
figures.
ThesecondlineofpointsofthefourMotherfigureswillcomprisetheSecondDaughter .
ThethirdlineofpointsoftheFourMotherswillcomprisetheThirdDaughter,andthe
fourthlineofpointsoftheFourMotherswillcomprisetheFourthDaughterandsoon .
Applyingtheaboverulethroughout,thefollowingwillrepresenttheFourDaughters:
4th

3rd

2nd

1st
Conjunctio Career
I2
FortunaMinor
I
These,againfortheconvenienceofthebeginner,arenowtobeplacedonthelefthandof
theFourMothersinasinglelinefromrighttoleft .
Four Daughters

Four . Mothers
Sib

71b -

6111 Sib

4tb

3rd

2nd
Con-

Cues

Fort.

Rubeus

Fort.

Amissio

Fort.
Junetio

Minor

Major

Minor
Fromtheseeightfigures,fourothersarenowtobecalculatedwhichmaybecalledthe
FourResultants,ortheFourNephews. Thesewillbethe9th,10th,11th,and12thfiguresof
thewholescheme. TheNinth-figureisformedfromthepointsofthefirstandsecondfigures
comparedtogether. TheTenthfromthe3rdand4thfigures; the11thfromthe5thand6th
figures,the12thfromthe7thand8thfigures. Theruleistocompareoraddtogetherthe
pointsofthecorrespondinglines . If,forinstance,thefirstlineoftheFirstMotherconsists
ofonepoint,andthefirstlineoftheSecondMotheralsoconsistsofonepoint,thesetwoare
addedtogether,andsincetheyformanevennumbertwopointsaremarkeddownforthe
firstlineoftheResultant. Iftheaddedpointsareodd,onlyonepointismarked forthe
resultingfigure. TheNinthfigureofConjunctioisthusformed .
FirstFigure SecondFigure

Conjunctio .
1st
Now thefirstfigurehasonepointatthetop,thesecondfigurehasonepointatthetop
-togethertheymaketwo,anevennumber,thusmaking2pointsforthenewfigure . Thefirst
figurehasonepointonthesecondline,andthesecondfigurehastwopointsonthesecond
line. Togethertheymakethreepoints,anoddnumber,thereforerepresentedbyonepoint
inthenewfigure. Therestfollowsimilarlyandisrepresentedagainbythefigure below.
13
4
Four Daughters
$ th

t+ th
Cow

Career

CONJUNCTIO
TheotherResultantsarecalculatedinpreciselythesameway :
InthiswayareyieldedthefourResultants :
12th

11th

10th

9th

.
Rubeus

Acquisitio

CaputDrac.

Conjunctio
AndthustheTwelvePrincipalFiguresoftheGeomanticschemeofDivinationare
completed. Theseagaincorrespondtothe12AstrologicalHousesofHeaven,withwhich
theywilllateronbecompared .
ForthegreaterassistanceofoneDivinerinformingajudgmentuponthegeneral
conditionoftheschemeof12figuresthusfarobtained,itisusualtodeducefromthemthree
othersubsidiaryfigures. Thesethreeareoflessimportancethanthetwelveprevious
Sth

4th
FourMothers
!f .

Fart. Rubes Foot.


Miaot

Major
Aims

Fort.
iat
Minor
1
1
/S
figures,andarenottobeconsideredatallinthelightofcomponentfiguresofthescheme,
butonlyasaidstothegeneraljudgment. Theseotherfiguresareknownas theRight
Witness,LeftWitness,andtheJudge .
Thetwowitnessesarewithoutsignificanceinthedivination,exceptastheyaretheroots
fromwhichthefigureknownastheJudgeisderived . TheRightWitnessisformedfromthe
9thand10thfiguresbycomparingthepointsinthemannerbeforeshownintheformation
oftheResultants. Thatisthecorrespondinglinesofpointsinthetwofiguresarecompared
together,andtheaddition,whetheroddoreven,comprisesthepointsoftheWitness . The
LeftWitnessrepresentsthecombinationinasimilarmannertothel1thand 12thfigures.
TheJudgeagainisformedinpreciselythesamewayfromtheTwoWitnesses,and is
thereforeasynthesisofthewholefigure .
Ifhebegood,thefigureisgoodandthejudgmentwillbefavourable ; andviceversa.
Fromthenatureoftheformationofthe15thfigure,theJudge,itshouldalwaysconsistof
anevennumberofpoints,andneverofodd . Thatis,addingtogetherthefourlines of
points,comprisingtheJudge,theresultshouldbeanevennumber. ForiftheJudgewerea
-figure
-ofoddpointsitwouldshowthatamistakehadbeenmadesomewhereinthe
calculation.
TheReconcilerisa16thfiguresometimesusedforaidingtheJudgmentbycombining
theJudgewiththeFigureintheParticularHousesignifyingthethingdemanded . Thus,in
theprecedingscheme,theJudgeformedisPopulus,andtheSecondFigure,beingAmissio,
theircombinationalsoyieldsAmissio.
InordertodiscoverwhereThePartofFortunewillfall,addtogether all thepointsofthe
firsttwelvefigures. Dividethatnumberbytwelve,andplacethePartof,Fortunewiththe
figureansweringtotheremainder. Ifthereisnoremainderitwillfallonthe12thfigure . The
PartofFortuneisasymbolofreadymoney,moneyincashbelonging totheQuerent,andis
ofthegreatestimportanceinallquestionsofmoney.
I
While the position of a geomantic figure in a house can give
one a rough idea of the entire circumstances the question touches
you can first should be familiar with the house system
astrologyand some keywords for each house.
First House (Ascendent)
Life, health, querent etc .
Second House
Money,property, personal worth.
Third House
Brothers, sisters, news, short journeys, etc.
Fourth House
Father, landed property,inheritence,grave, end of matter.
Fifth House
Children, pleasurefeasts,speculation .
SixthHouse
Servants, sickness, uncles and aunts, small animals.
Seventh House
Love,marriage, husband or wife, partnerships,associations,
public enemies and law suits.
Eight House
Deaths, wills, legacies ; pain,anxiety, estateof deceased .
)L
1
Ninth House
Long journeys, voyages. Science, religion, art, visions and
divinations .
Tenth House
Mother,rank and honour,

trade or professian,authority,
employment, andworldly positiongenerally.
Eleventh House
Friends, hopes and wishes .
Twelfth House
Sorrows,

fears,

punishments,

enemies

in

secret,
institutions, unseen dangers and restrictions
I7
1'7
HOUSEDIVISION METHOD
ANGULAR HOUSES
MOTHERS

HOUSE 1
4
4

10
SUCCEDENT HOUSES
DAUGHTERS

HOUSE
2

5
J 8
11
CADENT HOUSES
NEPHEWS

HOUSE
9
4

1
An Angular Housearethe main or most powerfull houses
placed on the zodiacwheel due to their
the houses thatinitiate events .
. 0
key positioning and are
SuccedentHouses are the intermediate houses separating the
1
1
I
Angular Houses from the Cadent Houses .
CadentHousesare considered the finishing houses for the
show the completedpart of the undertaking .
The diagram below shows the houses placed on the horoscope
wheel

The inside ringshows the number of the inside house


division and represents the field of experience. The geomantic
of figure is the the initiating force acting through the field
experience and the signs show how this will come about . Since this
geomantic figure appliesto a planet
to a planet) one then could, if they wish, place the planets in
thezodiac wheel as wellfor an easy reference .
4
(in somecases two figures
=--====-=--=-=---i

~~~~~~~~~ ~~~~~ ~~~~ ~~~ ~~~ ~~~~~ ~ ~~ ~ ~ ~~ ~~~


~~~ ~~~ ~~~~ ~~~~~~~~ ~~~~~~ ~~~~~~~ ~~~~~~ ~~~~~
~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~ ~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~ ~ ~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~ -- ~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ -~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~ ~ ~~~~~~~~~~~ ~
~~~~~~~~~~~-~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~
~~~~~~~~~~~~~~~~~

~~~ ~~~ ~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~ ~


~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~ ~
~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~ ~ ~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~
~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~
~~
~~~~~~~-~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~

~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~
~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~ ~
~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~
~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~ ~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~
~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~-~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~ ~~~~~~~~

~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~-~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~
~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~

~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~-~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~ ~
~~
~

~~~~~~~~~~~~~~~~~

~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~-~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~ ~~~~~~~~

~~~ ~~~ ~~~~~~ ~~~ ~~~~~~~~~


~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~-~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~
~~ ~

~
~~~~~~~~~~~~~~~~~~~~~~~~

~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~~~ ~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~
~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~
~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~ ~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~ ~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~ ~~
~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~
~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~
~~~-~~~~~~~~~~~~-~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~
~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~
~~
~
~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~ ~~~~~~~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ ~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~
~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~ ~
~~~~~~~~~~~~~-~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~

-
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~
~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~-~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~
~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~
~~~~~~~~~~~~~ ~~~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~ ~~~~~~~~~~
~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~
~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~

~
~
~

~~~~~~~~~~~~~~~~~~

-
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~-~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~
~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~ ~ ~~~~~~~ ~~~~~~~~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~
~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~ ~~ ~~~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~
~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

~~

~~~~ ~~~~~~

~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~ ~~~~~~~~~~


~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~ ~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~ ~~~~~ ~~ ~~~~~~
~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~~~~~ ~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~ ~~
~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~ ~~~~~~~~~
~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~ ~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~
~

~
~
~

~~~~~~~~~~~~ ~~~~~~

-
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~
~~~~~

~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~ ~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~ ~~~~~~~
~~~~~~~~~~~~ ~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~

~~~~~~-~~~~~~~
~ ~
~~~~~~~~~ ~~~~~~

-
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~
~~~~~~~~~~~~ ~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~
~~~~~~~~~~~~~~~~~~~~~~~ ~~~ ~~~~~~~~~ ~~ ~~~~~~~~~~~~~~
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~

~
1
r
Car cer in-the1 stHouse
Evilexcepttofor tifyaplacesaystheoldjudgement.
Thisisadepr essivesituationwher etheonlyhopeone hasistobestill
andnotattempttodoanything,
Car eer inthe2ndHouse
GoodinSatur ninequestions ;elseevilsaystheoldjudgement .
Thisshowsaslowandsteadybuildup in allthingswhichar ecar efullyplanned
andexecuted.
Car eer inthe3r dHouse
Evilsaystheoldjudgement .
Thisshowsanindividualwhoiscautioustotheextr emeandalsoshowsaver y
slowappr oachmentofasituationwhichcanbebadwhen.instantactionis
calledfor .
Car cer inthe4thHouse
Goodonlyfor melancholysaystheoldjudegement .
Thisshowsanindividualwithser ver e anxiety pr oblems,especiallyaboutthe
home. .
Car cer inthe5thHouse .
Receivealetter withinthr eedays,evilsaystheoldjudgement,
Restr ictioninthefieldofsexual activitywithaver yconser vative
attitude.
Car cer inthe6thHouse .
Ver yevilsaystheoldjudgement .
Becauseofonesalmostclinicalappr oachtopr oblemsanddetailyougain
enemysbecauseofthealmosttotalneglectfor humanfeelingyouhave .
Car eer inthe7thHouse
Evilsaystheoldjudgement .
Thisshowsthatoneisoutoftunewiththeideasandthoughtsofones
par tner .
Car eer inthe8thHouse
Ver yevilsagstheoldjudgement,
Thisshowanaimless individualwholacksincentive anddr ivepossiblydue
tofor mer har dshipsandasar esultwill
br ing
pr oblemswiththoseheor she
associateswith.
Car eer inthe9thHouse
Evil in allsaystheoldjudgement .
Thisshowsatr aveller whoisver yambitiousandwhostictstotheletter of
thelaw.Anindividualwhohasno give for himselfor other s.Nocompassionor
mer cyispr esent .
Car cer inthe1 0thHouse .

3'
Evilsavefor hiddentr easur esaystheoldjudgement.
Thisshowswor kfor anunknowngoal,lackofconsciousdir ection .
Car eer inthe1 1 thHouse
Muchanxietysaystheoldjudgement .
Thisshowsanindividualwhoseekstotalloveofallheor sheencounter s .
Thisr esultsintheindividualtr yingtopleaseallthepeopleallthetime .
Onemusttakestockofthe .selfandwor kfor theselfpossiblyattheexpense
ofother s .
Car eer inthe1 2thHouse .
Rather goodsaystheoldjudgement .
This showsan indivudalwhohastobeshowntheway s,alackofindependent
thought .Theindividualshouldtr ytobeindependentandstandupfor what
or shebelievesin.
Tr istitiainthe1 stHouse
Medium,goodfor tr easur eandfor tifyingsaystheoldjudgement .
Astr ongdr ivefor per sonalliber tyattheexpenseofother s . Aconstantflu
ofexper iencesandaneedtoleadisshownher e .Advancedspir itualand
occulttendenciesaspectthemselvesher e .Whilethemaindr ivefor leader shi ._ -
isshownther eseemstobeatendencyto to to theextr emesinthesefield5. :
Tr isitiainthe2ndhouse
Mediumbutgoodtofdr tifysaystheoldjudgement .
Thisshowsonewhoisimpulsivewithmater ialgoods .Theper sonwillhaveto
cur stendenciesofspendinganddir ectthemoneyflowintowor thwhilepr oje(
ifoneisgoingtor ideoutthebadaspectsofthisfigur e .

1
Tr isitiainthe3r dHouse
Evilinallthingssaystheoldjudgement .
Her eunusualstimulationofideasandr elationsipsar eshownThefigur es :
goodintuigtivefacultiesofmind,sear chingfor theXfactor , beyondthe
physicalconceptandstr uctur e .Afluxofgener ativefor ceofideasinthe
abstr actsenseisalsoever pr esenther ewithalotofcommunicationbetwee :
theindividualandvar iousgr oupsinvolved.
Tr isitiainthe4thHouse
Evilinallthingssaystheoldjudgement
Thefigur eher eshowsstr ongocculttendenciestofor mgr oupassociations
inthehomeor withclosefr iendsandr elatives .Thesuddenfluxofchange
ever pr esentinthisfigur e .Oneshouldgivepr efer encetofamilystr uctur e .
Tr isitia.inthe5thHouse
Ver yevilsaystheoldjudgment .
Thisfigur eshowstheunconventialinter msofexcitement and shows an off_ .a
thoughnotnecessar ilybadpsychologicaltr ait .Anexpr essionincommunicat._ -: ~
ideasisaver yr ealnecessity.Alsoaslightinstabilityfactor isappar en`~
well.
t2
I
r
f
t
Evilexcept for debaucher ysaysthe old

31 judgement,
Thisfigur eher eshowsextr etiesensitivitytotheplaneoflife,intouch
withthe unseen andinmanyinstancesabletomanipulatethevitalener gies
oflife .Psychichealing is but an exampleofoneofthesefor cesunder the
contr oloftheindividual .Str uctur eher e isver y impor tantalsofor theper son
toanalysewhatheor shehasdone .
Tr istitiainthe7thHouse.
Evilfor inher itanceandmagiconlysaystheoldjudgement .
Thisfigur eshowstheneedofpar tner shipsbutsuppr essestheneddofper sonal
fr eedomwithit .Alsoitshowsar appor twiththeindividualsfeelingsetc .
thatbor der beyondthephysical .I t is anunpr edictable figur e abletogo
+beither extr emeatamomentsnotice .
Tr ietitiainthe8thHouse.
Evil,butgoodinsecr ecysaystheoldjudgement .
Thefigur esoplacedshowsther ealitiesoftheoccultmyster iesandmansr elay-
ionshiptothem .I talsoshowsgr eatinsightandunder standingof these
qualities.Thewholeaspectistomakethe individual mor eawar eofhis
spir itualvalueswhichisoftendonebybeingawar eofthe advancesituation
befor e it comes.
Tr istitiainthe9thHouse
Evilexceptfor magicsaystheoldjudgement .
Thisfigur einthishouseshowsanewplaneopeningupand making contact
withtheinner for cesther e .Her emoder nideasandmethodsadvancebeyondthe
oldteachingmethodsandanewtypeofphilosophicalappr oachisgiven.
Tr istitiainthe1 0thHouse
Evilexceptfor for tificationssaystheoldjudgement .
Thisfigur esoplacedshowsastr ongtypeofener gythatneedstoleadand
cr eate .AtSobecauseofitsunusualdr ivethefigur eunder theoldsystem
appear sr adicalwithleaningtowar dsthemetaphysicalstr uctur ewiththe
fr eedomtofollowtheir tr ue will withina given str uctur eor fr amewor k.
Tr istitiainthe1 1 thHouse
Evilinallthingssaystheoldjudgement .
Thisfigur eshowsthenewageof* occult manifestationcomingoutwithafr ee
flowingfr eedomtofor maliaisonwith an esoter icgr oup.Ontheother handit
bodesillfor par tner shipsduetotheoffbeatandunstabileattitudeofthe
figur e .
Tr istitiainthe1 2thHouse
Evilbut good for magicandtr easur esaystheoldjudgement.
Thisfigur eher eshowsthehighlydevelopedlinkthe individualhaswiththe
occultpower swhomotivateanddir ecthim .Becausethislinkissofine
some individualsdevelop afor mofneuco5isandoften cannotdistinguish
betweenther ealandtheunr eal .
t
Laetitainthe1 stHouse
Good,exceptinwar saystheoldjudgement.
Thisfikar eshowsanuncannygr aspofselfawar enessandr ealisationofthei
divinepower slinkingtheindividualtotheelements .Thefigur esoplaced
r epr esentsatypeofmysticalappr oachtheindividualhaswiththedivine
plan . Becauseofthesensitivityofthefigur eonecanbetoor eceptiveto
thesefor cesr esultinginpossessionandcontr olbyexter nalfor ces .
Laetitainthe2ndHouse
Sicklysaystheoldjudgement .
Thefigur e showsalossoffunds(mater ial)onunwor thwhilepr ojects .At
anyr ateitshowsalosstotheindividualonewayor another .I falossi. :
abouttotakeplaceitwouldbebetter tochannelthefundsinto a pr oject
withahighspir itualcontentbehindit .
Laetitainthe3r dHouse
I llsaystheoldjudgement .
Thisfigur eshowsonegoingbacktothecor eessenceofthear chetype
str uctur eofself.Her ethecor eofoccultener gyisfor medand given
substanceinmuchthesamewayastheBr iahwor ldoftheKabbatah.I t
showshowachannelor str uctur etotheinner planes .canbefor medand
utilisedonthisplaneofexistanceandcommunicatedtoother s .
Laetitainthe4thHouse
Goodsaystheoldjudgement .
.Thisshowsthekar micties to fr iendsandfamilies-gr oupkar ma .Alsoit
canmean - togoaheadinadesir edpr ojectofaspir itualnatur e,dictated
bytheinner planes.
Laetitainthe5thHouse
Excellentlygoodsaystheoldjudgement .
Thisfigur eshowstheintuiativecr eativeaspectsofonesdevelopment
thr oughanoutletthatwilltakeit
.
Laetitainthe6thHouse
Evilgener allysaystheoldjudegemnt
.
T$ s
figur eshowstheactionsofthecr eativecur r entofthe6th-House
Mer etheimpetusisstr uctur edalong,linesto
suittheindividuals but
showsaheavyoccultinfluence .
Laetitainthe7thHouse.
I ndiffer entsaystheoldjudgement
.
Thisfigur eshowshowindividualswor ktogether tocr eatean
.outletfor
ener giesdir ectedfr omtheinner planes
.Thisshowsa unificationof
gr oupactivitieslinkedtothespir itual .
1
1 1
1
1
E
1
Laetitainthe8thHouse.
Evilgener allysays theoldjudgement .
Thefigur eplacedher eshowsthemater ialaspectoftheinner plane
contact .Some haveasstciatedevil tothisbecauseitdr aws onblackmagic
for gain.
Laetitainthe9thHouse
Ver ygoodsaystheoldjudgement,
Thisfigur eher eisthatofthemysticalleader whodir ectsthevar ious
ener giestoandfr omspir itualwor ship .I t shows pr opheticqualitiesof
spir itualdir ection.
Laetitainthe1 0thHouse .
Goodr ather inwar thanpeacesaystheoldjudgement .
Thisfigur esoplacedshowsthefor mationof anesoter ic or der or secr et
meetings.Alsoitshows theseideasbeingcommunicatedtoother s .I tisthe
motivationofselfinthespir itualanddr amaticsenseasadir ectr esult
ofper sonalachievement .
Laetitainthe1 1 thHouse
GoodinallsaystheoldJudgement .
Thisfigur eher e car r iesontheideaofesoter icandsecr etsocietymeeting,,
butismor econcer nedwiththeassociationsconnectedtothembutthe1 1 th
Houselooksattheir for mation .
Laetitainthe1 2thHouse
Evilgener allysaystheoldjudgement .
Thisfigur eher eshowsthechar ismaticmystical .qualitythatalmostappr oaches
sainthoodwithatendencyto'goitalone'typeofattitudeuntilthe
tr ansfor mationpr ocess .oneisunder going is completeandtheideasofthe
individualar er ealised.Sensitivitytoallar tfor msar eappar enther e .This
coulddescr ibeanindividualunder goingthekundalineexper ience .
CaudaDr aconisinthe1 stHouse
Destr oythefigur eher ebecauseitmakesthejudgementwor thlesssaysthe
oldjudgement.
Thisshowssomeoneor thingwho will notinitialyacceptchangeno-matter
whatar gumentispr esented .
CaudaDr aconisinthe2ndHouse
Ver yevilsays the-old judgement .
Thisshowsthe r estr ictedandcautiousattitudeoftheindividualina
pr oject.Ver ylittlewillbefor thcomingfr omthisper soninthewayofhelp,
CaudaDr aconisinthe3r dHouse
Evilinallthingssaystheoldjudgement .
Thisshowsthataper sonsideaswillnotbeacceptedbyother sduetotheir
conser vativeattitude .
CaudaDr aconisinthe4thHouse

'f2
Good,especiallyfor theconclusionofthematter saystheoldjudgement
.
Thisshows
atypeofr etir ement,possiblytothehome,wher etheindividual
ishappy- tolivea type ofr ecluseexistance .

I
CaudaDr aconisinthe5thHouse
Ver yevilsaystheoldjudgement .

'
Thisshowssomeonewhostickstotheoldwaysignor ingchange
.Thisis
pr oper nessor cor r ectnesstakentotheextr eme .
CaudaDr aconisinthe6thHouse
Rather goodsaystheoldjudgement.
Thisshowshar dwor k,donemostlyalone,toachieveonesends
.
CaudaDr aconisinthe7thHouse.
Evilinwar andfir esaystheoldjudgement .

'
Thisshowsafor mofcautionwhenfor mingalliances .
CaudaDr aconisinthe8thHouse
Nogoodexceptfor magicsaystheoldjudgement.
This shows thatcautionisneededwhenhandlingmoney,your sor someone
el" 'z -'t . .,
CaudaDr aconisinthe9thHouse

Goodfor scienceonly,badfor jour neysandr obber ysaystheoldjudgement .


Thisshows aphilosophicalappr oach ie atr additionalist-onewhodoesnot
differ fr omhisfellowsandthus . doesnotbr ingtr oubleonhimself.
CaudaDr aconisinthe1 0thHouse
Evil save wor ksoffir esaystheoldjudgement.

,
I tshowssuccessinapr ofessionalpur suitbutonlyifobtained thr ough
honestmeans .

t
CaudaDr aconisinthe1 1 thHouse
Evilsavefor favour ssaystheoldjudgement .
Thisshowssincer eindividuals who joinassociationsfor their meaningand

t
intentandnotfor anysuper ficialr eason .
CaudaDr aconisinthe1 2thHouse.

Rather goodsaystheoldjudgement .
Thisshowsisolationofselfandnotbeingver ymuchawar eofonessnr r oun4-" .
andisnotagoodtimefor businessor speculationor movement .
CaputDr aconisinthe1 stHouse .
Goodinallthingssays the oldjudgement .
Thisshowsaper sonwhofitsintoallfor msofsociety
.
CaputDr aconisinthe2ndHouse .
Goodsays the oldjudgement .
Thisshowsanindividualwhomakespr ofitver yeasily
.
CaputDr aconisinthe3r dHouse
Ver yGood saystheold judgement.
Thisshows
goodfor msofcommunicationsofcur r enttr endspr esentedto
: eople .
42
I
Caput Dr aconisinthe4thHouse .

3
GoodsaveinWar saystheoldjudgement .
Thisshowsgoodfor tuneandpeacefullnessinthedomesticfr ont .
CaputDr aconisinthe5thHouse .
Ver ygoodsaystheoldjudgement .
Thisshowsamoder ntr endtor omanceandsexwithsomeofitcomingyour
way.
CaputDr aconisandthe6thHouse
Goodfor immor alityonlysaystheoldjudgement .
Thebasicideaof this figur e her eispleasent,especiallywiththewor k
envitament'wher ether eislittleor notr oubleatall .
CaputDr aconisinthe7thHouse .
Goodespeciallyfor peace says theoldjudgement.
This shows thegoodcommunicativeskillsoftheindividualeffect_ ngother s
tothebentfitofbothpar ties .
CaputDr aconisinthe8thHouse
Goodsaystheoldjudgement .
Thisshowsgoodfor tunefor pr ofitsasanindividualher eisintunewith
thecur r enttr endsr egar dingbusinessmatter s .
CaputDr aconisinthe9thHouse
Ver ygoodsaystheoldjudgement .
Thisshowspeoplewhointr oduceanewtypeofr eligiousawar enessand
cultur al sense toother s .
CaputDr aconisinthe1 0thHouse
Goodinallsaystheold judgement .
Thisshows people wholikesome in the9thhousear eawar eofsocialtr ends
buther etheyintr oducethemfor pur elybusinessr easons.
CaputDr aconisinthe1 1 thHouse
Goodfor thechur chandecclesiasticalgainsaystheoldjudgement
.
Her ewehavepeoplewhocommunicateinasenseofgr oupsor associations
aswellasinever daylife .Theyhave a
specialskillwiththispar ticular
communicativefield.
CaputDr aconisinthe1 2thHouse
lot ver ygoodsaystheoldjudgement .
Thisshowsanempathywiththeenvior mentwhichcanbediaster iousifthis
ver yfinelinkfindsthattoomanyimpr essionsintr udewhichcouldcause
mentalpr oblems
.Aver yfinepsychicqualityisevidenther ethatmustbe
lookedafter andpr otected .
& . 4
Via in the 1 st House
Evil except for pr ison, says the old judgement .
Good for modificationofsur vivaltechniques,alsosettlingfoundation ;
thoughagainstthetendencytobetoosubjective .
Viainthe2nd House
I ndiffer ent,saystheoldjudgement .
Goodfor financialr ewar d,asar esultofper sonaleffor t .Theminds
inclinationtobuildbar r ier s(mainlyofpossessions)tohidebehindii
likelytosur facemor e,possiblyasanoppor tunitytor ectifyit .
Viainthe3r d House
Ver ygoodinall,saystheoldjudgement .
Swiftnessofmovementwilllend a cer tainhaz ar dousnesstor elationships
(gener al),thoughifwelldir ectedcanbeusedtoimplementconstr uctive
changes .I ntellectuallear ningisatahigher level,thoughitslack
ofdepthmust(byintegr ationandbalancingwithsubtler
for ms ofknowing)
betr ansmuted .
Viainthe4thHouse
Goodinallsavelove,saystheoldjudgement .
Thepotentialfor anintenseandsignficantr elationshipispr esent,though
likelytobeshor t-livedduetoconflictingdomestic views . Anexcessive
emotionalinvolvement- or inclinationtowar ds - wouldalsobedetr imental,
withemotionsdefinitelyinneedofr estr aining .
Via inthe5thHouse
Voyagesgood,saystheoldjudgement .
Thechannellingofener giestakesonadeeper significance,thr oughthe
fur ther ingofonescr eativeself,andnewfor msther eof
.Goodfor the
beginningofapr egnancy .
Viainthe6thHouse
Evil,saystheoldjudgement .
Achangeinthestr uctur eofonesemploymentwillshakeupthepsyche
alittle,thoughbeneficiallyifonesbeliefsar eflexibleenoughtochange
withtheflow .Healthgoesthr oughaboutofinconsistency,mor elikely
tobeaggr avatingthananythingelse .
Viainthe7thHouse
Rather 'good,especiallyfor voyages,saystheoldjudgement
.
Cir cumstancescausetempor ar ymovementsoutsideonesnor malspher eof
activities,withener gies

mainlythosehavinganemotionalbase
beingofgr eatvaluewhenfocusedthr oughconnectionswithother s
.
Viainthe8th House
Evil,saystheoldjudgement .
Replacementofr ecentlossbylegacyor similar
.Sexualpar tner appear ing,
bewar eofthepotentialener gydr ain .
Viainthe9thHouse
I ndiffer ent
;goodfor jour neys,saystheoldjudgement .
Higher aspir ationswillbefedto,thoughnotwithoutconflictfr omthe
lower selftobecontendedwith
.Longer jour neysar efavour able,and
likelytobeinter sper sedwithanumber ofenjoyablesocialvisits
.
1
Via in the 1 0th House
Good, says the old judgement .
An incr ease of involvementinthelocalcommunitystr ainsonesr esour ces,
thoughnotwithouttangibleandsignificantr ewar d .Watchfor pr oblems
withtr ippingover thefixedbeliefsofother s,alsodon'tyieldtosuit
their expectations .
Viainthe1 1 th House
Ver ygood,saystheoldjudgement .
Onesinclinationtowar dsexpansion(ofthemind)sur faces,totakeadvantage
ofnewdataandsituationsfor lear ning .Alsotheneedtoaidthelear ning
ofother sshowsitself .
Viain the1 2th House
Excellent,saystheoldjudgement .
somethingdonelong .agowillbear fr uit ;alsoamovetobr eakdowna-r es-
tr ictionwillpr oduceasuddenr eaction- likelytobefor thebetter .
For tuna Minor in the1 st House
Speedinvictor yandinlove,butcholer ic,saystheoldjudgement
.
Definitelyfavour ablefor expansion,butanadvantagetobemindfulof
thefollow-thr ough,withper sistencear elevantkey
.
For tuna Minor in the2nd House
Ver ygood,saystheoldjudgement .
Businessmatter sattr actandwillbenefitfr omattention,par ticular ly
r epr oper ty
.Gener allygoodfor takingstepstobuilduponesfinancial
wellbeing .
For tuna Minor in the3r dHouse
Good,butwr athful,saystheoldjudgement .
Diver sefor msoftr avelar ebeneficial,par ticular lyshor tjour neys
.
Self-analysis,concentr atingonmor eaccessiblepar tsofthemind,is
wellwor thwhile
.Thepossiblewr athfulnessisbr oughtaboutbypr oblems
withtheegoover -inflatingitself,andclashingwithinunbalancedr ela-
tionships
.Thedevelopmentofar ealisticself-per spectiveisasignificant
key .
For tunaMinor inthe4th House
Haste,r ather evilexceptfor peace,saystheoldjudgement .
Along-ter mplanfocusingononeshomelifecanbebegun,beingver yadvan-
tageousifcar r iedthr oughtoitsconclusion
.Thepotentialfor str ess
ishigh,indicatinganeedtochannelsomeener gyintor elaxation .
For tuna Minor inthe5thHouse
Goodinallthings,saystheoldjudgement
.Beneficialinall,except
for possibleexcessesinonessociallifeandself-aggr andisement
.Can
beexcellentfor developingtheexpr essionofcompassion,alsothesense
ofequalitywithother s .

-
For tuna Minor inthe6th House
Mediuminall,saystheoldjudgement .
Pr ogr essinbuildingontothemater ialbaseisdefinite,thoughfalse
per spectivesaboutthevalueofitallmustbecounter ed
.Atendency
tolookdownonother smustbecontr olled,whilstnotsuppr essingany
abilitiesonemayhavetoteachor leadother s .
For tunaMinor inthe7th House
Evilexceptfor war or love,saystheoldjudgement .Plansalr eadybegun
needbecontinued,andwithoutsur r ender ingdominionover onesactions .
Paymor eattentiontoconnectionswithneighbour sandfr iends .
For tuna Minor inthe8th House
Evilgener ally,saystheoldjudgement .
Regener ationastr onginfluenceonmovements,tobetakenadvantageof
bymaintainingconsistentactionsthr oughanyir r egular ities .Restr ain
anytendencytowar dsanger .
For tunaMinor inthe9thHouse
Good,butcholer ic,saystheoldjudgement .
Thecausesandeffectsfor minglocalpoliticswillgainsignificancein
your spher e,enoughtoboostyour under standingofitall,andifnecessar y
educateyoufur ther astohowyour positioncanbestr engthened .Agood
timetopr oceedwithchangesneededinthelocalr ealmofr eligiousaffair s .
For tuna Minor inthe1 0th House
Good,exceptfor peace,saystheoldjudgement .Ver ysettled,withpr ogr ess
inthewor kplaceatapr emium .Contactwithpar ent'sr ewar ding .
Yd
t
I
For tuna Minor in the 1 1 th House

`f.
7
Good, especiallyfor love, says the old judgement .
Thr oughchanges in the wor kplace,ther ewillbeanincr easeintheactivity
oftheintellect .Thiswillinfluencegr owthpatter ns,somor eemphasis
mustbeplacedonidentifyingthesepatter ns,andadjustingtheminkeeping
withtheflowoftheenvir onment .
For tuna Minor in the1 2th House
Good,exceptfor alter ation,or for suinganother ,saystheoldjudgement .
Ahiddenenemysur faces,withpr ovocativemovestemptingar eaction -
tobeavoided .Conceptsr epunishmentneedr evision .
A.-%
I aagr eatmanyinstanceswemaywishtofindoutthedescr iptionofan
individualwhomthedivinationpr ocesstellsustowatchoutfor
.The
table -belowatfir stglancemaycontr adictsomeoftheoldmeanings
such,
asPuella,commonlycalledgir l .Thefullmeaningactuallyisgoodfor tune
r elatingtowomen.Soinfactther eisnocontr adiction in point.The
tablebelowgivesusdescr iptionsandcolour s of the figur es which ar e

,
br oughtin line withother aspectsofor der teachingsbutmostimpor tant
ofalltheyar egivenasar chetypeassociation .

'
Meaning
Manwithr edgoldhair andhaz eleyes,middleagedand
holdsapositionofsomeimpor tance
Puer
Figur e
For tunaMajor
Acquisito
CaudaDr aconis
Populus
Rubeus
Laetitia
Via
Paella
Tr istitia
Albus
For tunaMinor
Woman.withr edgoldhair andblue or br own eyes,sheis
cultur edandhasgood businesssense
Fair hair edyoungmanwithblue-gr eyeyes,afr iendly
individual,atr aveller
Youngwomanwithr edgoldhair and blue eyes,messenger
Fair hair edmanwith blue eyes,fier cenatur eandcalm
exter ior
Womanwithgoldbr ownhair andblueeyes, distinguished
withpossiblepsychicgifts
Youngmanappr oachingsomeoneor thing,br ownhair and
gr eyor br owneyes
Br ownhair edyoungwomanwithblueor br owneyeswhois
kind andstudious

A man .withdar kbr own.hair andeyeswhoissuspicious aid


over cautious,athoughtfull
individual

I
Gr eyhair edwoman.withlightbr owneyes,asintensely
per ceptivewomanofauthor ity
Dar khair edyoungmanwithdar keyeswhoisactiveand
clever andhasatendencytor ushintothings .
Youngwomanwithlightbr ownhair andblueeyeswitha
-I
str eughtofpur poseand inquisitiveness.
I
t
7
1
Car cer
Amisso
Conjuncto
Caput Dar conis
Dar k hair ed manwithdar keyesand fr iendlymanner q7
andsteadydispositioninapositionofauthor ity
Dar khair edwomanwithdar keyes-gener ousandintelligeh
intelligentwithpower andauthor ity
Youngmanwithdar kbr ownhair anddar keyeswhoispat
patientandhelpfull,a tr aditionalist
Youngwomanwithr ichbr ownhair anddar keyes,a
car efulper sonwithgood.businessacumen
r .
ELEMENTALCONSTRUCTI ONOFTHE GEOMANTI C FI GURES
Thefollowing Geomantic figur es ar econstr ucted fr om the
four elements though they have a str ongempathy with the Ear th .
When their use is extended to an astr ological fr amewor k such as
houses, planetar y meanings and signs etc . some of the base
elemental meanings of the figur es actually alter . The following
esoter ic analysis isbasedonthefor mationofthefigur esand
their elementalcompositionbefor e
influence .
PUERYod

Fir e
Heh

Water
Vau

Air
Heh

Ear th
mer gingwiththeastr ological
I nthefigur eofPuer itisfoundthatthetwodots
cor r espondingtoptheAir levelallowsther emainingelements
Fir e,Water andEar thtodominatewhichshowsFir e
water thater uptsintheEar thliketheactionofavolcano .
AMI SSO

Fir e
Water
Air
Ear th
Her ethestr ongelementsofFir eandAir combineover Water
andEar thwhichpr oducesagaseouseffectoncethesolidelements
havebeenr emoved .
co
heating the
t
t
t
t
t
t
I
ALBUS

Fir e
Water
Air
Ear th
Air is the only str ong point her e and the lack of other
elements shows the exposur e of the intellect about to enter new
gr owth
POPULUS

Fir e
Water
Air
Ear th
I n this instance we have a total withdr awl of the elements
into the self which concentr ates totally in this ar ea.
FORTUNA MAJOR Fir e
Water
Air
Ear th
4b
Her e Ear thandAir ar ejoinedwithalackofFir eandWater
whichr elatestosoil(loosenedbytheAir )
tilledandgodfor potentialgr owth .
S1
whichiseasily
CONJUNCTI O

Fir e
Water
Air
Ear th
This shows a str ong Water -Air combination and lack of Fir e
and Ear th which r elatesto nour ishment in the for m Water
(r ain) being blown to ar eas that need it .
PUELLA

Fir e
Water
Air
Ear th
The lack of water her e illustr ates an imbalance ofemotions,
and being extr emelyr eceptive to other s .
REBEUS

Fir e
Water
Air
Ear th
Water her e is in its str ongest position and easily over comes
the other elements showing extr emism in the emotional ar ea .
AQUI STI TI O

Fir e
Water
Air
Ear th
The lack of Fir e and Air gives the str ong water ear th
combination an air of solidity and one can become bogged down in
c2
.
;z
I
mater ialism . (note howthe meaning of this figur e changes with
the intr oduction of Jupiter and Saggitar ius) .
CARCER

Fir e
Water
Air
Ear th
Fir e and Ear thar e str ong her e and both of them contain
Water -Air combination pr oducing h eat. i n acontained ar ea.
1
the
TRI STI TI A

Fir e

Water
Air
Ear th
The Ear th element is the str ongest her e and showsthatther e
is nogr owthsituationor asituationtosolidtopr oduce
movement.
LAETI TI A

Fir e
Water
Air
Ear th
Thisfigur eistheoppositeinmeaningtoTr istitiawiththe
theFir eelementbeingtheonlyspar kandr elatestoalmostpur e
essenceofspir itbefor enewgr owthbegins .
S3
s3
CAUDA DRACONI S Fir e
Water
Air
Ear th
This figur e pr oduces a lack of ear th which does awaywith
obstacles necessar y for r apid and almost uncontr olled gr owth .
CAPUT DRACONI S Fir e
Water
Air
Ear th
-The lack of Fir e r elatesto death and separ ation as the
other elements on their ownwithoutfir epr oduces a nogr owth
situation and one that cannot succeed .
FORTUNA MI NOR Fir e
Water
Air
Ear th
This shows a Fir e andWater combination which is the mer ging
opposites and showsunification but the lack of Air and Ear th
show thatthe succesfullcompletion willnot be mater ial .
VI A

Fir e
Water
Air
Ear th
This shows good and evenbalance and har mony . (Note the
effect of mer ging with the astr ological influence which dr asticly
changesthe base elementalmeaning of the figur e) .
1 51 20
t
I
I
COMPANI E OF THE HOUSES
The " Companie of the Houses" is a method used and descr ibed
by MacGr egor Mather s .Thismethod was the pair ing houses
calling them a " Company" .The pair s of houses wer e : 1 +2, 3+4,
5+6, 7+8, 9+1 0, 1 1 +1 2, and not 2+3 or 4+5 for they wer e not
pair s, 2 was only pair ed with 1 , and 3 with 4, 5 waspair ed with
6, not 4 . I n these pair s the geomantic figur es wer e placed and
looked on in var ious ways, depending on the question of the
diviner and r ead as influencing factor s, for example :
As " Companie Simple" :
identical : per sons - the figur es in the pair ed houses
wer e looked on ascompanions or associates and their natur es
show how they influence each other ; or when afigur e r epeats
itself in the pair ed house, these show good or bad
influences for the pr esent or time to come and/or
separ ately, the fir st figur e shows thepr esent, the second
the futur e.
" Companie Demi Simple" : When the figur es in a par ticular
houses ar e not identical, butthese figur es ar e pair
r uled by the same planet .
Finally the methoddescr ibed as " CompanyCompound
the figur es wer e upsidedown to eachother butidentical
Used as examples wer e Fuer and Puella, Albus and Rubeus,
Ls
When figur es in pair edhouses wer e
Wher e
Acquisitioand Amissia, Laetitia and Tr istitia. Fr om a pair
aReconciler Figur e was for med, e .g . the same way as the
" Judge wasfor med .Another mehtod of " Company Compound"
was if the figur es in a pair , although notidentical, had
mutual dod or evenfir st lines - both figur es must have an
even or both an odd set of dots.
for med .
Mather s was descr ibing a method called the
and the houses following as 2, Z
.,
A Reconciler was then
" Der ivative House
Method" , which has come into common use of late.This method was
used mainly for Hor ar y r eadings although it wor ked

quite
adequately in Natal char ts. The Der ivative House Method is a
method that extr actscompr ehensive infor mation fr om ones r eading
and deals withcir cumstances (i .e . the question) andhow one tends
to behavelf, what factor sar e influencing it and howother stendto
act .
This technique is based on the fact that eachof the 1 .: houses,
which r epr esent cir cumstances of life, ar e r elated to ever y other
house. I ts method is by r egar dingthe house of the question as
the fir st house of thechar t . Now thisdoes not mean giving the
fir st house in a geomantic char t a new meaning, it means for
example, if the question er lates to the sixth house, then one
would look at the sixth house and count that one as number one,
4etc .

Alltheother houses
althoughstillr etainingtheir or iginaltr aditionalmeanings,
thenfocusonthe1 sthouse{thehouseofthequestion)r eacting
thr oughthepatter nsetfor mthemwithther enumber ing .
1
I
1
This is wher e the " Companie of the Houses is used.

The pair ing


of the houses showsther elationships
S1
ofthefigur estoamatter ,
channelledintoanar eaoflifeshownbytheDer ivative
technique .Thenofcour seonelooksatthegener alr ulesin
Geomancy.Evilwithevilmakesevil ;goodwithgoodmakesgood ;
agoodfigur einagoodhouseisdoublegoodandagoodfigur ein
goodhousepair edwithanevilfigur einagoodhouseshows
linger ingmalicebutunoper ationalasitcannotmove ; or agcjod
figur einanevilhousepair edwithanevilfigur einagoodor
neutr alhouseshowsdur essduetonegativeinfluencesetc .,etc .
SUGGESTEDREADI NG
PlanetsinHousesbyRober tPelletier for

detailedmoder n
descr iptionoftheDer ivativeHouseTechnique .
Ter r estialAstr ology,DivinationbyGeomancybyStephenSkinner
whichisamustfor GeomanticHistor yanddiffer entmethodsused
withanexcellentbibliogr aphysection .
APr acticalGuidetoGeomanticDivinationbyI sr aelRegar die .
57
BRI EF /yEI 9N/NGS OFTY /o/ ovms S8
S8

For tunaMajor (Gr eat For tune) : - Good for gaininallthingswher ea


per sonhopesto win.
!'
For tunaMinor (Lesser For tune) : -Good in anymatter wher eaper son
pr oceedsquickly.

Via(Theway) : - I njur ioustothegoodnessofother figur esgener ally


butgoodfor jour neys.
r Acquisito (Acquisition) : --Gener ally goodfor pr ofitandgain

Paella(Gir l) : -Good in alldemands,especiallythoser elatingto


women.
.~
Conjuncto (Conjunction) : - Goodwithgood,evilwithevil,r ecover ing
oflostthings.
Puer (Boy) : -Evilinmostdemandsexceptingthoser elatingtoloveand

war .

Populus(People) : -Sometimesgoodandsometimesbad ;Goodwith good


Evilwithevil .
.~. Laetitia(Joy) : -Goodfor joy,nowor thefatur e .
Amisso(Loss) : -Goodfor lose,loveor other wise,badfor gain .
.
.
Albas(White) : -Goodfor pr ofitandenter ingintoaplaceor under -
taking.
Rubeus(Red) : -Evil inallthatisgoodandgoodinallthatisevil .

Tr iatitia(Sor r ow) : - Evilin almostallthings.


. Car eer (Pr isonbound) : -Gener ally evil,delay,binding,bar r ed,r estr iction

CaputDr aconis(Enter ing) : -Sear t,upper thr eshold .


CaudiaDr aconia(Exit) ;-Leavingapr oject
F
0
F
0
E -
LE SSON 51
INTRODUCTIONTOTHE TAROT
ForthemodernoccultstudentthenameTarotiscommon- place
andismainlynotedforitsdivinatoryprowess .TheGoldenDawn
designshoweverwereoneofthefirsttocombinethemeaningsof
mythology,astrology,numerology,alchemy,geometryandkabbalism
intoaunifiedpicturedformwiththekeywordbeingsynthesisa-
tion.Itisnotthepurposeofthispapertogointoalengthy
Tarothistoryasthiswouldrequireanentirebookinitselfto
explain(seeE ncyclopediaoftheTarotbyKaplan),buttopresent
tothestudentaframeworkfromwhichmanymoreattributionscan
beaddedastheyprogressthroughthestudies .
TheTarotis in factadeckofcardsthatare78 in number .
ThetwentytwoTrumps(MajorArcana)correspondtothelettersof
theHebrewAlphabetandthe22KabbalisticPaths,the16Court
cards(RoyalArcana)correspondtototheSephirothofChokmah,
Binah,TipharethandMalkuth,andthe40cardsoftheMinor
ArcanaarerelatedthetenSephirothwiththefourAcesapplied
toKetherthroughtothefourtensassociatedtoMalkuth .
TheactualmeaningofthewordTarotissomethingthatis
quitefranklyopentodebate .Themostlikelyconsiderationis
thatitisFrenchforTarocchi,whichwastheItaliannamefor
thedeckofcardswhichaccordingtosomehistorianswasderived
L51/pg1
I
I
L51/pg
fromthewordTrionifi .

Whenapplyinggematriatothephoenetic
pronunciationofTarot(whichisTaro)
Troa=Gate(inHebrew) .OtherexampleswithlatinshowRota=Wheel
andOrat=Speaks,howeverthesefancifulexplanationsforthe
moderndayoccultistsarereallynothingbutsychronicity .
E xplanationsbyoccultauthorssuchasCourtdeGebelin,
thattheTarotcamefromE gyptiansources,areequallyopento
debateasnoscientificevidencehascometotracetheTarotback
past the 14century except,fromthewriterCovelluzowhosaid
they were introducedtoItalyin1379fromNaib .Ifthiswere
truethedesignsoftheItalianpacksthatwestilluseinpart
todaywouldhavebeenthefirstmodernisationfromtheArabian
decksandgiventheItalianarchetype,wouldhavebeenamajor
overhaulfromtheAfricanpack,providinghoweverthatoneever
existed.
TheimmediateoriginoftheGoldenDawnTarotdesignswere
basedonthe17thand18thcenturyFrenchTarotdesigns(some-
timesknownastheMarselliesTarot)whichthemselveswerebased
onearlier Italianpacks .ThefollowinglessonsontheTarothave
beendeliberatelydevoidofheavyKabbalisticandmythological
symbolismandhavebeensimplifiedsothatthestudentcandeal
withthebarebonesofthecardsthemselveswithoutbeingcon-
fusedbywavesofsymbology.AsonestudieseachTarotTrump,
turnbacktothelessonsontheKabbalisticPathsthatthetrump
isasssociatedto,thenstartapplyingtheseadditionalrefer-
encestotheTrumpaswell .
wefindthatTora=Lawand
saying
an astrologer
L51/pg3
Withinrecentyearsithasbeenquiteacceptablefor,say,
torelymoreonhisorherastrologicalknowledge
getaninterpretationoftheTarot,justasaPsychologist
would possibly use mythology and a numerologist numerology while
KabbalistwouldusetheHebrewLetters.Fromthispointon
suchatypeofthinkingmustceaseasthecardsareinfactthe
synthesisationofalargevarietyofoverlapsandmustbetreated
assuchwhenexploringtheirmeanings . Thereforethestudent
mustnotthink"astrology",or"numerology",or"Hebrew",butto
think"Tarot" .
Inthedescriptionofthecardsthereisprovided basic
analysisofthecardgivingitsbaseessence . Thenwhatfollows
is a twelvestagedescriptionofhowthecard'senergyinteracts
inlifeexperiences .Thesetwelvedivisionsarebasedonthe
twelveastrologicalhousedivisions,whichshouldprovideaclear
format,orguide,forTarotdivinationinlifeexperiences
.
Itwasagreatployofoccultistsatthebeginningofthis
centurytorefertothe'truekeysoftheTarot' .Somehavetaken
thisomeantheHebrewAlphabetbutgenerallyforauthorslike
Waite,theyreferredtoBiblicalkeystakenfrompertinent
chapters. A good look at some of the French decks will confirm
thisalso.ChaptertenofRevelationsisagoauexampleofthis
whenstudyingtheWaiteTrumpofTemperencewhichwaslater
rectifiedbyCase :
'AndIsawamightyangelcomedownfromHeaven,clothedwitha
cloud
: andarainbowwasuponhishead,andhisfacewasasit
L51/pg 4
were the Sun and his feet aspillars of fire : . . . and he set his
right foot upon the sea, and his left foot on the earth .'
Another example of this type is the card the E mpress . Look-
ing again atthe Waite pack and the Case restoration we have in
Chapter 12 of Revelations : 'Andthere appeared a great wonder in
heaven; a woman clothed with the Sun and the Moon under her
feet, and upon her head a crown of twelve stars.'E arlier French
decks of the 17th and 18th century were also well aware of these
keys as the E mpress in many decks had the emblem of an eagle on
her shield: Revelations Ch 12 verse 14: 'Andto the woman were
given two wings of agreat eagle, that she might fly into the
wilderness, into her place where she is nourished for a time, and
times, and half a time from the face of aserpent .'
The Golden Dawn however does not have any secret keys asso-
ciated to the Tarot otherthan the picture on the card which
predominatesother associations . The easiest method of finding
out the essence of the card is to try and understand its general
meaningand why the cups, disks, wands and swords are placed in
certain positions in the card . When this is done then see how
the meaning can alter to suit different astrological house
allocations (which were chosen for their diversity) . It is also
suggested that you start a file index system foreach card and as
each card is studied record additional meanings that you have
found. A simple method of doing this isto simply sit quietly
and gaze at the card and record the impressions as they come to
mind . The time spent on this could take a few minutes oran hour
L51/pg 5
but try to be consistent . If this type of exercise is done daily
(rotating the cards) the cards will eventually act as triggers
for doorways into your subconscious giving you access to tremen
dous energy reserves and is a meditation exercise in itself .
When colouring the Tarot it is important to refer

the
four colour scales to get the exact colours needed. The Trumps
are formed from the combination of the fourcolourscalesandin
someinstancesthecomplementarycoloursaswell .TheMinor
Arcanaarealsocolouredfromthefourcolourscales.TheWands
relate to the King Scale, Cups - Queen Scale, Swords - Prince
Scale,Disks - PrincessScale .Themainelementalemblemisthe
colouroftheplanetandthebackgroundisthecolour

fthe
sign.Whenboththesecoloursaresimilaracomplementaryhue
generallysurroundsthemforidentificationandseparation .

The
RoyalArcanaarepaintedseparatelytotheelementsbutwith
dualassociation .Moreinformationonthecolouringofthecards
isgivenineachlectureforeachindividualcard .
- - - 00000- - -
i
1
1
THE MAJOR MOM
fTrm
L51/pg6
etterAttrbutio

th
M ~~
~-
11th
- -
The Fool
The Magician 12th
High Priestess D 13th
E mpress ' 14th
E mperor fj T 15th
5 Hierophant 6 16th
6 Lovers $ II 17th
Chariot
i

l 18th
Strength
t 19th
9 Hermit
20th
10 Wheel of Fortune
21st
11 Justice 7
22nd
12 Hanged Man Vt 23rd
13 Death
24th
14 Temperance
25th
15 Devil
26th
16 The Blasted Tower
0 27th
17 Star
28th
18 Moon
J\ 29th
19 Sun
O 30th
20 Judgement
31st
1 Universe ~~
32nd
THE MINOR ARCANA
The Reference of the Small cards to the 36 Decanates of the
1
7n- 704n4WAnrla
1- 10

5 of Disks
10 - 20

6 of Disks
7n - 7n

7 n4 n ; aka

A
L51/pg 7
8 of Swords
9 of Swords
10 of Swords
1- 10
10 - 20
120 - 3n O
7
9
1
Zodiac.
D_ ec_ a_ n_ a_ te_ Nu_ m_ te_ r of-
Sign_ D_ e_ gne_ egf P_ 1 - ane_ t~_ C_ ard_ M De_ c_ a_ n_ a_ te_ _ _ _
1- 10
10 - 20
n- Tn

D
2 of Cups
3 of Cups
4ofCliPa
10
11
12
1 10 ofWands 13
S
10 20 6ofWands 14
7n - 7n

(: : j7
7 n4 Wands 15
1 - 10

0 8ofDisks 16
1 - 20

t 9ofDisks 17
170 - 70 10 ofDisks 18
1 - 10 2ofSwords 19
10 - 20 3ofSwords 20
7n - - ,n 4ofSwords 21
1- 10

U
5of Cups
10 2ofWands
10 - 20
O
3ofWands
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
THE TRE E OF LIFE ON THE TAROT
Thepackof56cards - . . thefullfoursuitswithoutthe
22Trumps - expressedKabbalisticallyrepresentsthemysterious
workingandoperatingofthe
f~
1

throughouttheTen
Sephiroth,- andinthefourWorldsofAtziluth,Briah,Yetzirah,
andAssiah .
Wands
Cups
Swords
Disks
Atziluth

Fire
Briah

Water
Yetzirah

Air
Assiah

E arth
L51/pg8
O
6ofCups 23
7ofCups 24
8ofWands 25
9ofWands 26
10ofWands 27
~L. 2ofDisks 28
3ofDisks 29
O 4ofDisks 30
T
5ofSwords 31
6ofSwords 32
7ofSwords 33
8ofCups 34
9 04 Cups 35
CT
10 04 Cups 36
i 10
10 - 20
20 - 30
1 - 10
10 - 20
70 - 30
1 - 10
10 - 20
20 - 30
The fourCourt Cards of each suit represent
counter- chargedwith each other. Thus :
The King of Wands
The QueenofWands
ThePrinceofWands
ThePrincessofWands
TheKingofCups
TheQueenofCups
ThePrinceofCups
ThePrincessofCups
TheKing of Swords
TheQueen of Swords
ThePrince of Swords
ThePrincessofSwords
TheKing- ofDisks
TheQueen of Disks
ThePrince of Disks
ThePrincessofDisks
intheWorlds
Theordinarycards
DecanatesoftheZodiac .
S

of
f
of
of
of
SephirothintheWorldtowhichtheybelong .
invariablyKether .

TheotherCardsare
s7
L51/pg9
theE lements
ThereforetheCourtCardsaretheVice- regentsoftheName
eachsuitareclassedunderthe
TheAcesare
alsoreferredtothe36
t
AA
f A
V
1 of 0
M

A of V
AA
VA
A of A
A
s` '7

V
V8
s

A8
s` ~

VV
1
t
1
The Ace of WandsKether of
The Two of WandsChokmah of

and Atziluth
Three

"
Four

"
" Five

"

Six
" Seven

"

E ight"

Nine

Ten
. .
. .
Binahof
Chesedof
Geburahof
Tipharethof
Netzachof
Hod of
Yesod of
Malkuth of
"
..
L51/pg 10
andAtziluth
The AceofCups

Ketherof

andBriah,andso
on .
Swords,and Pentacles the Same (andYetzirah,andAssiah
respectively) .
Cant. . .
THE TRE E
OF
LIFE INTHE SUIT OFWANDS
q
to
CJc.r~gg
Qc'~K~SS
t
i
t
1
t
1
LZ1/pg1
The Atziluth of each World will include only the Ace, Briah
the 2nd and 3rd, Assiah the 10 and Yetzirah the remaining
numbers, 4- 9 inclusive, and both properly belong to Briah, but
the upper most point of the Yod touches Atziluth,
referredthereto .
observedthatthecharacteroftherespectiveTrumps
whereforeitis
thenaturalorderofthePathsontheTree,itistobe
allotted
thereto,balanceeachother : e.g .DeathandtheDevil,the
MagicianandtheFool,theHighPriestessandtheE mpress .
Thethreereciprocalhorizontalpathsareoccupied
respectively by the E mpress t : Fortitude J : and the Tower
e : the firstbeing, as it were, the expressionof that
BeautywhichresultsfromtheHarmonyofWisdomand
Understanding ; thesecondthatStrengthwhichistobefoundin
theHarmonyofMercyandSeverity ; whilethethirdconveysthe
ideaofthatVehementforcewhichistheHarmonyofVictoryand
Splendour . Fortitude J is also placed, as it were, between
thetwofivesoftheSephiroticUniverse .
L51/pg 11
FRONTFIE CE OF THE TAROT
o,- C 7 Ale 4- -
The front piece oppo_ _ te consists of the Crux Ansata which
is a form of the Rosy Cross . One arm is scarlet, with the symbols
of Leo and the Wand in emerald green . Another is blue with the
sign of Scorpio and the Cup in orange.A third is Yellow, with
Aquarius and Dagger in violet . The last is thefour colours of
Malkuth . The background is black with the writing and Pentagrams
in white. TheGreek letters in the White Ring stand for the Angel
HUA who presides over theoperations of the Tarot and shows that
all invocations come through K.ether andabove . The words around
the Ankh are L .I .F.E .,' B .I .O .S (Greek: for Life) andV.I .T .A
(Latin for Life) and T .A .P.O (meaning Tarot) .
THE COMPLE TE SYMBOL OF THE TAROT
1
t
N
In
z
a
N
N
W
J
U1
z
3
W
U
4
M m
In its entireconcept, the branch is also the secret of fire
that Prometheus stole from Zeus to benefit and protect mankind .
I
grasping
LE SSON 52
ACE OF WANDS
"Root of the Powers of Fire"
A whiteradiatingangelichand,issuingfromtheclouds,and
L5 /pg 1
branchwiththreeforks,inthecolourandwiththe
sigils fthescales.Therightandlefthandbranchesend
respectivelyinthreeflamesandthecentreoneinfourflames,
thusyielding10 - thenumberoftheSephiroth.22leaping
flamesorYodssurroundit,answeringtothepaths ; these,
threefallbelowtherightbranchforAleph,MemandShin ; seven
abovethecentralbranchforthedoubleletters,andbetweenthat
anditontherightare12,6above,andsixbelow,aboutthe
lefthandbranch .
Theplay'Prometheusunbound'byAeschylushasthefollowing
lineswhichtyplifiesthegeneralmeaningofthiscard
.
"ForIamhewhosoughtthestolenfountoffire,storedin
astalk,whichprovedtobetheteacherofallkindofcraft
tomortalsandtheirgreatresource ."
TheGoldenChainofHomer(analchemicalmanuscript)states :
"ThusGodcreatedfirstthisinvisiblefireandendowedit
L5 /pg
with an unerring Instinct and a Capacity to manifest itself
into three principles" .
The main branch of the Ace of Wands has three flaming forks, this
also alludes to the Holy Trinity.
The first principle :
"In its Original mostUniversal State it is perfectly invi-
sible,immaterial, cold and occupies no space, in this
tranquil state it is of no use to us, yet in this unmoved
stateit is omnipresent."
The right hand branch .
The second principle:
"In its second state it is manifested by Motion or Agitation
into Light . In this state it was separated out of the
Chaos, whenGod said 'Let there be Light .' Yet it is still
cold. When gently moved or agitated it manifests warmth and
Heat, as is the case in all Frictions and inFermentation of
Moist Things."
The left hand branch .
The third principle:
"When collected in asufficient quantity and Violently
agitated it is manifested into burning fire . this continues
burning as long as it is agitated and has a fit subject to
act upon ; when that fails, it returns to its first stage of
tranquil Universality ."
A
1
1
t
1
Thesigilsofthescales(takenfromtheRoseCross)
onthebranchesareexplainedasfollows : Ontherighthand
branchgovernsMLK .MLK=570whichis"treign",or"the
King" ; onthelefthandbranchgovernsASh .ASh=301whichis
"Fine, smoulderingwrath" ; onthemiddlebranchgovernsMOL .
MOL=170whichis"light,rodorstick" ; hence: theWand,the
potentialofthemainbranch,thethirdprincipleasshown
above.
Whatisbeingsaidisthat"theKingreignswithdiscernment
directinghiswillpowerthroughtheWand"
representativeofthepositivemasculineforces .
Thebranchrepresenteththerawmaterialotheasyet
unshapedandunengravedwandofthemagician,itgivethaglimpse
ofhigherattainmentandaspirationjustasthemagician'swand
invokesanddirects.

AtoolofWillwhicheventuallybecomes
'Will' ; itisfertilityunmanifested,anddarestoenter
the realm ofmanifestationthroughdivinewillfromtherealmof
creation as itcandonothingelsebut,forthatisitsnature
andnopowercanpreventthisforasabranch,itiscutfromthe
treeoflife .

Thisbranchlinksthetwoworlds,atransmitter
fromeachtotheotherastheFnSoph
L52/pg3
Middle branch . From this you can see theUniversalSpiritinits
threepowers .
shown
- theWandbeing
into
AurisforKetherofone
worldand Malkuthofanotheranditisthisrealmofnothingness
thatthewielderoftheAceofWandstraverses .Itislikenedto
thelegendoftheGoldenBough,forduetotheGoldenBough,a
TrojanprincecalledAeneaswasabletosurvivewhenpassing
through the underworld .
Primary Red and its complementary, Vivid Green, arethemain
colours usedin the AceofWands.Thisredisthefireelement
ofwhichthisAcerepresentstheelementinitspureessence,
its raw energy.

TheAceistheincorporealformofitselement
shownherebythevividgreenwhichisthe
L52/pg4
elementalwombof
fire,thegestationplaceofthiselement.Thebranchiscol-
ouredprimaryred,otherwiseknownasvividred,representingthe
SecretFire .Thecolourthengraduatesintoamoreflameredas
itmovesoutonthethreeforkstowardstheflameswhichportray
aflamered(orangered)ontheirverytips .The22Yodsareof
theprimaryred .Thebackdropofthiscardisofthegreenwhich
emergesfromthecloudsinitsdepthofpigmentationwhichthen
graduateintoatranslucentgreen(ofthesamecolour)tothetop
ofthecardanalogoustoheatrisinginadesert .Thewhole
impressionofheatshouldemanatefromthecardifcolouredin
thismanner .Justlooking at itshouldgivetheauto- suggestion
ofthefeelingofbeingexposedtotremendousamountsofheat,
butwithoutburning,whichiscalledcelestialheat .Oneachof
thethreebranchesisadiskshapedlaymancolouredthewhiteof
Kether,thesigilineachlaymaniscolouredred .Thehand
protrudingfromthecloudsiswhitealludingtothebrillianceof
Ketherandexhibitsthequalitiesofmanifestation .Theclouds
arebrilliantwhiterepresentingtheplaceofmanifestion .The
redreflectsoffthecloudsandhandsasifthereisareflection
fromtheeternalfireofcreation .
t
1
t
t
t
I
I
L52/pg 5
The primary red portrays the seed of Universal energy - pure
force - blind force - the Yod of Yods being spontaneous in nature
it must givebirthandgivingbirthiswhatitdoestothecyclic
chainofnature .

It isagenerative andlifegivingpowerhence
theuseofthewordenergyasshownabovewhichrelatesto heat,
frictionandfire .

Aseachbranchbecomesaflameitmanifests
asfireinitspureform - spiritualpower .
Aichemicallyredispositiveenergyandmasculineforce,and
thegreenislife,thenourishmentoflife .Togethertheyillus-
tratethenatureofcreation .Theyarethealltransmuting
elixir .Theaceofwandsshowstransmutation,thesecondstage
beingtheTwoofWands.
Thevividgreenshows immortality - greenisgrowthand
activatedinthefireelementisgrowthoftheHolySpirit .This
SpiritbecomesintheAceofWandsareflectionofKether ; the
Spiritmanifestinginitsmaterialformfirstthroughcreative
energy.
spontaneous,
L5 /pg 6
DIVINATORY ME ANINGS
ON MATTE RS OF the Physical Body; Selfhood ; Self Projection ; new
ideas; new beginnings ; reactions to outside stimuli ; thelife
force; first encounters :
In these circumstances the Ace of Wands represents potential
creation and the inevitable submerging of latent qualities. It
denotes a new birth of a child or project . It shows a person of
divine purpose although unconscious of the fact ; the action is
and is a pure force, but this pure force has as yet
nocontrolling principle ; its sole purpose is but to manifest .
stabilizing factor must be introduced so that it does not become
a blind force.

It can portray aperson dominant and overbearing


in character, or a person with that 'charisma', 'ever burning
life force' .

When representing matters of health the Ace shows


high and intermittent fevers brought on by psychological inter-
ferences, or the general act of 'over expending' . But in general
it is boundless energy and all things of concern to an individual
can be penetrated to theirroot . Most of all, with the turn of
this card, onespeaks from thesoul . "Divine Purpose
ON MATTE RS OF possessions and personal attitude towards such;
personal estate and resources both physical and material ;
principles and feelings; management and projection ; commerce,
personal, commercial, governmentaland national financial affairs
directly relating to the self :
t
1
I
t
1
sions for great value is placed
L52/pg 7
The Key word actioned by the Ace of Wands under the above
matters is obscurity . Little value is placed on material posses
on the spiritual andmental
resources of the self . Concerning material dealings in the above
matters,absolute honesty, integrity and although unusual with
the latter - subtlety . In whatever role one plays lies little
games although the actor believes in the purity and 'intent' as
well as 'content' of his/her act . Concerning business affairs
the Ace of Wands is favourable for commencementproviding the
cards turned up on either sideare favourable, for where there is
the potential there must be an instigator and a director of the
force.

On the negative side the Ace showswrath,


excessive loss due to impulsiveness ."Obscurity" .
outbursts,
ON MATTE RS OF short journeys ; communications ; relationships ;
brothers,sisters, neighbours ; humour; identity ; early education;
books; correspondence ; enlarging ones field of activity:
Intense motion is the key word for the above matters. The
Ace of Wands gives motivationfor undertakings ; plans get under-
way and on the drawing board, but as yet unformulated . E nergy
and desire compels action, so we see stirrings of undertakings
such as journeys, the writing of neglected correspondence or the
Ace will forewarn receipt of letters or communication in some
other form . A member of the family may travel 't or 'from'
unexpectedly or announcea new goal or project . The Ace also'
showsthedesireforonetofindoneself
.

Itadvisesbyits
presencethatthiscanbeworkedtowardsthroughreading(inspir-
idea and the energy (impetus) to inspire it .
Completion" .

It shows strong emphasis that one cycle


L5?/pg B
ational philosophical or esotericliterature) .It must be remem-
bered thatthe Ace onlyshows the first stirrings, the seed of an
When enquiring on
concerns that are already underway theAcethendepictsthe
drivingforcebehindactivities .Itsactionisgenerallyfavour-
ablebutifthereareproblemsitwilladvisethatfuelisbeing
addedtothefire ."IntenseMotion" .
ONMATTE RSOFtheendofonestageandthecommencement
another; thehomeandprivatelife ; buildings; land ; parents ;
security ; emotions; significantshiftsinlifesdirections ; con-
cerningthesoul ; theoccultinitspracticalterms ; divination :
TheKeywords for theAceofwandsontheaboveare"After
isended
andanotherpreparingtocommence .TheAceshowswhatconcerns
thequerentintheunconscious,whatdrivesthisisthefactthat
thequerentisshownthatheorthesubjectofhisquestionwill
propelledintoanothercyclebeforeconsciousrealisation
pass
.Itshowsthattheresultsofacyclearecom-
nomorecanbeachieved,somuchsothatithasreturned
toitssource .Inthispositionitcanshowthepassingoverof
asoul fromthisworldtothenext
.Thismaynotnecessarilybe
adeathbutaninitiation,oronestransformingfromKether
comes
pleted,
oneworldtoMalkuthofanother . Onmaterialmattersthere
restlessnessandasyetundecidedplans
.Parentsappeart
omnipresentinthepersonspsychologicalmakeuppossiblepsyc-
hosis.

Securitycanonlybefounddeepwithinoneselfandwith
is
I
1
r
L 2/pg 9
the knowledge that all beginnings mustend and all endings are
beginnings . E motions canbe violent when one is out ftouch
with ones soul . "After Completion" .
ON MATTE RS OF lovegiven ; creativity of selfhood; the creative
will ; children; entertainment ; recreation ; speculation ; sports;
thearts ; gambling ; fulfilling potentiality :
This is a most powerful position for the Ace of Wands. Its
effects are far reaching, lasting much longer than in any other
position . It represents universal creativity, procreation .
Although representing pure speculation, there are results there-
from, once the cycle commences. On matters of love given the Ace
showspurity and is of more of a universal level ratherthanfor
selfishreasons.E xternalexpressionshinesbrilliancebut
excessivenesscanquicklyovercomethebrilliance.Ifcards
depictingamasculinesignturnupwiththeAce,orinthe11th
house,boysaregenerallyreferredto- birthofaboychild -
butonthemostparttheAcereferstoconception- ratherthan
actualbirthinthisposition .Fertilityistheemphasis .
E ntertainmentandrecreationareofnoconsequencewiththisAce
foritsprimeconcerniscreativity ; itsforceiscatabolic .For
actualcreativeartsthiscardisfortunate - indshowssuperior
talent .Thekeywordofthispositionis"Procreation" .
ONMATTE RSOF

sickness(generallydue

workproblems) ;
employment : employees ; relationshipswithinthework environment ;
conflicts ; service; onessenseofservice ; theacquiringof
skills ; psychology :
The Ace of Wandstends to be a malefic under these matters
unless favourable cards turn up with it depicting otherwise . The
pure root force of the Ace cannot handle day to day conflicts
which the modern man is confronted with in the working environ-
ment . Such living has takenmantoofarawayfromthespiritual
source.SotheAceshowsareactiontothiswayoflife,which
manifestsinsickness: rashes,feversinfluenza,headaches,bad
tempers,viruses,neuralgia
Theinnerpsycherevoltssurfacingasoneormoreofthemany
moderndayailments.Thelifeforcebecomesblockedandrun
down.TheAceshowsthelifeforcefightingback,contant
throughitscreativity.Italsoportraysanoveremphasisof
loyaltyinonessenseofservice .Thiscancausesomepeopleto
worktoexhaustion . Relationshipscanbecomeheatedbut
shortlivedwithmanyanangrywordsaid .Ifthecentralessence
oftheAceofWandscanbereachedwithintheindividualwhile
subjecttotheseconditionsthengreatstrengthandunderstanding
isachieved - notforgettingtheabovementionedproblemsover-
come .Thisisthelessontaughtandthegoaltowhichonemust
strive.Onapersonalnoteaburningdesireforselfimprovement
isevident .TheKeywordsforthisposition
ONMATTE RSOFmarriageanddivorce ; contracts; theother
competitors,adversaries,andknownenemies ; partnerships ;
relationships ; socialinteraction ; thelawofcompensation ; what
islacking ; theworkingsofkarma :
L52/pg10
andnervousorstressconditions.
are"ToSurmount" .
party;
public
1
I
I
public activity etc .

Others reactwithzealandknown
actwithvehemence,oftenblindly,buttheAceofWandsturnedup
showsasecretweapon - truth.Karmicallyyoucouldn'thavehad
itbetter ; itshowsdevotionandthewilltofacetruthand
reachfortheknowledgeoftheUniversalSpirit .
compensatewhenthisAceappears
.OntheotherhandtheAcecan
showyouwhatislackingifthelatterisnotanactualityin
yourlife .Thisiswhatmustberealised .Thekeywordforthe
AceofWandsinthispositionis"Devotion" .
ONMATTE RSOFdeathandrebirth ; accidents; effectsofothers;
crimeandretribution ; legacies; wills; othersestatesand
finances ; jointresources ; moods; sex ; spiritualism ; rejuvena-
tion; mysticism ; transformation ; psychotherapy :
Thecreativepowers

theAceofWandscanbealmost
drownedoutinthisposition .

Ifthiscanbeavoidedthenwe
L52/pg11
The Ace of Wands shows somethingwhere there was nothing
hope. It lends life to relationships, fire to life and rekindles
the embers of relationships .

Therefore in questions of marriage


andpersonal affairs this card is favourable . On questions f
termination of associations it again says'yes', forremember the
Ace of Wands is a blind force and where there is fire more wood
will

added and the flames will leap higher .

This is the
precedent for matters concerningcontracts and partnerships,
enemies
Youcannot
havecreativityrebirthingthroughothers . Birthisthemain
essencegivenfromthiscardwhereasthispositionshowsrebirth .
LZ2/pg 12
Are they not one and the same! Moreimportantly the Ace shows
that a seed has been planted, but this is the period of gesta-
tion. Again, as shownin the abovematters, we come across a
situation where material concerns must be dealt with . The "blind
force" provides initial impetus but to have any other influence
the Ace must concede defeat. It is good with good andbad with
bad - if the wheel is in motion it will continue, if not it will
start . It does not concern itself with spiritualismand mysti-
cism as they are but diversions from the source and truth . Tran-
sformation is its potential and transform it will . The key word
for this position is "Transformation" .
ONMATTE RSOFreligion; metaphysics ; philosophy ; higherstudyand
education; legalsystems ; morals ; institutionsoflearning ; long
distancetravel ; exploration ; publiccommunications ; the
collectivemind :
Whatmoredisruptingistruthinitspurestform,canthere
inaworldoferroneousenigmaofsurdsthroughinstitution-
alizedculture of religion,metaphyscis,politicsandphilosophy .
TheAce of Wandsisamysterytothechild of earthandassucha
pathtowalk,anyoneofthemanypathsgivenbythisposition .
It

reflects

aspiration,

spiritualpower

and

influence.
Favourableinmattersofreligion,philosophy andallforms
spiritualteaching .Itexhibitsthepuristwithhighmorals .
questioningtravel,theanswerisyes,butasyetintheplanning
stage,ortheintitialmovementinsuchanundertaking .
willbeinhastethereforethefastestmeans
In
Travel
willbechosen .
t
r
a
t
t
t
I
r
L52/pg 1
Fortunateare the affairs of learning and in legal matters. But
what is wrong we ask? The answer is simple. The Ace is purely
potential . It is up to us to bring "whatever" into manifesta-
tion . The omen is there,do we act on it? And what of the
collective mind? "It is!" The key word for this position
"Truth" .
is
ONMATTE RSOFpublichonour ; status; ambitionsandgoalsreached ;
achievements ; profession; theotherparent ; causesfordisgrace ;
recognition ; identity :
"Master humandestiniesamI . . .knockingonce every
gate"saiththeAceofWands"Igivethyouopportunityyetal-
entedsloth,getupandtakeyourbowasyehathnotyetbegun" .
Thepenultimateofachievementisshownbythepositionofthis
Ace.

Doyouliedowntodieonceyourgoalisattained - no!
Newgoalsareset,ambitionsrealised .Thispositionisfavour-
ableforpublichonourandforadvancementsorhonourinprofes-
sion,forinitiationofeventsingovernment .Theenergyisnew
andmustbeguidedasaparentguidestheenergiesofagrowing
child,somustaheadofanorganisationguidethewheels
commercewithin'hisindustry .
action,'oractionisshownbytheAce,andthisactionm st be
directifnotsomewhatruthless .

Butlookdeeperandyouwill
seethesecretisinthetiming .Thereisatimeformercy,a
timeforseverityandatimetowalkthemiddlepath .Themaster
ofthispathishewhocommandsallactionfromthemiddlekeep-
ingatrueandclearperceptionofthelawofcauseandeffect .
Yourdownfallisnottotake
"Opportunity" .
ON MATTE RSOF friends ; income ; socialalliances ;
theyarenewanducnertainwhichpreventcloseness .
L52/pg14
legislation ;
onesattitude; groupactivities; government; counsellors; love
received ; spiritualandintellectualaspirations ; ideals;
fulfilment ; whatyouyieldandhowyoubenefitothers :
SpiritualaspirationscometotheforewhentheAceofWands
appears.Itisthebirthofgatherings,groups,organisations
andthesittingofparliament .Beginningsaredeemedfortunate
bytheAce,andifqueryingoutcomes,theytooarefortunateif
surroundingcardsreinforcethis .

Friendshipsgrowbutasyet
TheAceis
thepre- natalstateofasleepinggiant,theuniversaluncon-
scious.Idealsareprominentandtheinspiredaspires,carrying
othersalongwithinthecurrent .Meetingsleavemembersinvig-
oratedspurringonactioninthoseabletopickupthecurrent ;
thustheAcefavoursgroups .Ontheotherhanditalsoshows
thataspirationsandidealsareallthatcomeoutofsuchmeet-
ings,astheAceisablindforcegivingtheimpetus,butthis
impetusmustbepickedupandcarriedon ."Aspire
ONMATTE RSOFresponsibilityandcontribution
others;
humanisticconcerns ; karmicdebts ; unresolvedproblems ; hidden
resources ; theunconscious ; sorrow; healthafflictions ; secret
enemies; hospitals ; secretsocieties; selfundoing ; total
identification :
r
r
f
L /pg15
UnderthesematterstheAceofWandsshowsaformoftransi-
tionbutintheinitialstagesitshowscompletion .Onehas
fulfilledallKarma,thusacompletenewbeginningwithnewKarma
tobemadeistotakeplace
.Itshowsrelease ; release from
hospitals,theholdofenemies,fromhealthproblemsand
imprisonmentwhetheritbefrommindorbody .Itidentifieswith
theHolySpiritinitscreativeform.Thereisnosecrecywhen
theAceturnsup,secretsareknown,nottold,butknown .Those
inspiredseekspiritualretreatifnotinthephysicalinthe
mind .Thisalsodepictsastraltravel .Theneedtobeintouch
withonesessenceisofprimeimportancetothosewhoreceive
thiscard .Onesselfundoingcomeswhentoomuchprideandover-
confidenceovercomeslogicandethics ; gamblestakenandlost .
"Release" .
- - - 00000- -
Ace
(The Furnace)
In the 1st position :
In the 2nd position:
In the 3rdposition :
Inthe4thposition :
Inthe5thposition :
Inthe6thposition :
Inthe7thposition :
Inthe8thposition :
Inthe9thposition :
Inthe10thposition :
Inthe11thposition :
the12thposition :
"DivinePurpose"
"Obscurity"
"IntenseMotion
"AfterCompletion"
"Procreation"
"ToSurmount"
"Devotion"
"Transformation"
"Truth"
"Opportunity"
"Aspire
"Release"
- - - 00000- - -
L52/pg16
Wands - "Root of the Powers of Fire" - " Potentiality
ME DITATIONONTHE ACE OFWANDS :
LettheStudentfirststudytheoverallpictureofthecard,then
studyeachdetail .Studythecolours.
NowlettheStudentlookatthecardandfeelitsvibrations .
Writedownyouroverallimpression .
- - - 00000- - -
ex- eeerci se
Nowpaintthiscardwiththeabovedescribedcolours .
outlineddrawingissuppliedwiththislesson .
A/TFriT
t
1
w
I
1 1 " )
h i
z
0
N
W
J
Q
z
Q
3
( 1
r-r-r--m-00~m" n" 00 monr
-ww
1
1 1
t
i
t
t
t
r
LESSON 53
2 OF WANDS
" Lord of Domi ni on
0 t o1 0 degreesAri es
i np
L5 _S/ pg 1
A wh i t e radi at i ngangeli c h and, i ssui ng fromt h e clouds, and
graspi ngt wocrossedwands,flamesi ssuefromt h epoi nt ofjunc-
t i on.Ont wosmallwandsaboveandbelowaret h ezodi acsymbols,
wi t h flamesoffi vei ssui ngt h erefrom.
Th i ssh owsmangraspi ngt wobat onswh i ch areh eldfi rmlyi n
asi nglegri p,sh owi ngappli cat i onoft h eenergyh eldi nt h eAce
ofWands.Th econcept of bot h powerandappli cat i onbut under
cont rol of t h epowerh oldi ngt h em.Fromt h euni t yoft h eAceof
Wandst h et wowandsrepresent t h espli t ofpowert h erebycreat i ng
duali t y;t h eh i gh erandt h elower,t h eposi t i veandt h enegat i ve .
Th i sspli t nat urei nrelat i ont ot h e fi reelement represen-
o
t et h li gh t anddark .Th i si ssh ownbyt h eXgi venbyt h eposi t i on
ft h e 2 ofWands .Ifyoulookat t h ecent repoi nt oft h eXyou
wi llget t woV'smeet i ngi nt h emi ddleonedescendi ngandone
ascendi ng,t h ecent rebei ngt h econcent rat i onofenergi es .Two
polari t i esareformedbut asyet undi vi ded .Asapoi nt ofmani -
fest at i oni t i sanarch et ypalperspect i veoft h epowersoft h e
opposi t esmeet i ngat ah alfwaypoi nt ,t h econsci ousanduncon-
sci ous,t h ei nnerandout er.

Th epoweroft h i scardt h erefore


LS3Jpg
meet s ; i t h as beendescri bed as mast ery of t ech ni que . A di vi -
si onh as beenmade of t h e wat ers of creat i onof above and below,
one bei ng t h e reflect i onoft h e ot h er, as i t i s sai d i nt h e
" Emerald Tablet " of Hermes ( Tri smegi st os) :
" Int rut h cert ai nly and wi t h out doubt , wh at everi s below i s
li ke t h at wh i ch i s above, and wh at everi s above i s li ke t h at
wh i ch i s below, t oaccompli sh t h e mi racles of one t h i ng ."
Th e X i s alsoa symbol of t h e di sci ple Andrewandh asbeen
called'St Andrew'sCross'represent i ngt h eUni onoft h eupper
andlowerworldswh i ch fi t t i nglydescri best h elast st agebefore
t h euni onoft h eAceofWands .St .Andrew,byt h eway,repre-
sent edt h eAst ralSelf .Th eXoft h ewandssh owst h ebi ndi ng
fact orauni fi edforceofst rengt h andbalance .Th i ssh owsalso
t h at Marsrules,bri ngi ngabout abundant energy,di rect i onand
leadersh i p.
K
Th esui t ofWandsh asbeenpai nt edi nt h ecoloursoft h e
i ngScale .Int h e 2 ofWandst h ewandsarei nt h ecolouroft h e
planet ( Mars) wh i ch i sScarlet ( avi vi dRed) ;t h ebackdropoft h e
cardi si nt h ecolouroft h ezodi acsi gn( Ari es) wh i ch i sBlood
Red .Th eromplement arycolour,Yellowi sh Green,i st h ecolourof
t h ei ssui ngflames,out li ni ngandsh adi ng .Th eh andandclouds
arebri lli ant Wh i t ewi t h areflect i onofRedaroundt h eedges,
sh owi ngspi ri t mani fest i ngt h rough t h efi reelement .
Th eScarlet sh i nest h rough t h evi brat i onoft h eBloodRed
1 1
i
I
1 1
1 1
t
f
s
t h ereby emanat i ng fromt h e card a deepRed vi brat i on
L53/ pg-
maki ngi t
purelyanAri esofAri es,orasi t i s,aMarsofAri esvi brat i on.
Th i sgi vesapowerfullycommandi ngvi brat i on,oneofgreat dri ve,
energyanddesi ret oi mprove .Ani ni t i at i veforcecomesfrom
t h esecolours .Th i sforcei sofact i on,andwh enunh i nderedi t
i sforeverseeki ngnewt h i ngs,i t soarst ot h eh i gh est sh owi ng
t h epot ent i alforaleaderoft h ough t .Th ecolouri smart i aland
onanegat i vesi dedest ruct i veenergi espredomi nat ewi t h mi suseof
power;awarri or,andarut h lessavenger.Th esecolourssh owno
mercy .
Th eplanet Mars,sh ownast h esymbolofSpi ri t const rai ned
byMat t er,i sassoci at edt ot h e2ofWandsi nt h ezodi acsi gn
Ari es .

" LordofDomi ni on" i st h enameoft h e2ofWandsbut i t


seemsmoreappropri at e,
ci at i on,t

callt h ecard" LordofAct i on

Nevert h eless
ch aract eri st i csareverypredomi nant .
abundant energy,andi sveryst rongwi lledwi t h acapaci t yfor
di rect act i on.It squali t i esarecourageousness,i ni t i at i veand
i nspi ri ng .Th i sposi t i oncanleadt osuccessbut generallyi t
referst ot h ebegi nni ng,not t h eend . .Th evi cesofMarsi nAri es
aresh ownt h rough t h eappli cat i onoft h eenergyi t provi des,just
asi t squali t i es .It i saveryh i gh egoproject i onwh i ch t h e
et h i csandbeli efsarefi lledwi t h fant asy .It saggressi ve
at t ri but esreact i nat t ackrat h ert h anapproach ,orreact i onsof
defensi veness .It snat urei saut ocrat i canddomi nant wh i ch
bet urnedfromt h ebest appli cat i ont ot h eworst t h rough lack
compromi se .
wh enconsi deri ngi t sast rologi calasso-
bot h
Marsi nAri esrepresent s
can
It scompet i t i venessi sagoodat t ri but epovi di ngi t
i ncorporeal form,
L53/ pg 4
doesn't become anobsessi on. Th e appli cat i onof t h e energi es of
Mars i nAri es depends ent i rely ont h e i ndi vi dual .Froma psych o-
logi cal approach t h e excessi veaggressi veness of Mars i nAri es
canbe front foranunconsci ous i nferi ori t y complex, h ence
const ant act i onforreassurance . Th e lessonforMars i nAri es i s
t ot h i nk before you act .
t h e Ace of Wandsrepresent s t h e fi re element i ni t s
t h e 2 of Wands represent s t h e fi re element i n
i t s last st age of puri t y -ort h efi rst st age ofpuri t yi flook-
i ngi nt h eopposi t edi rect i ont omani fest at i on
.Hencet h ei nt er-
pret at i onoft h e2ofWandsi sgenerallyt akenfromaposi t i ve
andpurelycreat i vepoi nt ofvi ew.

Th e2ofWandsi sacard
" i ncessant act i vi t y" ,t h eopposi t esi t represent sbyt h ecrossi n
t h ewands( t h ecrossi nfact sh owsfourdi vi si ons) cannot act as
formunt i lpolari sat i ont akesplaceandeach di vi si onact sont h e
ot h er.

Ift h i sdoesnot t akeplacet h eact i vi t yceasesandt h e


card'si nfluencefallsaway
.Th ereforet h eenergi esoft h efi re
element t h rough t h e2ofWandsi si nt erpret edi ni t sh i gh est
form,orrat eofact i vi t y,andonallmat t ersspi ri t ualor
ph ysi cal t h e key word i s act i on; i t s mode of act i oni sdomi ni on.
Ch okmah ofYod( i nfluenceoverot h ers,aut h ori t y-power) .
t
t
t
I
1
I
DIVINATION
e ON MATTERS OF t h e Ph ysi cal Body; Selfh ood ; Self Project i on;new
i deas ; new begi nni ngs; react i ons t oout si de st i muli ; t h eli fe.
force ;fi rst encount ers:
Wh ent h e2ofWandst urnsupont h esemat t ersi t -st rongly
L53/ pg 5
1
I
advi sesproject i onandast at eofdi rect confront at i on
persont ot h emat t eri nconcern.Th e2ofWandsi nfact advi ses
t h at t h i si st h ebest wayt oh andleasi t uat i on,andt h emost
probable .But i t canalsoi ndi cat et h at such act i oncanbeones
downfalli fsurroundi ngcardsi ndi cat et h i s .Th eli feforce
port rayedi nt h i sposi t i oni sabundant energy,st ami naandexces-
si vevi t ali t y,alwaysresult i ngi nph ysi calexert i on.Personal
project i oni swi t h confi denceandposi t i vi t y .Generallyt h i s
posi t i oni sveryfort unat efort h e2ofWandsandanymi sfort une
onlycomesabout t h rough onesownact i ons .

Ph ysi cally,t h erei s


usuallygoodh ealt h andvi t ali t y( ornews
come) ,but at t h eworst onecanexpect afeveri sh t ypeofi ndi vi -
dualpronet oi nfect i ons .
t h i sposi t i oni
somet h i ngmust beconfront ed .
ONMATTERSOFpossessi onsandpersonalat t i t udet owardssuch ;
personalest at eandresourcesbot h ph ysi calandmat eri al ;
pri nci plesandfeeli ngs ;management andproject i on;commerce,
personal,commerci al,government alandnat i onalfi nanci alaffai rs
di rect lyrelat i ngt ot h eself :
oft h e
ofgoodh ealt h t o
Th ekeywordfort h e2ofWandsi n
" Confront at i on" ,nomat t erwh at t h equest i on,
LSD/ pg b
A const ant search forways of bui ldi ng ones mat eri al and
fi nanci al resources and dri ve t oi mprove ones ownabi li t i es. Th e
2 of Wands i nt h i s posi t i onsh ows t h at ri sks aret akenfort h e
sake of gai n, but more oft ent h annot wh at i s at t ai ned sli ps out
of ones graspdue t orecklessness . Money comes and goes qui ckly .
Alt h ough t h e sui t of wands does not relat e di rect ly t o posses-
si ons and money, i t does relat e t ot h e act i vi t y and energi es
i nvolved, soplease readonwi t h t h i s concept i nmi nd sot h at t h e
words are not mi sunderst ood . Th e2 of Wands i nt h i s posi t i on
concerni ng t h e above li st ed mat t ers sh owst womai nact i ons .Th e
fi rst i si mpat i encei nh andli ngonesaffai rsandt h eot h eri s
ent erpri seandrapi dgai nt h rough ent erpri se -orspeedyact i on,
( t h i sofcoursedependsont h equest i on.

Th ekeywordfort h e
ofWandsi nt h i sposi t i oni s" Ent erpri se" .
ONMATTERSOFsh ort journeys ;communi cat i ons ;relat i onsh i ps ;
brot h ers,si st ers,nei gh bours ;h umour;i dent i t y ;earlyeducat i on;
books ;correspondence ;enlargi ngonesfi eldofact i vi t y :
lect
t h i sposi t i ont h e

ofWandsi ndi cat esanact i vei nt el-


andaggressi veassert i oni ncommuni cat i on.

Th eexpressi on
gi venonmat t ersofrelat i onsh i psandcommuni cat i oni sdomi nance .
Peoplearespurredi nt oact i ont h rough someformofcommuni cat i on
but -at t h esamet i met h i scancreat edi sput es .
s
2
Wh at evert h e
i nt ermedi aryreact i on,peoplearewokenup.Onli t eraryconcerns
t h i scardsh owscreat i vi t y,wri t i ngsat t endedt oonafai rly
i nt ensi vescale .

Th esewri t i ngsareat t i mesi mpulsi ve,dri ven


1
1
I
t
L53/ pg 7
froma h i gh ersource .

Manyi nspi rat i onal wri t i ngs arei ndi cat ed


by t h e 2 of Wands .

Concerni ng relat i onsh i pst h e 2


generally i ndi cat e a lonerand t h i s i s due t ot h e i nt ensi t y
t h e energy depi ct ed .

Th e answert h i s card wi ll gi ve t o such


quest i ons, dependi ng onh owt h e quest i oni s worded and ont h e
surroundi ng cards, i s ei t h er: 1 . Th e relat i onsh i p wi ll be
i nspi ri ng but frenzi ed, or2 . Th ere wi ll be argument s ordi s-
put es .Th e lessonh ere i " Appli cat i on" .
ON MATTERS OF t h e end of one st age and t h e commencement
anot h er; t h e h ome and pri vat e li fe ; bui ldi ngs ;
ext ernal, but are alsoi nt ernal and canbe di rect ed t o
Wands
land ; parent s ;
securi t y ; emot i ons ; si gni fi cant sh i ft s i nli fes di rect i ons ; con-
cerni ng t h e soul ; t h e occult i ni t s pract i cal t erms ;di vi nat i on:
Wh ent h e 2 of Wands t urns upont h ese mat t ers i t st rongly
advi ses t h e querent t oest abli sh h i s/ h erownroot s sot h at fut ure
effort s canbe bui lt on. A st at e of i ndi fference i s sh own,
t owards t h e h ome envi ronment and i nmost i nst ances rest lessness
leadi ng t oasuddenbreak-a-way( ph ysi cal orpsych ologi cal) from
t h e h ome and parent s . Th e energi essh ownh ere, i f used creat -
i vely, canfi ll t h e soul andprovi de a soli d base forani ndi vi -
dualspersonali t yt ogrowfromwh enaspi ri ngt ot h eh i gh est ,and
t h eh i gh est i swh at oneaspi rest oi ft h eofWandsh asanysay
i nt h emat t er.Morei mport ant lyt h e2ofWandssh owst h at
aspi rat i onsandappli cat i onofenergi esarenot necessari ly
act i vi t i es
i nt h eh ome .Great product i vi t ynomat t erwh at t h event ure .Th e
keywordandlessonh erei s" Self-Cont ai nment " .
ON MATTERS OF lovegi ven;creat i vi t yofselfh ood ;t h ecreat i ve
wi ll ;ch i ldren;ent ert ai nment ;recreat i on;speculat i on;sport s ;
t h eart s ;gambli ng ;fulfi lli ngpot ent i ali t y :
Ont h eabovemat t erst h e .2ofWandsexpressesrawt alent .
Concerni ngsport st h ecarddepi ct salot ofact i vi t yandcompet i -
t i veness .It depi ct st h eAt h let e .Impulsi venessi st h eexpres-
si onwh i ch i sappli edi nacreat i vefash i on,andt h ecardsh owsa
st rongwi ll,somet i mest ooforcefulfort h esurroundi ngi nflu-
ences .Th i scanleadt oarrogance .Inmat t ersoflove,t h e2
Wandsdenot es bi ndi ngfact orwh eret woworki nuni son.It
cert ai nlyi sn't qui et relat i onsh i pasmuch energyi sspent
creat i ng .Each i s const ant lyact i ngasacat alyst fort h eot h er.
Recreat i ngandent ert ai nment i ssough t t h rough great expendi t ure
ofenergy,usuallyi nt h edi rect i onofsport .Alt h ough acoura-
geouscardi t i s onealsooft empt at i ont h ereforerepresent i ng
weaknesst ot empt at i oni nt h eabovemat t ers . relat i ont o
ch i ldren,unwant edpregnancycanoccurast h e2ofWands i s
penet rat i on lossofmai denh ood .Th ekeywordfort h e of
Wandsh erei s" t h eCompet i t or" .
ONMATTERSOFsi ckness( generallydueworkproblems) ;
employment : employees ;relat i onsh i pswi t h i nt h eworkenvi ronment ;
confli ct s ;servi ce;onessenseofservi ce;t h eacqui ri ngf
ski lls ;psych ology :
L5./ pg8
of
Th i si sast rongposi t i onfort h e2ofWandsasi t repre-
I
1
LS / pg 9
sent s ski ll and energy expressed t h rough work ; t h e leaderofmany
ast h rough i t spoweri t uni t es .

It i sadri vi ngforcewh i ch can


qui cklysaponesvi t ali t yandt h i swouldbe
must belearned
so,but fort h e
procreat i vepowersuni t ed .Hi gh expect at i onsaremade
employeesandot h erforms relat i onsh i pswh i ch leads
i mpat i ence .Tolerance
i ngt h at not allpossesssuch vi t ali t yanddri ve .Wi t h t h e2of
Wandsi nt h i sposi t i onpromi nanceandrespect canbeearned
t h rough onesach i evement s .Healt h i saffect edt h rough over-
expendi t ureofenergyandsuscept abi li t yt oh eadi njuri es,si nu-
si t usandt h eli ke .Th i si sacardoft rut h ,t h ereforeany
psych ologi calproblemwi llbebrough t t ot h eforeandpenet rat ed
t oi t scoreessence .Ift h equerent orsubject oft h equerycan
facet h et rut h t h eproblemcanberesolved .Ifnot ,t h eproblem
i sli kelyt ocauseanexplosi ont h enbeburi eddeepagai n.Th e
keywordfort h i sposi t i oni " Accompli sh ment " .
ONMATTERSOFmarri ageanddi vorce ;cont ract s ;t h eot h erpart y ;
compet i t ors,adversari es,andknownenemi es ;part nersh i ps ;publi c
relat i onsh i ps ;soci ali nt eract i on;t h elawofcompensat i on;wh at
i slacki ng ;t h eworki ngsofkarma :
Th i s i s a weakposi t i onfort h e2ofWand-. Th e i ndi vi dual
wi sh est ofunct i onaloneandnot i ngroups i solat i oni s
desi red .Th i sposi t i oni s oneofcompensat i onandt h ei nfluence
oft h e2ofWandsdoesnot compensat e,but works i n di rect
fash i on. answert ot h esuccessofanymat t er,great energy
must

expended .

Youmust t ryh ardert h anyouwouldi nany


t
alongwi t h t h eunderst and-
force and must be looked at fromt h at level .
i ndi cat es ext raordi nary occurrences and t h e power
h appenwi ll h appenqui ckly and unexpect edly .
L5': ./ pg 1 0
ot h erposi t i on. Th i s mode of act i onappli es t oall of t h e above
mat t ers . Cont ract s, part nersh i ps and marri age are gone i nt o
h ast i ly and act i vi t i es concerni ng such areapproach ed
aggressi vely . Int h e worki ngs of Karma t h e 2 of Wands sh ows one
of a mart i al ch aract erwh ot ook wh at t h ey want ed nomat t erwh at
t h e consequences . Th e lessont obe learnt i s t osh are and t o
care wi t h people,not loosi ng si gh t of t h e endresult forall
t h at mat t ers i s t h e i nt errelat i onsh i pwi t h people and wh at you
cangi ve by yourpresence . " Take Care" .
ON MATTERS OF deat h and rebi rt h ; acci dent s ; effect s of ot h ers ;
cri me and ret ri but i on; legaci es ; wi lls ; ot h ersest at es and
fi nances ; joi nt resources ; moods ; sex ; spi ri t uali sm; rejuvena-
t i on; myst i ci sm; t ransformat i on;psych ot h erapy :
Th i s posi t i oni s one of powerfort h e 2 of Wands . It sh ows
t h e querent i s -orcanbe -i ncont rol and h ave i nfluence over
ot h ers, and be li able t o, t h rough t h e powers of uni on, obt ai n
fort une .

It represent s last i ng effect s of joi nt vent ures and


profi t t h ereof . We must st i ll look at t h i s card i nt h e fi re
element -one of energy and appli cat i onand not i nt erpret t h e
produce of t h i s card mat eri ali st i cally . One canreapri ch es an
spri ri t ual level undert h eabove affai rs fori t i s a procreat i ve
Th e 2

Wands
" t ocross over
and h avea look ; t obe very much a part of t woworlds . Th e
Wands i s t h e element of surpri se h ence wh at everi s goi ng
Th e key word i s t h e
1
1
1
t
ONMATTERSOFpubli ch onour
;st at us ;ambi t i onsandgoalsreach ed ;
ach i evement s ;professi on; .t h eot h erparent ;causesfordi sgrace ;
recogni t i on;i dE,i t i t y :
t
Th e2ofWandsi sst rongundert h eabovemat t ers .

It sh ows
t h emani fest at i onofapromi si ngcareerandgreat energypursui ng
such .

Oneusuallyat t ai nsorh oldsaposi t i onofpower.

Th e
" Unexpect ed"
.
ONMATTERSOFreli gi on;met aph ysi cs ;ph i losoph y ;h i gh erst udyand
educat i on
;legalsyst ems ;morals ;i nst i t ut i onsoflearni ng ;long
di st ancet ravel ;

explorat i on
;

publi c

communi cat i ons


;

t h e
collect i vemi nd :
Th e2ofWandst urnedupundert h eabovemat t ersh owst h at
i ft h equerent gi vesh i m/ h erselft h enecessaryeducat i onand/ or
t rai ni ngt h equerent wi lldevelopself-confi denceandexpert i se .
L5/ pg1 i
Th i si sa,powerfullydomi nat i ngforcebut i t i sonet h at i snot
seen,-i t i ssensed ;i t comesfromwi t h i norfromabove,but not
fromwi t h out .Th eWi llsoarst ot h eh ei gh t sofph i losoph yand
met aph ysi cs,andani nsat i abledesi ret olearni squi t eevi dent .
Inmat t ersofundert aki ngandsuccessorach i evement t h ereoft h e
answerwouldbe" Yes" fort h i sposi t i oni soneofopt i mi sm.But ,
ont h eseposi t i vepoi nt si t must bewarnedofspeculat i onand
longjourni esasonemayfallsh ort oft h emark .

Th eremust
surroundi ngst ablei nfluencespert ai ni ngt ost ami na .

Th ekey
wordi " Opt i mi sm" .
L5=/ pg
abi li t y

bri ng not only fame but not ori et y i s evi dent but
person's downfall canbe t h ei rdesi re forpowerat all cost s .
Generally t h erei sgrandure,andexperi enceavoi dsdi ffi cult
si t uat i ons .

Th eenergyoft h e2ofWandsflowsfreelyh ereand


alli t represent sasi t sbaseessencecanbeexpressed .Wh en
enqui ri ng about ot h erpeopleororgani sat i onsi t usually i mpli es
adomi nant i nfluencewei ldi ngapowerfulbanner-onet h at canbe
qui t eformi dable .Th ekeywordi s" Ambi t i on" .
ONMATTERSOFfri ends ;i ncome ;soci alalli ances ;legi slat i on;
onesat t i t ude ;groupact i vi t i es ;government ;counsellors;love
recei ved ;spi ri t ualandi nt ellect ualaspi rat i ons;i deals ;
fulfi lment ;wh at youyi eldandh owyoubenefi t ot h ers :
Freedomofexpressi oni s a pri mei ssuewh ent h e2ofWands
i sappli edi nt h i saspect .'Weh aveapureelement i nt h e2of
Wandst urni ngupundert h eabovemat t ers,gi vi ngauni fi edforce
ofsi nglemi ndedi nt ent .Avot ei nGovernment i sunani mousand
uni onsgai npowerfulposi t i ons .Onapersonalleveloneh ast h e
forcesofli gh t anddarkat onesfi ngert i pswei ldedt h rough t h e
Wi ll .Wh at di rect i ont h eWi llt akesi supt ot h ei ndi vi dual .
Indulgencei nsoci alpleasuresi si ndi cat edbyt h e2ofWands
combi nedwi t h h appi nessandjoyandcompani onsh i p.
i s" Uni fi ed" .
ONMATTERSOFresponsi bi li t yandcont ri but i ont o

ot h ers ;
h umani st i cconcerns ;karmi cdebt s ;unresolvedproblems ;h i dden
Th ekeyword
1
1
1
L5t i / pg 1 3
resources ; t h e unconsci ous ; sorrow; h ealt h affli ct i ons ; secret
enemi es ; h ospi t als ; secret soci et i es ; self undoi ng ; t ot al
i dent i fi cat i on:
Th e2ofWandssh ows a si t uat i onofcomplet i on,yet wi t h t h e
fi nalst epasyet not t aken.Onemoret h i ngmust bedonenow
t h at allmat t ersh avebeencomplet edandcarefullybalancedout ,
andt h at i st o" st epover" .Tomanyt h ewords" st epover" would
i nferdyi ng,but t h i si snot so.It i st h edeat h oft h epast ,
but alsot h efi rst st epi nnewbegi nni ngs .Th esenewbegi nni ngs
arenot asi fyouwerenewlybornbut asarebi rt h t aki ngwi t h i t
allt h eaccumulat edknowledgeofpast experi ence,alt h ough t h e
past ,i t selfnowsuperfluous,i spush edbacki nt ot h e
subcon-
sci ous .
So,foralloft h eabovemat t erst h e2ofWandsrepre-
sent st h esat i sfact orycomplet i onandt h epenet rat i onofnew
begi nni ngs .Th ekeywordfort h e2ofWandsi nt h i sposi t i oni s
" Penet rat i on" .
2 o-f Wands : " Lord of Domi ni on" -" Act i on"
( Fi rst St age Calci nat i on-Blackeni ng)
In1 st posi t i on:
In2nd posi t i on:
In3rd posi t i on:
In4t h posi t i on:
In5t h posi t i on:
In6t h posi t i on:
In7t h posi t i on:
In8t h posi t i on:
In9t h posi t i on:
In1 0t h posi t i on:
In1 1 t h posi t i on:
In1 2t h posi t i on:
" Confront at i on"
" Ent erpri se"
" Appli cat i on"
" Self-Cont ai nment "
" Th e Compet i t or"
" Accompli sh ment
" Take Care"
" Unexpect ed
" Opt i mi sm"
" Ambi t i on"
" Uni fi ed"
" Penet rat i on"
---00000--
LC7/ pg 1 4
MEDITATION ON THE TWO OF WANDS :
Let t h e St udent fi rst st udy t h e overall pi ct ure of t h e card, t h en
st udy each det ai l . St udyt h e colours .
Now let t h e St udent look at t h e card and feel i t s vi brat i ons .
Wri t e downyouroverall i mpressi on.
---00000---
exerci se
Now pai nt t h i scard wi t h t h e above descri bed colours .
out li neddrawi ng i s suppli ed wi t h t h i s lesson.
1
i
Un
z
a
w
W
J
Q
Z
d
3
t t i
-i =--s=mm--
t
1
poi nt i ng upwards at anangle, and as ani nt roduced fact ort h e
t h i rd wand poi nt s upwards .

Th i s i s a reflect i onof t h e Holy


Tri ni t ysh owni nt h eAceofWands .But i t i snot just a reflec-
t i on,
i t i spowerformulat ed,brough t i nt omani fest at i onfromt h e
LESSON 54
3 OF WANDS
" Lord of Est abli sh ed St rengt h "
1 0 t o20 degrees Ari es
O
i n. P
wh i t e radi at i ng angeli c h and, as before, i ssui ng from
clouds and graspi ng t h ree wands i nt h e cent re ( 2 crossed and
t h i rd upri gh t ) flames i ssue fromt h e poi nt of junct i on.
Th e t h ree wands are h eld fi rmly i nasi nglegri p,t h emaxi -
mumone h andcanh oldi nt h i smannerandst i llret ai nst rengt h
andbalance .

Th ei nt roduct i onoft h et h i rdbat oni nt h emi ddle


oft h eXsh owst h ecent ralpoi nt ofi ncreasedst rengt h
maxi mumwi t h i nt h eout let ofasi ngleh andwh i ch di rect st h i s
force.

Th i scent ralpoi nt i nt roducedbyt h et h i rdbat oni st h e


Sunandt h i spresencerepresent sat aperi ngfact ort ot h eforce
previ ouslyappli edbyMarsandprevent soverst i mulat i on.

Th e
amount

f energy and forceappli ed wi ll be enough t o sui t t h e


si t uat i on.
Th efi rst t wowandsareast h eywerefromt h e2ofWands,
L54/ pg 1
L54/ pg
i ncorporeal t ot h e corporeal, t h e 2 of Wands bei ng t h e i nt erme-
di ary st age . Th e symbol sh ownby t h e t h ree wands i st h esext i le
wh i ch i sasi gi lfromt h eGreekAlch emi calt radi t i on.Th esex-
t i lerepresent st h i rt ydegrees( 30,3+0=3) .30i sverymuch
i nt h eunconsci ousandt h eenergi esareuni versalandspi ri t ual,
bei ngi nt ernalt h eyt apot h erdi mensi ons .Th esext i lealso
represent st h esoul,uni onofspi ri t ,soulandbody .Soh erewe
h avet h e3ofWands,t h et h i rdst agei nt h esui t ofWands .
sext i leh assi xpoi nt sandt h i salludest ot h esi xpoi nt edst ar.
Wh ereweh adi nt h e2ofWandsonedescendi ngforceandone,
ascendi ngforcemeet i ngi nt h emi ddlebut not yet mergi ng,i nt h e
Wandst h epowersmerge,auni oni sformed ;t h eonei s
creat edt h rough t h i suni onofspi ri t ,'soulandbody ;andasi t
says i nt h e" EmeraldTablet
'Just asallt h i ngsproceedfromOnealonebymedi t at i onon
Onealone,soalsot h eyarebornfromt h i sonet h i ngby
adapt at i on.'
Oneneedsaynomore,forfromt h e3ofWandswh i ch i s
mani fest at i onoft h eAceand2ofWands,t h erei sgrowt h and
mult i pli cat i onast h reei st h eformulaforcreat i on,t h ecat alyst
act i ngasuni onuponduali t y .
t h e3ofWandst h ewandsarepai nt edt h ecolourot h e
planet i nt h eKi ngScalewh i ch i nt h i scasei sMai zeYellow .Th e
backdropoft h ecardi sBloodRed,t h ecolouroft h esi gni n
Ki ngScale.

Th eflamescomi ngfromt h eh andandwands


Th e
a
t h e
are
1
I
1
Green.
congeni alcompany .
L54/ pg
" coloured i nt h e complement ary colour

t h e backdrop, Vi vi d
Th e h and and t h e clouds radi at e Wh i t e wi t h t h ei rsh adi ng
and out li ni ng t i nt ed red, t h i s sh owi ng t h e spi ri t mani fest i ng
t h rough t h e fi re element .
Th e Mai ze Yellowvi brat i ng_ t h rough t h eBloodRedemanat es
powerful deepOrange wh i ch i s a powerfullysoot h i ng h eali ng and
revi t ali zi ng colouras warmi ng as t h e Sun. Th i s deep Orange
represent s " Mast ery by Wi ll" and i t li nks manwi t h t h e Uni verse
t h rough i t s di rect effect ant h e spi ri t ual aura . It i s t h e
source of powerof t h e rulers but alsoone of love and nobi li t y.
Th e Suni nAri es i s t h e planet and-zodi ac si gnat t ri but ed t o
t h i scard .Th i scombi nat i oni s anenergyofst rengt h ,wi llpower
and vi t ali t y; i t i sfort unat eforadvancei nli fesact i vi t i es,
t h et aki ngofopport uni t i es,posi t i onsopromi nenceandt h e
t aki ngonofresponsi bi li t y .Asi nMarsi nAri est h erei senergy
andpower,but ,t h eproject i onofi t i snot sospont aneous,i t i s
morecont rolledi nt h eSuni nAri es .Th eSuni sexalt edi nAri es
t h ereforei t sposi t i veli fegi vi ngexpressi onwi ll beemph asi sed .
It gi vest h eabi li t yt olead,self-confi denceandi t smode
act i oni si ndependent ofext ernalfact ors ." IAm" wouldbest
descri bet h epowerbest owedbyt h eSuni nAri es .Th i sconfi gura-
t i onpromot esforesi gh t wh i ch becomesproph ecybut wi t h a
t endencyt oi deali t y .Opi ni onsareout spokenandi t skeenment al
energydeli gh t si ni nt ellect ualargument s .

Onesi nt elli gencei s


fpri mei mport ancecausi ngonet oseekt h esh ari ngofi deasi n
Met aph ysi calandoccult concernsaresubject s
L54/ pg 4
of i nt erest and t h ere i s a t endency t oclai rvoyance .
t h e3ofWandst h ei deaformedi nt h eAceoWands
i mpregnat edi nt h e2ofWandsi snowfert i li zedandacourse
act i oncannowt akeplace .Hencei t sname" LordofEst abli sh ed
St rengt h It smodeofact i oni si nt ernalpower,aut h ori t yand
uni fi cat i on.
Bi nah ofYod( pri de,arrogance,selfassert i on) .
DIVINATION
ONMATTERSOFt h ePh ysi calBody ;Selfh ood ;SelfProject i on;new
i deas ;newbegi nni ngs;react i onst oout si dest i muli ;t h eli fe
force;fi rst encount ers :
Onapersonalnot et h e3ofWandsdenot esoneof

sunny
di sposi t i onwh oh aseaseofproject i onoft h eselfwi t h t h e
abi li t y

t urnpri deandarrogancei nt oat t ri but es .

It i s
posi t i on selfreali zat i onandsuccessi nonesendeavours .
Self-assert i onleadst oach i evement .One'seesoneselfaswh at
t h eyreallyareandset sout t out i li set h equali t i es,wh et h er
posi t i veornegat i ve .

Th eph ysi calbodyh oldsgeneralgood


h ealt h andh asani nnerpowerorreservet h at i susuallyappli ed
i naposi t i vemanner.

Th eenergyoft h i scardt akesh old


and
i ni t i alevent sandlaunch est h esei nt ooperat i on.
onesach i evement si si mport ant fort h ose
Recogni t i onof
represent edbyt h e7'

f
Wandsandduet ot h i st h esepeopleuset h ei rcreat i vet alent st o
t
personal est at e and resources
pri nci ples and feeli ngs ; management and project i on; commerce,
personal, commerci al, government al and nat i onal fi nanci al affai rs
di rect lyrelat i ngt ot h eself :
L54/ pg 5
t h at end .

Wh ent h e 3 of Wands t urns up i nt h i s posi t i oni t skey


word i s " Foresi gh t " .
ON MATTERSOF possessi ons and personal at t i t ude t owards such ;
bot h ph ysi cal' and mat eri al ;
Th e3ofWandsi nvokesvi rt uouspri nci plesandfeeli ngs,
gi vi ngh onest yi ndeali ngsoffi nanceandpersonalaffai rs .Know
t h yself,bet ruet ot h yselfandyouwi llbet ruet oot h ersdes-
cri besi t scodeandlesson.Wh ent urnedupundert h eabove
mat t ersi t foret ellsgoodfort une,i ncreasei npossessi ons,suc-
cessfulnegot i at i onsi nbusi nesscommerceori ngovernment al
affai rs .

Ifsurroundedbyopposi ngcards,t h e3ofWandssh ows


t h et oi lwh i ch event uallysuspendsorceasest h eadverseevent s
and

t h rough t h ereservesofpersi st enceand,i nnerpower,


relaunch esact i vi t i esonamoresuccessfulnot e .

Profi t ari ses


out ofselfdevelopment ofonest alent swh i ch cant h enbeusedt o
at t ai nobject i ves
.Th i smeanst h at youmust endeavourt out i li ze
allyourpersonalresourcest oach i eveyourobject i ves
.
" Ut i li sat i on"
ONMATTERSOFsh ort journeys ;communi cat i ons ;relat i onsh i ps ;
brot h erssi st ers,nei gh bours ;h umour;i dent i t y ;earlyeducat i on;
books ;correspondence
;enlargi ngonesfi eldofact i vi t y :
Th e out let fort h e
art i st i c, romant i c andwarmi nassoci at i ons .
L54/ pg6
energi esoft h e3ofWandsi nt h i s
posi t i on t h rough communi cat i on.Wh ent urnedupundert h e
abovemat t ersi t i sopt i mi st i c,andgi vesh opeandprobable
successt ot h eresult oft h equest i on.Aflarei nwri t i ngand
speech i sch aract eri zedbyt h e3ofWandsandt h at t h eessenceo
t h e subject i s bound t obe expressed . Travel i nevi t able,
pleasurederi vedandt h eexpressi onsh ownbyt h e3ofWandsi s
Anot h ermeani ng
deri ved fromt h e 3of Wands h ere i s t h at not h i ng i s secret .
Wh at everi t i st h eknowledgeofi t wi llbespreadfarandwi de .
" Int eract i on
ONMATTERSOFt h eendofonest ageandt h ecommencement
anot h er;t h eh omeandpri vat eli fe ;bui ldi ngs;land ;parent s ;
securi t y ;emot i ons;si gni fi cant sh i ft si nli fesdi rect i ons ;con-
cerni ngt h esoul ;t h e occult .i ni t spract i calt erms ;di vi nat i on:
Th e

of Wands t urned up undert h e above mat t ers t each es


t h at i ndependenceandsecuri t ycomesonlyfromwi t h i nandcan
onlybeach i evedaft eryouaccept yourresponsi bi li t i est oyour-
selfandt h osearoundyou .

Selfassert i oni si mport ant ast h ere


areset backs,but duet oset backsonemeet st h esech allenges
t h erebygrowi ngst ronger.

Th erebecomesi ncreasedact i vi t yi n
t h eh omeandconcernswi t h propert yarebrough t t ot h efore,wi t h
speculat i onandnegot i at i oni npurch aseofland .

Wi t h t h e3
Wands posi t i oned t h us new st eps are t akenonli fe's pat h ways . It
i s t h e i ni t i at or, alt h ough i t t alksofaPat h ofLi gh t ,ast h e
Post ulant ,youh aveach oi ceofPat h sandt h ere are manyt h at you
I
1
t
I
canwalk .
ONMATTERSOFsi ckness( generallydue
employment : employees ;relat i onsh i pswi t h i nt h e
confli ct s ;servi ce ;onessenseofservi ce ;t h eacqui ri ng
ski lls ; psych ology :
Concerni ngworkrelat edmat t erst h e3ofWandssh ows
posi t i veexpressi on,workwi llbeenjoyedandt h ere
L54/ pg7
nessence t h e of Wands sh ould depi ct h armony . Th e
key word i " Ini t i at i on" .
ON'MATTERSOF love gi ven; creat i vi t y of selfh ood ; t h e creat i ve
wi ll ; ch i ldren; ent ert ai nment ; recreat i on; speculat i on; sport s ;
t h e art s ; gambli ng ; fulfi lli ngpot ent i ali t y :
Th i s i s t h e posi t i onof Vi rt ue'fort h e3ofWands . -Vi rt ue
as i nt h e i nh erent powert oproduceeffect s

Int h eext remewe


h avet h ecardi nalort h eologi calvi rt ues .Success i nanyoft h e
aboveact i vi t i esi sdet erredbyover-confi denceandduet oover-
confi denceonemayneglect t odeveloponescreat i vet alent swh i ch
ensuresuccess.Hereweh avet h eart i st andt h ei nvent or.Th e3
ofWandsi ndi cat esaposi t i vevi ewont h eaboveact i vi t i esrepre-
sent i ngt h euni onofli kemi nds .

It sh owsconcernandcare
ch i ldrenandt h ei reducat i on.Ont h eot h ersi deoft h i si sa
sch emewh i ch i s grandi sed,andat t h emost maybecommencedbut
unfi ni sh ed .

Th ekeywordfort h e3ofWands-i nt h i sposi t i oni s


" Vi rt ue" .
workproblems) ;
workenvi ronment ;
wi ll
promot i on,orrecogni t i on,andanemployeewi llbefai t h ful .Th e
Wand' powerof uni fi cat i ont ells t h at success comes wh en
one works i nh armony wi t h fellow workers, doi ng nomore, and no
less .It i ndi cat est h at ani nt erest sh ouldbet akeni ndi et ary
and h ealt h regi mes and t h e i mprovement of yourappearancefor
addi
recuperat i on-i s speedy and
your( ort h e one enqui red about ) general well bei ng .
t i on, wh enenqui ri ngabout h ealt h ,
t h ere wi ll b resi st ance t odi sease . Wh enaski ng about t h e
course di rect i ont ot akeforsomeone'soryourownment al
h ealt h t h at i sat present i nanunst ablecondi t i on,yoush ould
seekh elpfromapsych ologi st orcounsellor.Th rough t h i scourse
ofact i onproblemswi llbeovercome .Ingenerali t wi lli ndi cat e
soundment alh ealt h wi t h i nt ernalpenet rat i ngpowerst ounder-
st and ." Part i ci pat e" .
ONMATTERSOFmarri ageanddi vorce ;cont ract s ;t h eot h erpart y ;
compet i t ors,adversari es,andknownenemi es ;part nersh i ps ;publi c
relat i onsh i ps ;soci ali nt eract i on;t h elawofcompensat i on;wh at
i slacki ng ;t h eworki ngsofkarma :
Th e3ofwandsi s i naposi t i onofweakness,t h ereforet h i s
card'spowerscannot beexpressedi nt h ei rfullest .Allconcerns
enqui redabout wi llresult modest lyandmoderat ely .It i s
nei t h erverygood,norat allbad,but t h erei sh opeand
opt i mi sm,andt h at i swh eret h eest abli sh edi nnerst rengt h can
wi nout t h rough persi st ence .Marri agesh ouldbeworkedat ,
relat i onsh i psbui lt on,cont ract slookedi nt odeeperbefore
si gni ngandt roublesomepeopleofsi t uat i onsput upwi t h .

St i ck k
i t out and you wi llwi nout .

Wh eret h e 2 ofWandswouldnot
I
I
1
1
L54/ pg9
compensat ei nt h i s posi t i ont h e 3 of Wands cant olerat e and meet
h alfway
.Th ekeywordoft h e3ofWandsundert h eabovemat t ers
i s" Persi st ence" .
ONMATTERSOFdeat h andrebi rt h ;acci dent s ;effect sofot h ers;
cri meandret ri but i on;'legaci es ;wi lls ;ot h ersest at es
fi nances ;joi nt resources ;moods ;sex ;spi ri t uali sm;rejuvena-
t i on;myst i ci sm;t ransformat i on;psych ot h erapy :
I
Wh ent h e3ofWandsappearsundert h eabovemat t ersi t sh ows
t h at arevi t ali zi ngwi llt akeplace
.t h erei sapowerfulforce
i nfluenci ngonesconcernwh i ch h asonlyoneout let .
must becomeawareoft h i sout let andallowsuch aforce
ch annelt h rough i t ,fori f a dami sbui lt i t wi llsurelyburst
duet

t h ebui ldupofenergy,wh i ch cancauseagreat deal


h arm.

Th equerent i sadvi sedt oworkwi t h i n

framework
est abli sh edt h i ngsi fonewi sh est osucceed .Donot st ruggleand
t ryt oh old'opposi ngfact orsast h at i sgi vi ngt h osefact ors
somet h i ngt ost ruggleagai nst -ch annelt h em!

Th i si s

t i me
wh ent ransi t i onh asnot yet beencomplet ed ; alt h ough i t i spre-
pared,everyt h i ngi snot yet i ni t splace
." Transi t i on
ONMATTERSOFreli gi on;met aph ysi cs ;ph i losoph y ;h i gh erst udyand -
educat i on;legalsyst ems ;morals ;i nst i t ut i onsoflearni ng ;long
di st ancet ravel ;explorat i on;publi ccommuni cat i ons ;t h e
collect i vemi nd :
and
Th equerent
Nobi li t yi st h esoleexpressi onoft h e 3 ofWandsi nt h i s
posi t i on.

Th ere i s gai nt h rough h i gh ereducat i on;


ones fi eld ; orst ronglyi nfluencedbysomeoneoft h at cali bre .
Wh at everi sdonei t i sdonewi t h st yle .Th edevelopment oft h e
h i gh ermi nd i s ofpri me concernt ot h e 3 of Wands and i s favour-
ableforanyendeavoursi nt h i sfi eldas
reli gi on. It sh owst h eabi li t yt osucceedandri skst akent odo
so,alongwi t h dedi cat i ont ot h ePat h ch osen.Int h i sposi t i on
t h e3fWandsadvi sest h equerent t ot aket h eopport uni t i es
avai lableandi ft h erearenone,maket h em.Holdyourh eadh i gh
andbenoble." Nobi li t y" .
ONMATTERSOFpubli ch onour;st at us ;ambi t i onsandgoalsreach ed ;
ach i evement s ;professi on;t h eot h erparent ;causesfordi sgrace ;
recogni t i on;i dent i t y :
t h i sposi t i ont h e3ofwandssh owsh owt h esubject
enqui redabout i si nessencealreadyest abli sh edandaprecedent
h as already beenset onwh at st rengt h ofonesposi t i on.Allt h e
querent needdoi st oreali zet h i sposi t i on,i fnot already
recogni sed .Oncet h eposi t i oni sreali zedt h ent h eappropri at e
forcecanbeappli edt oach i evegoals .Inalloft h eabove
concernsi t represent sh onour.Onamoremat eri anot et h e
governi ngbodi esovert h equerent areofapowerfulnat ureand
cannot beswayed,andi ft h equerent wi sh est oworki nh armonyh e
orsh emust i dent i fywi t h t h i s .Th ekeywordsfort h e3ofWands
i nt h i sposi t i onare" Est abli sh edForce" .
leaderi n
well as areasof
ONMATTERSOFfri ends ;i ncome;soci alalli ances ;legi slat i on;
t
L54/ pg 1 1
ones at t i t ude ; groupact i vi t i es ;government ; counsellors ; love
recei ved ; spi ri t ual and i nt ellect ual aspi rat i ons ; i deals ;
fulfi lment ; wh at you yi eld and h owyoubenefi t ot h ers :
Th euni fi edduali t yoft h e3ofWandsagai nbecomespromi -
nent i nt h i sposi t i on.Fri endsh i ph oldsast rongbondandone
sh ouldrelyonfri endsast h eywi llbesupport i ve .Goalsare
reach edt h ennewgoalsareest abli sh edi nt h ei rplace .Communi t y
act i vi t yt akesapromi nent placei ni nfluenci ngt h esubject of
t h equerent squest i on.Import ant peoplewi llalsoplayapromi -
nent part i fnot i nt h eflesh asanarch et ype .Amoreuni versal
out look sh ouldbeat t empt ed along wi t h t h e use of ones t alent s
fort h esakeofh umani t y .Anot h eraspect oft h e3ofWandsi n
t h i sposi t i oni ssuccessandwealt h brough t about byclari t yand
t h rough cult ure, but t h i s i s onlyat t ai ned t h e pat h of h onest y i s
walked . ( Not e : t h euseoft h ewordssuccessandwealt h are
i ncli nedt oamorespi ri t ualconcept t h anmonet ary .Th ekey
wordi s" Clari t y" .
ONMATTERSOFresponsi bi li t yandcont ri but i on ot h ers ;
h umani st i cconcerns ;karmi cdebt s ;unresolvedproblems ;h i dden
resources;t h eunconsci ous ;sorrow;h ealt h affli ct i ons ;secret
enemi es ;h ospi t als ;secret soci et i es ;selfundoi ng ;t ot al
i dent i fi cat i on:
Th e 3 ofWandsrepresent saspi ri t ualt each erandservi cet o
h umani t yposi t i onedt h us .It i srat h erabri gh t cardalt h ough i f
enqui ri ngoft h enat ureofanenemy,yourfoewi llsurely
st rong . Healt h affli ct i ons sh ould be ont h e mend and t h e querent
sh ould
drawfromt h eadvi cei nt h e6t h posi t i on.

Inspi ri t ual
concernsmi nd,bodyandsoulareone,andyou
i dent i fywi t h t h espi ri t ;i t advi sest h at t h i si st h ecourse
t ake
.Ent rancei nt oasecret soci et yi sfavourableand
become Mast erof yourownabi li t i es . Selfless servi ce t o
h umani t ych annelledt h rough wh at everpat h youarewalki ngi nyour
li fet i mei st h ekarmi cdebt port rayedbyt h i scard . " Servi ce" .
3_ of-Wands:
In1 st posi t i on:
In2ndposi t i on:
In3rdposi t i on:
In4t h posi t i on:
5t h posi t i on:
In6t h posi t i on:
In7t h posi t i on:
In8t h posi t i on:
In9t h posi t i on:
In1 0t h posi t i on:
In1 1 t h posi t i on:
In1 2t h posi t i on:
" LordofEst abli sh edSt rengt h "
( SecondSt ageCalci nat i on-Wh i t eni ng)
" Foresi gh t "
" Ut i li sat i on"
" Int eract i on"
" Ini t i at i on"
" Vi rt ue"
" Part i ci pat e"
" Persi st ence"
" Transi t i on"
" Nobi li t y
" Est abli sh edForce
" Clari t y
" Servi ce
---00000--
sh ouldbeablet o
onecan
MEDITATIONONTHETHREEOFWANDS :
Let t h eSt udent fi rst st udyt h eoverallpi ct ureoft h ecard,t h en
I
t
st udyeach det ai l . St udy t h e colours .
Now let t h e St udent look at t h e card and feel i t s vi brat i ons .
Wri t e downyouroverall i mpressi on.
---00000---
exx -src_ i s -e
Now pai nt t h i s card wi t h t h e above descri bed colours .
out li ned drawi ng i s suppli ed wi t h t h i s lesson.
-------------------
-m----w---mm-
r--
h i
h i
N
A
Z
4
Z . 3
. 0
t 0
W
J
--
. --. . . . -. . . .
I
L55/ppg1
LESSON JJ
4 OF WANDS
"Lord of Perfect edWork"
20 t o30 degreesAri es
i n
T
Twowh i t eradi at i ngangeli ch ands,asbefore,i ssui ngfrom
cloudsri gh t andleft oft h ecardandclaspedi nt h ecent rewi t h
t h egri poft h eFi rst Orderh oldi ngfourbat onscrossed . Flames
i ssue fromt h epoi nt ofjunct i on -ast h ey do aboveandbelow.
Wh i leoneh andcanh oldonlyamaxi mumoft h reebat ons,t wo
h andscancomfort ablyh oldfour. Th i nssh owst h epeacefuland
h armoni ousmarri age ofopposi t es,t h et woh ands,sh owi ngt h e
complet i onoft h emergi ngoft woi nt erfaci ngforcesi nt oacommon
uni t wh i ch i sperfect i onoft h ework(at t h i slevel) -t h us,t h e
fourt h pri nci pleh asnowbeenbornout oft h e3ofWands .
Th efourbat onscomplet eacross,oran'X'asi t i ssome-
t i mesreferredt oas . Th i scrossmakesfourdi vi si onsalludi ng
t ot h efourpoi nt soft h euni verse . Oneart h t h esearesh ownas
t h efourelement sandi nt h i scase,ast h i scardi si nt h efi re
element ,t h ecommencement oft h efourelement si nt h ei rpri mor-
di alform. Asi t cont i nuest osayi nt h e"EmeraldTablet " :
"I t sFat h eri st h eSunandi t sot h ert h eoon .

Th eWi nd
h asbornei ni t sbody . I t snursei st h eEart h .
andt h ename"LordofPerfect edWork" seemst h emost appropri at e
t i t le fort h e 4 of Wands .
Th e double cross i s also t h e symbol forAsh es or Ci nders .
any are aware of t h e symbology of t h e Ph oeni x ri si ng out of t h e
Ash es . Th e same pri nci ple appli es h ere, but wh en looki ng i n t h e
di rect i on of descensi on i t i s t h e preparat i on of t h e i ndwelli ng
Self t o be born i nt o t h eSoul'slowernat ure,andi nt i mewi ll
event uallyari seout oft h eash es,ast h ePh oeni xdi d . Ofcourse
wh enlooki ngat t h i scardwi t h t h econcept ofascensi ononesees
t h ePh oeni xari seast h ebi rt h oft h eHi gh erSelf . Ash esalso
represent et h t h esi gnofdeat h wh i ch i srat h erappropri at eduet o
t h edeat h ofonepart oft h eselffort h esakeofanot h er,andi n
t h i st h erei ssorrowandloss . Usedi h ri t ual,ash eswerenot
onlyusedt opuri fy,but i nasenseusedt osh owrespect fort h e
depart ed .
Frompureexpressi oni nt h eprevi ouscardst h e4ofWands
begi nst h ecycleoft angi bleach i evement alludi ngt ot h e-di vi ne
Sparkwi t h i nman .

Th ecrosswi t h i nasquarei st h esymbol


perfect i on i n at t er:

"I amt h eani fest eri nat t erof t h ose


wh oseabodei st h eI nvi si ble .

I ampuri fi ed .

I st andUpont h e
Uni verse .

I amt h ereconci lerwi t h t h eEt ernalGods .

I am
perfect i oni nat t er,andwi t h out met h eUni versei snot . "
Th e4ofWandsi scoloured i n t h eKi ngScale . Th ewandsare
t h ecolourof t h eplanet ,Pari sGreenandt h ebackdropoft h e
cardi scolouredt h ecolourof t h ezodi acsi gn,BloodRed . Th e
Cloudsandh andsarei nbri lli ant wh i t eout li nedandsh apedwi t h
L55/pg
I
I
Th e rays of Pari s Greenst abi li se t h e volat i le BloodRed of
Ari es wh i ch gi vet h an end product oforder,t h erebysoci alorder
i si nfi lt rat edi nt ot h esph ereofact i vi t yoft h osesubject edt o
t h i scombi nedray .
beli efsformed,
L55/
. p . g
t h e red of t h e fi re element sh owi ng t h e presence of spi ri t mani -
fest i ng t h rough fi re . Th e flames comi ng fromt h e wands and h ands
are t h e complement ary colourt o t h e backdrop, Vi vi d Green .
Cult uralvaluesarei ni t i at edandreli gi ous
fori nt ot h evolat i leredi mpregnat esast h et i sm.
gest at i oni snowcomplet ei nt h ewombandallt h e past
act i ons and experi ences of manki nd h ave become a part f all
cellularst ruct ure .
Th e ofWandsh asVenusi nAri esat t ri but ed . Venusi n
Ari essh owsaproject i onofonet h at demandsat t ent i on,h as
act i vecreat i vi t yi nart i st i cpursui t sandst i mulat esent h usi asm,
orexci t ement i nsoci algat h eri ngs . I t pursuessoci alevent sand
congeni alcompany,andlovest h ei deaoflovegi vi ngfreelyof
emot i ons,at t i mesappeari ngaggressi vei napproach . Populari t y
andext ravagancecomeseasyt oVenusi nAri es,but favoursand
appreci at i onfluct uat esast h egrassi salwaysgreeneront h e
ot h ersi de .
Th i sallsoundsqui t eacont rast t ot h eessent i almeani ngof
t h e4ofWands,but wh enyoulookat t h e4ofWandsasi t i si n
t h efi reelement ,youcanseeh owallt h eabovebasi crepresent a-
t i ons -xuareofVenusi nAri es .

Forexample,t h edemandi ng
at t ent i onbecomesaut h ori t yandt h ewi eldi ngofpower-"I wi ll
speak and you wi ll li st en" ; t h e effect s i t h asonsoci algat h er-
i ngsbecomescat alyt i c,spurri ngot h ersont onewh ei gh t s ; t h e
emot i onswh enworki ngt h rough At zi lut h becomet h at ofLove for
allcreat i onwh i ch loveswi t h aselflesspassi on,but h asnopi t y
orcompassi on . Venusact i ngi nt h efi reelement i sdrawnaway
frommat eri al,personali zedvalues,gi vi ngi t amoreuni versal
andh armoni zi ngt une .
Ch esedofYod(set t lement ,arrangement ,complet i on) .
DI VI NATI ON
ONATTERSOFt h ePh ysi calBody ; Selfh ood ; SelfProject i on ; new
i deas ; newbegi nni ngs ; react i onst oout si dest i muli ; t h eli fe
force ; fi rst encount ers :
Th e4ofWandsi nt h i sposi t i onrepresent st h eexpressi onof
"wh at i s"and . not "wh at wi llbe", asallonei s,i swh at one
expresses . Th i si ni t selfi sfi newh enworki ngwi t h i naconfi ned
st ruct urebut t h eelement ofcreat i oni sveryli mi t ed .
expressi on i s i t s own complet eness, i s h armoni c, values beaut y
anddfi net h i ngsandcanworkwi t h i ni t sownconfi nedst ruct ures
creat i vely . Th ereforeonemust not underest i mat et h i scardwh en
i t t urnsupundert h eabovemat t ers . Just reali zet h at t h ereare
li mi t s,i t senergi esarenot boundless . Wi t h i nt h i sposi t i on
Th i s
are
t h eseedsfordecadenceandeli t i sm. Th e4ofWandswarnst h at
onemust usewh at oneh ast h enopenoneselft oi deas ; t h i si snot
allt h erei s . Th eKeywordi s"Li mi t at i on" .
1
f
1
ONATTERSOFsh ort journeys ; communi cat i ons ; relat i onsh i ps ;
brot h ers,si st ers,nei gh bours ; h umour; i dent i t y ; earlyeducat i on ;
books ; correspondence ; enlargi ngonesfi eldofact i vi t y :
Alot energyi sappli edi nt ravelli ngt osoci aengage-
Th erewi llbeeasei nrela-
t i onsh i psandgeneralh appi nessi nrelat i onsh i pswi t h brot h ers,
si st ers,relat i onsandnei gh bours . Concerni ngeducat i onand
wri t i ngst h i s i s not onesfort e'ast h e4ofWandsrepresent sa
st at eofbei ng .

Bei ngcont ent i nwh at onei s,wh at oneknows,


ment sandpleasuret akent h ereof .
L55/pg5
ON ATTERS OF possessi ons and personal at t i t udet owards such ;
personal est at e and resources bot h ph ysi cal and mat eri al ;
pri nci ples and feeli ngs ; management and project i on ; commerce,
personal, commerci al, government al and nat i onalfi nanci al affai rs
di rect ly relat i ng t o t h e self :
Th e of Wands undert h e above mat t ers t ells t h at all i s
undercont rol . To possess i s of great i mport ance -Took out
anyone t ryi ng t o t ake anyt h i ng away . Onejudgesot h ersbywh at
t h eypossess,ph ysi cally,ment allyand spi ri t ually, andat t h e
most ,mat eri ally . Th et i mei sfavourablet oat t endt opersonal
busi nessandfi nanci alaffai rs . Th e4'ofWandsrepresent sat i me
sat i sfact i oni nact i vi t i espast ,present andwi t h wh at s
come,but t h i ssat i sfact i oncanleadt o so much comfort t h at one
forget st oconcent rat eongrowt h ,
andi ndulgences . "TPossess
wast i ngenergyont ri vi ali t i es
L55/pg b
and t h rough t h i ssh rugs off educat i on opport uni t i es . I t also
represent s t h e mani fest at i on of art i st i c li t erary ski lls, an
out let of wh i ch must be provi ded . Th e key word fort h e of
Wands undert h e above mat t ers i s "Cont ent ment " .
ON ATTERS OF t h e end of one st age and t h e commencement
anot h er; t h e h ome and pri vat eli fe ; bui ldi ngs ; land ; parent s ;
securi t y ; emot i ons ; si gni fi cant sh i ft s i n li fes di rect i ons ; con-
cerni ng t h e soul ; t h e occult i n i t s pract i cal t erms ; di vi nat i on :
On t h e above mat t ers t h e 4 of Wandsrepresent s a very close
t i e t o t h e fami ly even t o t h e poi nt of clanni sh beh avi our, domes-
t i c t ranqui li t y and t h e h omebei ngaplaceofgat h eri ngofmany
soci alact i vi t i es .

at t ersoft h eoccult vergeont h euncon-


sci ousreadyt o burst fort h just beforet h ePh oeni x ri sesfrom
t h eash es. I nt h i sposi t i ont h equerent i sadvi sedt h at i t i s
t i met oact asalli smadeready,andi si norder; i t i st i met o
i ni t i at efort h ecandi dat ei sready ; i t i st i mefori llumi nat i on
andst i rri ngsh avealreadycommenced .
Th eKeywordi s"Readi ness" .
ONATTERSOFlovegi ven ; creat i vi t yofselfh ood ; t h ecreat i ve
wi ll ; ch i ldren ; ent ert ai nment ; recreat i on ; speculat i on ; sport s ;
t h eart s ; gambli ng ; fulfi lli ngpot ent i ali t y :
Th e ofWandsundert h esemat t erssh owsacombi nat i onof
recklessnessandcompromi se . Beh avi ourcanswayei t h erway . I t
i supt ot h equerent t ocombi net h esenat ureswh i ch t h encan
I
I
L55/pg 7
become qui t e a vi rt ueprovi di ng t angi ble ach i evement . Th i s
ach i evement i s seent h rough t h e above mat t ers expressed t h rough
creat i vi t y . Admi ni st rat i on i n sport and ot h erforms of recrea-
t i on, act i ng and drama,a premedi t at ed gamble wi ll be t aken . I t
represent s t h e reach i ngout t o ot h ers and t h e free gi vi ng of t h e
self i nlove and t o love . Fromt h e above we can underst and t h at
t h e 4 of Wands advi sest h at ones fut ure success wi ll be, i f t h e
correct act i s made not t oo soon and not t oo lat e . "Ti mi ng" .
ON ATTERS OF si ckness (generallydue t o work problems) ;
employment : employees ; relat i onsh i ps wi t h i n t h e work envi ronment ;
confli ct s ; servi ce ; ones sense of servi ce ; t h e acqui ri ng of
ski lls; psych ology :
Th e 4 of wands sh ows t h at t h rough work t h e querent wi ll fi nd
complet eness, and t h rough ones worki ng envi ronment t h e meet i ng of
ot h ers and development of frui t ful relat i onsh i ps are ach i eved .
I f t h e querent i s not i n a si t uat i on wh ere t h i s can be ach i eved
t h en t h e 4 of Wands advi ses
wi se uncont rolledt emperament al out burst s
t h at you ch ange jobs -move fromt h e
debri and make yourself new.

Healt h i s good provi di ng t h e i ndi -


vi dual doesn't overdot h i ngs .

Remai n calmi n t emperament ot h er


can lead t o ment al and
emot i onal problems. Th e Th ymus gland and areas around t h e face
are alsoaffect ed . Bei ng conci li at ory i s t h e sense of servi ce
but t h i s i n i t self, i f not mast ered leads t o weakness and abuse .
I f mast eredi t can be a vi rt ue wh en worki ng amongst ot h erpeople .
Th e of Wands mast ers t h i st rai t t h rough t h eenergi esoft h e
fi reelement . "Conci li at i on" .
L55/pg e
ON ATTERS OF marri age and di vorce ; cont ract s ; t h e ot h erpart y ;
compet i t ors, adversari es, and known enemi es ; part nersh i ps ; publi c
relat i onsh i ps ; soci al i nt eract i on ; t h e lawof compensat i on ; wh at
i s lacki ng ; t h e worki ngs of karma:
I n essense t h i s posi t i on fort h e 4 of Wands i s qui t e st rong .
I n allof t h e above mat t ers t h eexpressi oni sposi t i veandrepre-
sent st h easpi rat i ont oupli ft ,t orai set h econsci ouslevel,
t h usi npeacet h erei suni onwi t h fellowh umansbri dgi ng
i nt ellect uallevel, alt h ough t h emai nconcensus i s t h rough t h e
onan
massconsci ousness . Th rough uni t yt h eh ardest t asksi s
ach i eved . Th i sallcomesabout i ft h equerent h asaclear
unclut t eredmi ndlooki ngonlyt owardst h e'Li gh t ' . Onconcerns
ofcont ract s,part nersh i pset c . ,t h erei saveryconvi nci ngand
i nspi ri ng element i nvolved . Th i smakessuch affai rsh ardt ot urn
down . Treadcarefully . Th ekeywordi s"Fellowsh i p" .
ONATTERSOFdeat h andrebi rt h ; acci dent s; effect sofot h ers ;
cri meandret ri but i on ; legaci es; wi lls ; ot h ersest at esand
fi nances ; joi nt resources ; moods ; sex ; spi ri t uali sm; rejuvena-
t i on ; myst i ci sm; t ransformat i on ; psych ot h erapy :
Th e4ofWandsi si ni t sfalli nt h i sposi t i on,but t h i si s
consi deredfort unat efort h i scardh ereasi t smai nconcent rat i on
i sanmani fest at i onont h emat eri alplane . Th ust h eweaknessof
i t sfallh oldsalli t sst rengt h undercont rol . Th i si sdoneby
vi rt ueofbecomi ng .

Th erei snodesi reorlust ori nt ellect ual


t
r
1
L55/pg 9
calculat i on, i t i s just "t obe . Th erei scompulsi venessi n
act i on i n all mat t ersenqui red about . Undermat t ers of fi nance
t h e 4 of Wands st at es t h at fort unat e result s wi ll come, only i f
t h at i st h edi rect i ont h eyaregoi ngi nt h efi rst place
. Cri me
i s commi t t ed t h rough i gnorance of wh at one i s doi ng and li kely
t obeunnot i ced
. I t i sfavourablet opoolyourresourcesand
t h ere may be i ncome fromwi lls and legaci es, but t h i s does not
necessari lymeanonamat eri albase . "Cont i nuance" .
ONATTERSOFreli gi on ; met aph ysi cs ; ph i losoph y ; h i gh erst udyand
educat i on ; legal syst ems ; morals ; i nst i t ut i ons of learni ng ; long
di st ancet ravel ; explorat i on ; publi ccommuni cat i ons; t h e
collect i vemi nd :
at t ai nment t h erei sh onest ybut i nat t ai ni ngt h erei s
mi sconcept i onoravoi danceoft h et rut h ,fort h eult i mat ei s
at t ai nnomat t erwh at t h ecost ; sobeawareofyour. mot i vesand
act i onswh en recei vi ng t h e 4 of Wands undert h e above mat t ers .
Here t h e 4 of Wands represent s purely spi ri t ual aspi rat i ons and
all pursui t s of ph i losoph y, reli gi on, art , et c . ; journi es i nt o
t h e ast ral and an at t ach ment t o t h e i deals of ot h er worlds .
Appli cat i onont h eph ysi cali nst udyorbyph ysi calpart i ci pat i on
i snot i ndi cat ed,leavi ngt h ei deali st anddreamer
. Th equerent
i sadvi sedt oapplyWi llt oi nt ent i on,andnot get carri edaway
on unappli ed ent h usi asm; ut i li ze t h i s energy t o creat e -don't
st agnat e . Th e Key word i s "ent h usi asm" .
ONATTERSOFpubli ch onour; st at us ; ambi t i onsandgoalsreach ed ;
L55/pg 10
ach i evement s ; professi on ; t h eot h erparent ; 'causesfordi sgrace ;
recogni t i on ; i dent i t y :
Th e4ofWandsalludest oagrandh appeni ng,t h ecomplet i on
oft h epreparat i onofavent ure,t h epi nnacleofonesprofessi on ;
onecangonofurt h erat t h i spoi nt . Success . Ambi t i ont h en
leanst owardsrecreat i on,t h eart s,ret i rement . But ,i t also
meanst h ecommencement ofanewcareerwi t h h onour. Onest epsi n
wi t h acomposi t eofpast experi encesandt rai ni ngfullyquali fi ed
t omeet t h enewgoals . Onest agei sfulfi lledsat i sfact ori lyas
anot h ercommences,but t h eresourcesarecarri edover. Th e
posi t i oni st ransi t orynei t h ergoodnorbad,but i nfluencedby
wh at everWi lldi rect si t . "CarryOver" .
ONATTERSOFfri ends ; i ncome ; soci alalli ances ; legi slat i on ;
onesat t i t ude ; groupact i vi t i es ; government ; counsellors ; love
recei ved ; spi ri t ualandi nt ellect ualaspi rat i ons ; i deals ;
fulfi lment ; wh at youyi eldandh owyoubenefi t ot h ers :
I next endi ngloyalt yandfri endsh i ponereapsloyalt y ; h ar-
moni zewi t h Soci et y'sneedsandcreat easenseofpurposesai t h
t h e4ofWandsundert h eabovemat t ers . Emot i onalandi nt ellec-
t ualsecuri t yi sfoundi nh oli st i cconcept sbut concept st h at can
beneat lyslot t edi nt oast ruct ure . Th i scardalludes t h e
h ealer,t h enat uropat h i st orh omeopat h i st . I t represent spart i -
ci pat i oni nt h ewh oleasa"part wi llnot beaccept edandt h at
composi t ei sput i nt oplayi nservi cet oh umani t yt h rough
counselli ng,groupact i vi t i es,soci alfunct i onsasameanst oan
1
I
I
I
1
1
end .
agai nst di sorder, and wi t h carefulpreparat i ont h edesi redresult
wi llbeach i eved . Th eKeywordi s"Purpose" .
ONATTERSOF responsi bi li t y andcont ri but i ont oot h ers ;
h umani st i cconcerns ; karmi cdebt s ; unresolvedproblems ; h i dden
resources ; t h eunconsci ous ; sorrow; h ealt h affli ct i ons ; secret
enemi es; h ospi t als ; secret soci et i es ; selfundoi ng ; t ot al
i dent i fi cat i on :
I n t h i s posi t i on t h e 4 of Wands represent sa magnet i c allur-
i ngforce . Th i sforceconst ant lyplacesst ressononet ost ri ve
t oi mproveasi t uat i on . Youcanuset h eseenergi est oenri ch
ot h ersoryourselffromot h ers . Healt h affli ct i onsarelymph at i c
andlooseni ngofmuscles . Th e4ofWandssh owst h at t h i si sa
t i meforsoli t udet obui ldst rengt h . Th eunconsci ousi sont h e
t h resh h old and i t i s t i me t o t unei n .

Th i s i s a t i me forprepa-
rat i onofwh at i st ocomesot one
up,
L55/pg11
government al mat t ers t h ough t must be appli ed i n armi ng
t unei nandlearn,foryou
must i nreadi nesst opassont oyournext li fecycle . Th e
secret enemi es h ere are fromwi t h i n as you are yourown worst
enemy . Concent rat eanddon't let yourmi ndwander,li mi t t h e
forceandlet i t bui ld . "Allure" .
---ooOr,---
4 of Wands :
n 1st posi t i on :
"Lord of Perfect ed Work"
(Th i rd St age Calci nat i on -Reddeni ng)
I n 2nd posi t i on :
I n 3rd posi t i on :
I n 4t h posi t i on :
I n 5t h posi t i on :
I n 6t h posi t i on :
I n 7t h posi t i on :
I n 8t h posi t i on :
I n 9t h posi t i on :
I n 10 t h posi t i on :
I n 11t h posi t i on :
n 12t h posi t i on :
"Li mi t at i on"
T Possess"
"Cont ent ment
"Readi ness"
"Ti mi ng"
"Conci li at i on"
"Fellowsh i p"
"Cont i nuance"
"Ent h usi asm"
"Carry Over"
"Purpose"
"Allure"
---0 0 0 0 0 --
L55/pg 12
EDI TATI ON ON THE FOUR OF WANDS :
Let t h e St udent fi rst st udy t h e overall pi ct ure of t h e card, t h en
st udy each det ai l . St udy t h e colours .
Nowlet t h e St udent look at t h e cardand feel i t s vi brat i ons .
Wri t e down youroverall i mpressi on .
---0 0 0 0 0 ---
exerci se
Nowpai nt t h i scardwi t h t h eabovedescri bedcolours .
out li neddrawi ngi ssuppli edwi t h t h i slesson .
I
11
11
0
Q
Z
4
3
h 7
mgor. : --ft i t on NI "-a' -so--
---no" --WONOft "--= as --
11
I
r
r
i
LESSON56
5OFWANDS
"LordofSt ri fe"
0 t o10 degreesLeo
i n
Two wh i t e radi at i ng angeli c h ands, i ssuant perNubes Dext er
and si ni st er.

Th ey are clasped t oget h eri n t h e gri p of t h e 1st


Orderand t h ey h old, at t h e same t i me,
L56/pg 1
by t h ei r cent re, fi ve
wands orbat ons wh i ch are si mi lart o t h e fi re Wand of t h e ZA .
One wand i s upri gh t i n t h e mi ddle, t h e ot h ers cross each ot h er.
Flames leap fromt h e poi nt of junct i on .
posi t i on of t h e wands creat es an i mage of an unbalanced
cross, one of corrosi on, fort h e cross draws spi ri t down mani -
fest i ngi t i nt omat t er,t h esymbol of selfsacri fi ce,andt h i s
crossrepresent edbyt h e5 of Wandsi soneofi mperfect i on . An
overbalance of anelement h asnowent eredt h esi t uat i onfromwh at
was "perfect i on i n at t er" i n t h e 4 of Wands and h as nowbecome
"domi nat i onof at t er" .
posi t i on of t h e fi ve wands also alludes t o t h e Laborum.
Th e Laborumonce appeared t o Const ant i ne i n a dreamand t h en was
t aken on as h i s emblem. I t was beli eved t h at t h e emblemput
t h ose t h at wore i t undert h e prot ect i on of Ch ri st , and i t was
beli eved t o represent t h e fi rst t wolet t ers of Ch ri st wh en wri t -
t en i n Greek .

I t was t h e Ch aldean sky god's emblem and was


L56/pg2
consi dered t o be a good omen . Th e mi ddle upri gh t wand suggest s
an axi al symbol alludi ng t o t h e "Cosmi c Tree" . Th i s emblemh as
also oft en been i nscri bed onmanyt ombs,andi mplement sbei ng
associ at edwi t h t h eAlph aandOmegasymbols .
Th e5ofWandssymboli sesmat t eruni t edwi t h h eaven,orone
couldsay,mat t eract edonbyt h equi nt essence . Energyandli fe
worki ngwi t h great force ; man . Th erei sst rengt h andseveri t y
worki ngi nmi crocosmbut i t sWi llcomesfromt h edi vi ne .
"LordofSt ri fe"i si t snameandi neverywayt h i si swh at
h appenswh ent h erei st oomuch forcecreat i nganoverbalance-of
energi es. Th i sforcei snecessaryforgrowt h andch ange,andi n
t i mefort h egai ni ngofpoweraswi llbeseeni nt h e6ofWands .
Herei nt h e5ofWandsresurrect i onfromt h eash esoft h e4
Wandsh ast akenplace .

Wi t h t h ei nt roduct i onoft h elargerwand


t ot h efourwefi ndt h at alargeforceh asdi st urbedt h eper-
fect edworkoft h eprevi ouscard .

Th ecent ralwandh asfurt h er


unbalancedt h esi t uat i onbyh avi ngnosupport ,i t i snot balanced
oranch oredi nanywaysavebyt h et woopposi t epolari t i es
each h andwh i ch nowarebecomi ng overt axed .
agai nweh avepurebut vi olent energyt h at canbet urned
i nanydi rect i on .
"I t i st h efat h erofeverymi raculousworki nt h ewh ole
world"(EmeraldTablet ) .
i
t
r
i
I
I
r
r
L56/pg
Th e 5 of Wands i s coloured i n t h e Ki ng Scale . Th e backdrop
of t h i s card i s coloured Poi son Yellow wh i ch i s apure clear
yellowt endi ng t owards greeni sh rat h ert h an gold. Th i s i s t h e
colourof t h e si gn . Th e wands arecolouredi nt h eplanet ,Li gh t
I ndi go,ot h erwi sedescri bedasDullVi olet . Th ecloudsandh ands
are ofaBri lli ant Wh i t et h epresenceoft h eSpi ri t . Th eflames
i ssui ngfromt h ewandsarecolouredi nt h ecomplement arycolour
t ot h esi gn,Ri ch Vi olet (Purple) .
Yellowbackdroprepresent sani nexh aust i blesupplyof
energy'andwi llpower,wh i ch combi nedwi t h t h eVi olet bri ngs
fort h spi ri t ualpowerwh i ch t h ench annelst h rough i nt ot h e
ph ysi callevelbyconcent rat edat t ent i on . Th i sgi vespowersof
creat i onanddest ruct i on,but t h rough dest ruct i ononebeh olds
creat i on . Th eemanat i onsfromt h esecoloursareofarawst at e
fort h i scard,aseach i sacomplement aryt ot h eot h er,t h erefore
t h eylackobject i vi t yandh umi li t y
. I t i safi xedsi nglepur-
posedemanat i onwi t h aconcent rat i onofenergi esont h epi llarof
severi t y .
Th ezodi acsi gnandplanet associ at edt ot h e5ofWandsi s
Sat urn i n Leo . NowSat urn i n Leo represent s a li fe force t h at
must be rest ruct ured, as t h e vi t ali t y does not flowas readi ly as
t h e previ ous cards . Th e expressi on of emot i on and creat i vi t y i s
alsolessspont aneous
. Sat urni nLeosh owst h at creat i vi t yand
t h e expressi on of ones essence must be worked at .

Areas of
di ffi cult y are h i gh li gh t ed wh ere Sat urn i n Leo are placed . Th ere
i s aconst ant st ruggleforcont rol of t h esurroundi ngenvi ronment
anduni versallawsbecomeonesi dedandt h erei sneedfor
rest ruct ureofi deasalongwi t h t h ebui ldi ngofaproperset
values . Th erei sst ronge di sci pli net owardsch i ldrenandconcern
about t h ei reducat i on . Onet h i ngofsi gni fi cancewi t h Sat urni n
. Leoi s t h e neverendi ngdri ve t o creat e somet h i ng t angi ble . I t s
expressi onflows lot easi erwh ench allengesaremet i nt h e
out si deworld . Toremai nwi t h i ncurrent st ruct uresonlycauses
t h ei nevi t ableandt h at i sdi scord,abreaki ngdownofsuch
st ruct urecausi ngabat t leground . Allowedt oroamfreet h e
energi est urnt oacreat i veforce,andat t h emost ,anuncont rol-
ledforcet h at plough st h rough allobst ruct i on . Nevert h eless,
onet h at meet sch allengesoni t sownground .
Geburah ofHod(quarrelli n -fi gh t i ng) .
DI VI NATI ON
ONATTERSOFt h ePh ysi calBody ; Selfh ood ; SelfProject i on ; new
i deas ; newbegi nni ngs ; react i onst oout si dest i muli ; t h eli fe
force ; fi rst encount ers :
Wh ent h e5ofWandst urnsupi nt h i sposi t i oni t i ssayi ng
t h at i t st i met o'get i t t oget h er',t i met ofaceupt oyour
spi ri t ually .
L56/pg4
and t h i s leads t ot h e desi re forleadersh i p .

Th i s can become
di ct at ori al and demand i s made forrespect Aconcept ofjust i ce
t h e
t rue
self,

creat e a newself, ph ysi cally, psych ologi cally and


I n fact , t h e 5 of Wands warns t h at i fyou don't
t
t
t
i
t
f
1
L56/pg 5
t ake t h i sadvi ce,li feci rcumst ancesaregoi ngt oforceyout odo
t h i sanyway . Th ei rony of i t i s,t h at t h eresult ofyouract i ons
now,t h at mani fest i nyearst ocome,dependent i relyonh owopen
andt rut h fulyouaret oyourself .

Th i si st h et i me t o commence
newproject s,but project syouwi llbespendi ngmanyyears
t h ere

i sgradualgai ni npersonal
on .
Th eli feforcei srest ri ct edduri ngt h ei ni t i alst agesbut t h i s
must compelonet obui ldandi mproveonesh ealt h ,ch angi ngones
unh ealt h ywayofeat i ngandli vi ng . "Rest ruct uri ng"i st h eKey
wordfort h e5ofWandsi nt h i sposi t i on .
ONATTERSOFpossessi onsandpersonalat t i t udet owardssuch ;
personalest at eandresourcesbot h ph ysi calandmat eri al ;
pri nci plesandfeeli ngs ; management andproject i on ; commerce,
personal,commerci algovernment alandnat i onalfi nanci alaffai rs
di rect lyrelat i ngt ot h eself :
t h i sposi t i ont h e5ofWandssh owst h at a feveri sh pace
i sset ononeselft obui ldnewski llsandt h rough t h oseski lls
youprofi t . Th erei sagreat dealofst ressandt ensi onwh i ch
h asbeenbui ldi nguponani nt ernallevel . Th equerent must
reali zet h at t h i si snot duet oout si dei nfluences,but duet o
i nt ernalenergi es,needs,desi resandt h eWi llt oget on . Th e
querent must learnt odealwi t h such energi esandapplyt h em
creat i velyonapersonalleveli nt h eout si deworld . Takest ock
of h owyourski llsareusedandi mproveont h em. Wh at deeper
underst andi ngdoyouh ave?Wh at areyouri nt ernalresources?
Allt h eset h i ngsmust bedeveloped,t h enoveraperi od of t i me
resourcesi nt ernaland
break
closefami lymembers,wi t h t h ereasonasyet unseen . Th e Key
wordh erei "Ch annelli ng"onesenergi es,ast h i si swh at t h e
querent (ort h esubject oft h equery)must learn .
ONATTERSOFt h eendofonest ageandt h ecommencement
anot h er; t h eh omeandpri vat eli fe ; bui ldi ngs ; land;
p flongt ermrelat i onsh i psandt h edrawi ngawayfrom
L56/pg6
. ext ernal .

Th e 5 of Wands sh ows an energy t h at i s slowbut


powerful . "Pressure" .
ONATTERS OF sh ort journeys ; communi cat i ons ; relat i onsh i ps ;
brot h ers, si st ers, nei gh bours; h umour; i dent i t y; earlyeducat i on ;
books ; correspondence ; enlargi ng ones fi eld of act i vi t y :
One of t h e mai n concerns i n t h i s posi t i on i s t h e educat i on
t h e young and t h e growt h of t h ei rpsych es. Th e 5 of Wands
represent s t h e di sci pli nari an, one t h at can i n fact be t oo h arsh
forwh at i s deemed t o be,t h eri gh t way . Th i scancauserebelli on
andvi olent out burst s,but generallyfai rplayi si noperat i on .
I ncommuni cat i on,at t i t udei si mport ant ,but t h erei sadomi nant
onesi dedapproach i nmost formsofcommuni cat i on . Wh enrecei v-
i ngt h e5ofWandsundert h eabovemat t erst h equerent i swarned
ofasi t uat i ont h at i sget t i ngout ofh andwh i ch must berech an-
nelled . Th erewi llbejourni es,but journi eswi t h out det our,
t h osewi t h asi nglepurposei nmi nd .

I t warnsoft h epossi ble


parent s ;
securi t y ; emot i ons; si gni fi cant sh i ft si nli fesdi rect i ons ; con-
cerni ngt h esoul ; t h eoccult i ni t spract i calt erms ; di vi nat i on :
i
t
t
11
t
t
t
I
i
r
I
(ort h eobject oft h equest i on) .

Emot i onsarewi t h drawn


affai rsoft h eparent s,securi t ybei ngofani nt ernalsource .
Th i sposi t i onsh owst h at t h eh omebecomesacast leandt h at t h ere
alot ofcomi ngandgoi ng,regalaffai rs . Th eSofWands
advi ses . t h equerent t h at di rect act i onmust bet akeni nyourli fe
forsat i sfact orysurvi val,t h efi rst st epbei ngest abli sh i nga
soli d,secureh omebaset osui t allneeds . Th i sdoesnot neces-
sari lymeant h eboundari esoft h epropert yyouli ve,but your
wh olesph ereofdayt odayact i vi t y . I ft h i sact i oni snot t aken
t h edri vi ngenergi essh ownbyt h e5ofWandscant urnt odest ruc-
t i vepurposesrat h ert h ancreat i ve . "Const ruct
ONATTERSOFlovegi ven ; creat i vi t yofselfh ood ; t h ecreat i ve
wi ll ; ch i ldren ; ent ert ai nment ; recreat i on ; speculat i on ; sport s ;
t h eart s
; gambli ng ; fulfi lli ngpot ent i ali t y :
mat t ersofch i ldren,t h erei sdelayi nh avi ngt h emas
onesi ndependence
L56/pg 7
Th e5ofWandsundert h eabovemat t erswarnsof(current or
fut uredependi ngonquest i on)asi gni fi cant sh i ft i nonesli fe
maybeh i ndered .

Lovei sverypowerfuland
last i ngbut wi t h h eldfromexpressi on . Th e5ofWandswarnsof
t h edangerofexcessi veness,not knowi ngwh ent ost op . I nwh at -
everi sdoneundert h eabovemat t erst h eenergydri vei srelent -
less. Th i si saposi t i onofpowerfort h e5ofWandsbut such
forcemust ber^onedwi t h ; nomat t erwh et h ert h eevent i sfor
t h egoodorbad,t h erewi llbest ri febefore-t h eendresult
;
not h i nggi veswi t h out ast ruggle .

Onalowerlevelst ruggleand
st ri fei sanunwelcomedaffai r,but ont h eh i gh erlevelsuch
ch ange
i
li kely t o leave orbe fi red . No mat t erwh at t h e cost , det ermi na-
t i on t o exploi t t alent (personalorof anot h er) push es a si t ua-
t i on t oo far. Too much force saps vi t ali t y, t h erefore cont rol
and foret h ough t of doi ng only wh at i s necessary i s advi sed . Self
adjust ment and organi zat i on wouldn't go ami ss wh i ch t h e querent
i s more t h an capable of at Wi ll .

Th e key word fort h i sposi t i on


"St ri fe
L56/pg 8
energy i s looked forward t o as i t becomes a powerfully creat i ve
force
. "Excessi veness
ON ATTERS OF si ckness (generally due t o work problems) ;
employment : employees; relat i onsh i ps wi t h i n t h e work envi ronment ;
confli ct s; servi ce ; ones sense of servi ce ; t h e acqui ri ng of
ski lls ; psych ology:
Undert h e above mat t ers t h e 5 of Wands sh ows t h at energi es
h ave become t oo i nt ense wi t h i n an envi ronment . You h avepossi bly
dri ven yourself t oo long and t oo h ard wh i ch leads t o i llnessand
-acci dent s . Blood pressure goes up and t h e back st art splayi ng up
due const ant st ress . Opi ni ons are onesi ded t h us causi ng
di srupt i on i n t h e work envi ronment .

Th ere i s li kely t o bea


employment , ori f one i s t h e employer, someone i s
ON ATTERS OF marri age and di vorce ; cont raLt s ; t h e ot h erpart y ;
compet i t ors, adversari es, and knownenemi es ; part nersh i ps ; publi c
relat i onsh i ps ; soci al i nt eract i on ; t h e lawof compensat i on ;
i s lacki ng ; t h e worki ngs of karma:
wh at
i
1
t
1
t
I
t
I
I
I
I
I
I
I
I
I
I
I
I
must li ve,get onwi t h your
areasofli feasregardsrelat i onsh i psandcont ract s
L56/pg9
Wh ent h e5ofWandst urnsuph erei t depi ct sat i mewh enall
must be
revi ewedorredefi nedsot h at aclearerperspect i vecanbet aken .
Th i si nvari ablyleadst oadeci si ont h at must bemade,t h eresult
ofsuch canbeveryt raumat i ct ot h oseat t h eendofi t
. Fort h e
onemaki ngdeci si onst h erei snoregret andt h eyact veryfast
wi t h si nglemi ndeddet ermi nedness
. "Ti mesmi lesandwet si t s
kni fe,somet h i ngmust begot out qui ckly,t h enburi eddeep,you
li fe" .

Concerni ngcompet i t orst h ey


are li kelyt o be formi dable,andsoci ali nt eract i oncanbedi s-
t ast efulbut necessaryforgrowt h
. Th eKeywordi s"Deci si on" .
ONATTERSOFdeat h andrebi rt h ; acci dent s ; effect sofot h ers ;
cri meandret ri but i on ; legaci es ; wi lls; ot h ersest at esand
fi nances ; joi nt resources ; moods; sex ; spi ri t uali sm; rejuvena-
t i on ; myst i ci sm; t ransformat i on ; psych ot h erapy :
Th e5ofWandsadvi sest h at sexualenergi esmust bech annel-
ledasi t i saperi odofsexualfrust rat i on . Onemust reali ze
t h evalueofret ai ni ngt h esexforceandlearnt out i li zei t for
const ruct i vepurposes . I ft h i si sn't reali zed,t h ent h esexual
fact ori sabused . Th eresult sofyourpast act i onsarenow
comi ngt ot h efore
. Wh et h eri t i sunfort unat eorfort unat e
dependsent i relyonyourpast act i ons,beli efsandi deals . Th ere
i sli kelyt obefi nanci algai ni nt h eh andli ngofot h ersfi nances
anddeali ngsi nlegaci es
. Th erecanalsobeli t i gat i onconcern-
i ngt h elat t erandh eavyt axesordut i esmayh avet obeaccount ed
for.

Howeverwh ent h e5ofWandsi swellaspect edwi t h t h e


valuesare
represent st h ebreakupofold
L56/pg12
t h eworld . Th i si st h ei rwayandt h eywant allt obeconvert ed .
Averyonesi dedapproach andpoli t i callyaveryoppressi ve
approach ,but aneffect i veonewh ent h enumbersareont h ei r
si de,ash asbeenseeni nt h eh i st oryofh umani t y . To"Express
ONATTERSOFresponsi bi li t yandcont ri but i ont oot h ers ;
h umani st i cconcerns; karmi cdebt s ; unresolvedproblems ; h i dden
resources ; t h eunconsci ous ; sorrow; h ealt h affli ct i ons; secret
enemi es ; h ospi t als ; secret soci et i es; selfundoi ng ; t ot al
i dent i fi cat i on :
I nt h efi rst posi t i onsh ownbyt h e5ofWandsi t wast i met o
get i t t oget h er. Heret h e5ofWandssays : i t st i met obreaki t
upanddi spersei t (wh at ever"i t "i s) . I ot h erwords,all
ambi t i ons,values,pri ori t i eset c . wh i ch wereoncet h edi rect i ng
force,nowbegi nt odi ssolve . Th ei ri mport anceh asout li ved
i t self . Duri ngt h i st i meonefeelsdi sori ent at ed,spacedout and
consoli dat ed .
aspi ri t ualbasei t i sapoi nt wh erei dealsandspi ri t ual
defi ned,ormust bedefi ned .

Th i sposi t i onalso
confusedunt i lnewvaluesandat t i t udesh avebeen
at t ach ment swh i ch h avebecome
excessbaggage . Healt h wi llbeonalowebbwh ent h e5ofWands
t urnsuph ere . Onesvi t ali t ywi llbepush edt oanexh aust i ve
st at eunlessonet reat st h i st i measawai t i ngperi od,wi t h draw-
i ngi nt ooneselft oconservewh at energyi sleft wh ereonecan
search fori nnerst rengt h . "Di ssolut i on"
---0 0 0 0 0 ---
i
i
I
I
I
I
I
I
I
I
s
i
1
t
I
t
t
1
r
r
t
I
I
Z oo-f
Wands :
(Fi rst St age Put refact i on -dyi ng)
I n 1st
I n 2nd
I n 3rd
I n 4t h
I n 5t h
I n 6t h
I n 7t h
I n 8t h
I n 9t h
I n 10 t h
I n 11t h
I n 12t h
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
posi t i on :
"Lord of St ri fe"
"Rest ruct uri n
"Pressure"
"Ch annelli ng"
of
"Const ruct "
"Excessi veness"
"St ri fe"
"Deci si on"
"Di sci pli ne"
"I mprovement "
"Values"
"Express
"Di ssolut i on"
---0 0 0 0 0 -
EDI TATI ONONTHEFI VEOFWANDS :
Let t h eSt udent fi rst st udyt h eoverallpi ct ureoft h ecard,t h en
st udyeach det ai l . St udyt h ecolours .
Nowlet t h eSt udent lookat t h ecardandfeeli t svi brat i ons .
Wri t edownyouroveralli mpressi on .
----ooOoo---
ex--grci s--e
Nowpai nt t h i scardwi t h t h eabove
out li neddrawi ngi ssuppli edwi t h t h i slesson .
descri bedcolours .
wwwwww---0 o-rw
woft 4ms
an
L57/pg6
could be using it for development . This is a time topreparefor
thefuture . 'Preparing" .
ONMATTERSOFtheendofonestageandthecommencement
another ;thehomeandprivatelife ;buildings ;land ;
security;emotions ;significantshiftsinlifesdirections ;con-
cerningthesoul ;theoccultinitspracticalterms ;divination :
timesofchaos,thereisstability . Thisisa
w ill ; children ;entertainment ;recreation ;
thearts ;gambling;fulfillingpotentiality:
parents;
With the 6 of Wands in thispositionit is advisedthat it
istimeforconsolidation ;pickuptheflow ofenergyanddirect
itintoastructuralform . Thisalsorelatestothebuildingof
thephysicalandspiritualbasetow orkfromhence,evenin
fortunateposition
forthe6ofWandsandallmatterscanbereadthus . Thequerent
islikelytoreceivebenefit,orsomethingofbenefit . Thereis
happinessinthehome . Iftakinganew directioninlifethe
timeisfortunate. . The--Keyw ordforthe6ofWandshereis
"Consolidate .
ONMATTERSOFlovegiven ;creativityofselfhood ;;thecreative
speculation ;sports ;
Childrenare(andmustbe)givenasmuchaspossible,the
opportunitytodevelopandlearn . Itisapositionofromance,
loveandgoodluckforthe6ofWands. Inmaintaininggraceit
isfortunateinalloftheabovemattersbutinexcessivenessthe
equilibriumissoonshattered .

Avaluablelessonthatistaught
I
I
I
t
i
andmindasthereisathreatofailments .
157/pg7
from the 6 of Wandsinthispositionistheapplication the
CreativeWill . Letthequerenttakeheedofthevirtuesgivenin
thiscardandapplyitsw isdominonesdailylife. Onemust
standseparatefromtheselfandlookon,thusguidingeach
actionandthoughtw ithclarity,w hichintimew illcometo,full
understanding. "Understanding" .
ONMATTERSOFsickness-(generallydue

w orkproblems) ;
employment : employees ;relationshipsw ithinthe . w orkenvironment ;
conflicts ;service;onessenseofservice ;theacquiring
skills ;psychology :
thispositionthe6ofWandsgovernshomeopathyand
spiritualhealing.

Oneshouldconcentrateonhealingthebody
Whilethingsappear
w on over and currently easy, you must demand from yourself
constant flow of application in your w ork,otherw isecarelessness
setsinandvictorydoes
chance

lookintothe
yourcurrentactions .
efforttostrivetow ards
notlast .
Theseenergiesarefreeflow ing,
ismostprobablyofthepsyche,
TheKeyw ordi"Prediction" .
ONMATTERSOFmarriageanddivorce ;
competitors,adversaries,andknow n
relationships ;socialinteraction ;
The6ofWandsprovidesa
future,foresightintotheresults
Itadvisesonetoputenthusiasm
efficiencyandfurtheringofthe
into
self .
ifthereisanyobstructionit
notofexte nalcircumtances .
contracts ;theotherparty;
enemies ;partnerships;public
thelaw ofcompensation ;w hat
is-lacking ;tew orkingsofkarma :
'Shethatw edsw illw iselymatchherlove,Norbebelow her
husband - Norabove" . (Ovid) . The6ofWandsadvisesthatthe
querentshouldbeconfidentinhis/herdecisionsandthatitis
timetocapitalizeonresources .

Lifesconcernsw orkinequili-
brium,so muchsothatonecanbeeasilysw ayedbyothersasboth
sides f thepennycanbeseen .
desirous of greatloveandalsopreparedtogivelove,
aw areofthedirection f feelingsasthesetend
encompasing.
L57/pgS
Italsoadvisesthatoneis
thereisadangerofw astingenergiesonactingtoosoonin
butb
tobeall
Inpersonalrelationshipssuchfeelingscause
confict - loveisselfish.

The6ofWandsisfortunatefor
contractsofallformsandrelationshipsingeneral . "Prosper
ON MATTERSOF deathandrebirth;accidents ;effectsofothers ;
crimeandretribution ;legacies; w ills ;othersestatesand
finances;jointresources ;moods ;sex ;spiritualism ;rejuvena-
tion ;mysticism;transformation ;psychotherapy:
The6ofWandsadvisesthatthelessonofConservation
Energymustbelearnt . Financialbenefitandincomemustbe
convertedintow orkingassets . Thispositionshow sinnersight
intomatters,andthequerentisadvisedtotrusthisinner
voice,butheshouldsleepondecisionsuntilheissurethe
pictureisclear . Asingleindividualcanexercisehisfullest
potentialw henw orkinginunityw ithanotherw herepersonal
resourcesandenergiesarecombined .

The6ofWandsw arnsthat
ones
t
t
1
1
L57/pg9
private and businessaffairs . This action causes delays and
additional expenditure of energy to rectify the situation . The
secret is "w hen to act and w hen to remain still" . The Key w ord
_for the 6-of Wands
inthispositionis"CalculatedAction" .
ONMATTERSOFreligion
;metaphysics ;philosophy ;higherstudyand
education ;legalsystems ;morals;institutionsoflearning ;long
distancetravel ;exploration ;publiccommunications ;the
collectivemind :
The6ofWands

initselementinthisposition .
Philosophy-isthepow erofbeingandonew oulddow ell
in apply-
ingtheirenergiestohigherreligion,metaphysicalstudiesor
to
theChurch . Positionsofimportancecanbeachievedandexplored
avenuesputintooperation .

Travelislikelybutonlyfor
definedpurpose .

Apow erfulmomentumcansetupfromthisposi-
tion,farbeyondthequerent'srecognitionofhow , . w hyandfor
w hatend . Onecanbecarriedalongfortherideandtheneven-
tuallyspunoffbythemomentum,oryoucanlatchontothis
pow er,absorbingit,channellingonesenergiesalongitslines,
andthenthroughthisbecomingquiteaformidableforce .
"Pow er".
ONMATTERSOFpublichonour ;status ;ambitionsandgoalsreached ;
achievements ;profession ;theother'parent ;causesfordisgrace ;
recognition ;identity:
Whenaskingaboutyourprofession,the6ofWandsansw ers
Aparentisw elllovedbutmustlearnto
L57/pg10
that' --times are fortunate and that great deal has been
confronted and overcomew iththeresultsnow availabletouseto
onesbenefit . Achievementsaregreatandhonourisderivedfrom
these. The6'o4. Wandsisgoodinallaspects . Goalsandambi-
tionsarew onoverandoneisidentifiedw ithsuccess . Beproud .
letothersdeveloptheir
ow nselfdiscipline .

Thisparentmaybein

position
prominance. The6ofWandsrepresentsVictoryundertheabove
matters .

Itrepresentsanenergythatisnottooforcefuland
nottoosoft ;aforcethatadjuststocircumstances .

TheKey
w ordis"Victory" .
ONMATTERSOFfriends ;income;socialalliances ;legislation ;
onesattitude;groupactivities ;government ;counsellors ;love
received ;spiritualandintellectualaspirations ;ideals ;
fulfilment ;w hatyouyieldandhow youbenefitothers :
Groupsw orkinharmonythroughprogressionarystages .
Legal,diplomatic,andlegislativecontroversiesarew on . Itis
atimeoffulfilmentandachievement . Ifquestioningsomeones
advicethe6ofWandsshow sthatitw asgivenw ithw isdomandif
carriedout,likelytobesuccessful . Inunificationthere is
victory,thereforethe6ofWandsfavoursallgroupactivities .
Youarew arnedtoletothersexpresstheirow ncreativetalents
andgetonw iththedevelopmentoftheself . notexploit
others . TheKey,w ordforthe6ofWandsinthispositionis
"Fulfilment" .
1
I
1
ON MATTERS OF responsibility and contribution t others ;
humanisticconcerns ; karmic debts ; unresolved problems ; hidden
resources ; the unconscious; sorrow ; health afflictions ; secret
enemies ;
identification :
L57/pg11
hospitals ;

secretsocieties ;selfundoing;total
Throughhardw orkcomeththefulfilmentofhopesandw ishes .
Herethe6ofWandsrepresentsthepow eroftheSecondOrder .
Allpastactionsarenow judged
. Youcannotgetoff . w ithsym-
pathyorexcuses
. Allpresentandfutureactionsaredeliberate
andyoumustansw erforw hatyouWillorallow youregotorun
aw ayw ith. Youareexpectedtoberesponsibleforyourthoughts,
desires,intentandreaction . Youmustmaintainequilibrium
internallyandexternallymakingeachthoughtandresultthereof
oneofWill - PureWill . Illnessesshow nbythe6ofWandsare
Apoplexy,fattydegenerationoftheheart,andfevers . Theseare
T- not beyondhelpandthemostpositivehelpyoucangetisthrough
your ow nWill . Youhavenobodyelsetoblamebutyourselfif
you notdoallthatisw ithinyourpow ertohelpyourself .
TheKeyw ordis"Will
---00000---
b- fWand-2 : "Lord of Victory"
(Second Stage Putrefaction - gestation)
In 1st position :

"Opening"
In 2nd position :

"Take Advantage"
. In 3rd position :

"Preparing"
In 4thposition

"Consolidate"
In5th position :

"Understandin
In 6th position :

"Prediction"
In 7th position :

"Prosper"
In 8th position :

"Calculated Action"
In 9th position :

"Pow er"
In 10th position :

"Victory"
In 11th position

"Fulfilment
In 12th position :

"Will"
---00000--
MEDITATION ON THE SIX OF WANDS:
Let the Student first study the overall picture of the card, then
study each detail. Study the colours .
Now let the Student look at the card and feel its vibrations .
Write dow n your overall impression .
---ooOoo---
eexeer -cc -i --se
Now paintthiscardw iththeabovedescribedcolours .

An
outlineddraw ingissuppliedw iththislesson .
L57/pg12
1
1
w
h7
z
0
0
0
W
J
L
0
ir--
-------------------
I
Tw o 'hands holding six w ands, three crossed .

A third hand
issuing from acloud at the low er part of the card holding an
upright w and w hich passes betw een the others . Flames leap from
the point of junction .
Thetw ohandsmeetingonthehorizontalshow strength,
balance and harmony (see 6 of Wands).

The introduction
largercentral w and reinforcesthepow er
stagefurther - acardofstruggle .
LESSON58
7OFWANDS
"LordofValour"
20to30degreesLeo
C
in
ofthe6ofWandsto
Victoryonits . ow nhas
supportanddirection,thereforetheadditionalw andbringsforth
thiselementofdirectionandsupport(stablegovernment) . Now
onecanprogress,butevenw henprogressingaftervictory,one
encountersdifficultiesandobstacles
. Anelementalsomustbe
introducedthatw illprovidetheforcenecessary overcome
obstaclesnomatterw hatandthisisshow ninthecardbythe
numberofhandsbeingthree - atypeofperfection, perfect
numberofdirectionforthepow erfulforce .
The7ofWandshasbeencalled"Lord Valour Valour
meansonecanencounterdangerw ithfirmness
. Whatnecessitates
firmnessisthecentralw andw hichgivessupporttobraveryand
L58/pg
ofa
no
the victorypreviouslyattained .
Yellow .
L58/pg 2
The initial impetus is thus
carried through making changesandadjustments,sothatallw orks
w ithandnotagainstthenew energies.
Withdiscretionandtheuseoffrugalityinjudgment, each
andeveryonearegiventheirroleinthefurtheranceofgrow th,
eveniffirstthereisdestructionandseparation . Eachbeing,
functioningindividually forthegreaterw holegivesanoverall
pow erfulforce . TheEmeraldTabletsaysthis : 'Separatethe
~earthfromthefireandthesubtlefromthegross,softlyand
w ithgreatprudence . '
The7ofWandsispaintedinthecoloursoftheKingScale .
backdropiscolouredinthecolourofthesign- Poison
Thew andsarethecolouroftheplanet - Scarlet .

The
flamesarecolouredRichViolet . Thecloudsandhandsare
BrilliantWhiteshow ingspiritmanifestingfromKetherthrough
thefireelement .
Fromthesecoloursw eseeapictureofenergy,notoneof
rushedenergyasinthe2ofWands,orofexpansiveenergyas
w iththe6 of Wands,butone of w armth,graduallyfilteringout
andbecomingallencompassing . Together,thesecoloursalludeto
aninitiative,stayingpow er,andthepow er of recyclingusing
everybitofpotentialavailable .
thusabletoovercomew eakness .

nthisthereisthepow er
healandrevitalizethedepleted,butitsactionisslow and
steady .
Theenergiesareregenerating
1
t
1
1
t
nature is strongly competitive and is verymasculine in
expression making the male very attractive tothefemaleasthe
male's vitalityisstronglysensed. Italsohasdomination
tendenciesandthecreationofabeliefofself-infallibility .
MarsinLeoisstrongandgeneratessuccess,honourand
authority. Thereisrashnessinmattersofloveandoneisnot
soluckyw ithchildren . Itsnature is alsogenerousandsincere,
affectionate,enthusiasticandsociable ;capableofafasttemper
andmilitant . Positionsofresponsibilityandauthorityaremore
thanlikely . DiseaseandaccidentsarecommontoMarsinLeoif
itisafflicted .
Whereverthiscardoccupiesthereisstruggleofoneformor
another .
NetzachofYod(oppositionyetcourage .
DIVINATION
ONMATTERSOFthePhysicalBody ;Selfhood ;SelfProjection ;new
ideas ;new beginnings ;reactionstooutsidestimuli ;thelife
force;firstencounters :
Whenreceivingthe7ofWandsinthispositionthequerent
L58/pg3
The planet and sign represented by the 7 of Wands is Mars in
Leo w hich gives w illpow er and energy, stability, significance and
determination .

It inspiresconfidence and initiative .

The
outw ard
L58/pg
is advised to self-promotehimselfandadvertisehis
Whenconcerningothersyouhavethe
achievementeveniftheylackenthusiasm .
ingallonesprevioushardw ork .
inthispositioni"Pushing" .
pow er
ItisthroughtheWill
thatyouw illbringforcefulnessandareleaseofpow erinyour
expression . Thereisdangerofapersonalapproachbecoming
narrow andonebeingovercomebyemotionalintensity . Thelife
forcemustbeheldstableandchannelledifyouw antgrow thand
development ;onecanpushtoohardandtoofast,therebydestroy-
Thekeyw ordforthe7ofWands
ONMATTERSOFpossessionsandpersonalattitudetow ardssuch ;
personalestateandresourcesbothphysicalandmaterial ;
principlesandfeelings ;managementandprojection ;commerce,
personal,commercial, governmental andnationalfinancialaffairs
directlyrelatingtotheself :
thispositionthe7ofWandsdepictsthatthereisor
w illbe a strainonthefinancesw iththenecessitytospendmore
tokeepallundercontrol . Thisalsoincludesastrainonones
personalresourcesw hicharefrequentlycalledontokeepevery-
thinginorder .

Thequerentmustlearnthatgivingtoomuch
theselfatanyonetimecreatesadepletionofenergy,Willand
anydesiretocontinue . Keepastrongcontroloverhow muchyou
give oftheself,financially,psychologicallyandphysically .
Donothingonimpulse- thinkbeforeyouact .

Thekeyw ordfor
the7ofWandsinthispositionis"Strained
1
1
1
L58/pg 5
ON MATTERS OF short journeys ; communications; relationships ;
brothers, sisters, neighbours ; humour ; identity ; early education ;
books ; correspondence ;enlarging ones field of activity:
Relationships w ill have to be w orked at if you w ant
maintain them. There is an element of ruthlessnessw ith the 7of
Wandsinthisposition,
and continues to persist at all costs . Measured risks may
takenw ithprobablesuccessbeingtheoutcome .

Allforms
communication_mustbemadew ithcareanddonotleaveanyavenue
openforcontradiction . Therearemanyareastochoosefromw hen
lookingatliterature,travelandpersonalrelationships .
w hichw illnotaccept'no'asanansw er
factonemayfindthatthemomentumofactivities necessitate
travelfurtherthanoriginallyintended,sobeprepared,asyou
w illhavetoactquickly . "PersistingForce".
ONMATTERSOFtheendofonestageandthecommencement
another ;thehomeandprivatelife ;buildings ;land ;parents ;
security;emotions ;significantshiftsinlifesdirections ;con-
cerningthesoul ;theoccultinitspracticalterms ;divination :
Althoughfulfillingyourfamily'sneedsisapressingissue
the7ofWandspointsoutthatyourneedsmustalsobconsi-
dered . Youmustbefirmw ithothersandsinglepurposedinall
ofyourtasksuntilalliscompleted,ofw hichnodoubtyounow
are. thispositionthe7ofWandsshow ssomeoneexpendinga
lotofenergyagainstdifficultodds . Thiscouldbeinthe
searchofanew homeandpurchaseofland,orthereverse,the
sale of land, or concerning the-hard w ork involved in moulding
ones land and home to* - suit ideals. What has been achieved w ill
now be w orked on to maintain, or improve. "Exertion" .
ON MATTERSOF love given ; creativityofselfhood ;thecreative
w ill ; children ;entertainment ;recreation ;speculation ;sports ;
thearts ;gambling ;fulfillingpotentiality :
The 7ofWandsundertheabovemattersadvisesthatonemust
takeontheattitudeofthe survival ofthefittest . Thereisno
sympathy forthosew hocannotkeepthepace,w hofallbythe
w ayside - that is their fate and in most cases, their choicein
failing,w hichthey alone mustexperience . Insportandanyform
ofcompetition, w hether it be the applying for a part in a play
orgambling,thereisanopponentthatmayhavemorepow erand
abilitythanyouhad bargained for. Thereforetherew illbea
struggle for the top in w hatever direction you go . Impulses can
lead totroubleandonecangetlostinthepassionofromance .
Desireandinstinctaretotheforeandyouarew arnedtow atch
outforrisks . "Survival" .
ONMATTERSOFsickness(generallydue w orkproblems) ;
employment : employees ;relationshipsw ithinthew orkenvironment ;
conflicts ;service;onessenseofservice;theacquiringof
skills ;psychology :
Undertheabovemattersthe7ofWandsrepresentsdifficul-
tiesthatcanbeovercomeifonetakesstockofoneselfandhas
L58/pg6
1
L58/pg 7
thecourage to meet faceto face w ith their difficulties .
ments w ill save the day for you .
maintain physicalhealthisanendlessbattle,butif"you areill
you becomedrainedofenergyandmayhaveheartorcirculation
problemsw hich,w hendullingthesensesandreflexes,leadone
intoaccidents . ,Avoiddrugsduringthisperiod . Avoidfoodthat
causesfermentation . Withinthew orkenvironmentthereareargu-
ments w hich donotaddtooneshealth . Learnthatyourskills
areyourmostvaluableassetsandactdecisivelyasthisis
really a terrifictimetotransformoneselfw hileunderduress,
throughdisciplineoftheselfandservicetoothers . "Courage" .
ONMATTERSOF marriageanddivorce ;contracts ;theotherparty;
competitors,adversaries,andknow nenemies ;partnerships ;public
relationships ;socialinteraction ;thelaw ofcompensation ;w hat
islacking;thew orkingsofkarma :
Youmayberushedorw anttorushintosomenew association
orrelationship,butitisadvisedthatpostponementofcommit-
Currentcommitmentsw ill
taxingand you mustfulfilallpresentresponsibilitiesifyoudo
notw anttoputyourfuturecommitmentsintojeopardy. Thereis
anelementofescapismfromtheselfandfromexternalinfluences
intosocialexperiences,avoidingresponsibilities . Theseare
thew orkingsofKarmainyourlifegivingyoutw ochoices- w hich
w aydoyougo - ordoyoumerelycompensate . Beingintw ocamps
atonceloosesbothopportunities . Donotconfuseresponsibility
w ithdevotionorcause. "Responsibility" .
L58/pg 8
ON MATTERS OF deathand rebirth; accidents ; effects of others ;
crime and retribution ; legacies ; w ills ; others estates and
finances ;jointresources ; moods ; sex ; spiritualism ; rejuvena-
tion ; mysticism ; transformation ; psychotherapy :
7ofWandsw arnsthatonemustactw ithcautioninall
financialbusinessaffairsastherei san elementofrisk . There
may beobstructioninreceivinginheritance -or. . . ,partnersmay
overspend . Thispositionshow soneoverindulginginpersonal
pleasuresandw astingenergyontrivialities . Theresources
necessaryareavailable,itsuptotheindividualtoutilizethem
prudently . Thequerentisw arnednottosw ayfrompressing
concernsandto see themthrough .

Ontheesoteric side the7of


Wandsshow sonew hoblocksofftheinnerpow erandthe inner
planes, onew hostridesalong avery precariouspathattempting
toconquerphysicalmatterw ithpurelyphysicalmeans .
"Precariousness" . . .
ONMATTERSOFreligion ;metaphysics ;philosophy ;higherstudyand
education ;legalsystems ;morals ;institutionsoflearning ;long
distancetravel ;exploration ;publiccommunications ;the
collectivemind :
thispositionthe7ofWandsshow sthatyourthoughts
belongtothemoment . Movementsinanydirectionareexpansive,
travellingfar .

Whathasbeenw onuptothis pointhasbeen


satisfactory in itself but has not fulfilledyourdesiresw hether
theybethepow erofmaterialw ealthorthepow erofthespirit -
1
1
I
mode of action isnormallysubconscious .
L5B/pg9
w hateverthegoal,itispow erofsomekind .

Becauseofthis,
one presses on searchingw ithineachmomentasitcomes .

This
Agreatdealcanbe
achievedw iththisaspect,butitisofnoimportance,just
Forthis,endlessfaithandcourageisneeded meanstoanend .
tocontinueagainstallodds . Fromanotherpointofview youcan
alw ays

tryingtoliveuptoothers'expectations - that in
itselfisamammothtask. "Pow erHungry" .
ONMATTERSOFpublic. honour ;status;ambitionsandgoalsreached ;
achievements ;profession ;theotherparent ;causesfordisgrace ;
recognition ;identity:
nyouattempttoattaingoalstherew illbetension as many
otherinterests w ill needtobesatisfiedatthesametime .
risetoanyformofprominenceyouw illneedagreatdeal
creativeeffort . Youmustw orkhardtosucceed,andfromyour
w orkyourfamilyw illgainanadvantageinlife . Acrisisw ill
havetobmetw hichcoincidew ithobstaclesandantagonism .
Thisw illnotbeaneasyroad . Allthatcanbesaidisto"push
on" . Ifyouareconsciouslyaw areofw hatyoumustencounterand
how itallfitsintothecosmicplanyouw illbeabletochannel
yourinnerpow er,concentratingitsolelyonthededicatedpur-
pose . "Concentration" .
ONMATTERSOFfriends ;income;socialalliances ;legislation ;
onesattitude;groupactivities ;government ;counsellors ;love
received ;

spiritualandintellectual

aspirations ;

ideals ;
To
fulfilment ; w hat you yield andhow you benefit others :
This position is one of reforming,

pioneering and
experimenting . Thereisliabletobeconflictsw ithassociates,
advisersandfriendsconcerningtheseissuesandones
ideasofhow thingsaretobeareusuallynotaccepted .
Wandsshow s an element of force in all that is done in
totheabovematters,thuscausingdisputesw iththosew how ish
tooppose . Themainemphasisistobetteroneself,thecommu-
nity,or yourcountry,andtodothatyoumustreformnotjust
functionsandenergies,butthemindandbeliefsw hetheritbeof
the self or others . The lesson to belearnt is subtlety in
applyingyourenergiesandideas . "Reform" .
ONMATTERSOFresponsibilityandcontribution others ;
humanisticconcerns ;karmicdebts ;unresolvedproblems ;hidden
resources ;theunconscious ;sorrow ;healthafflictions ;secret
enemies ;

hospitals ;

secret societies ;
identification :
L58/pg 1 0
personal
The7of
relation
selfundoing ;total
The7ofWandsshow sinthispositionthatthereareundoub-
tedlyhiddenenemies(external)butyouw illalw aysovercomeany
influencetheyhaveifyoupushonrelentlessly . But,themost
pow erfulenemyistheself - yourcomplexes,'unconscious,and
yourpast . Thesearetheeverincreasingobstaclesobstructing
freeflow ofenergyandgrow th . Thesearew hatyoumustforever
w orkoutonaninnerlevel . The7ofWandsadvisesthatnow isa
goodtimeforspiritualinvestigationintoyourow ninnerlayers
1
I
I
I
I
(encountering yourself) ; . as-now the old skeletons are more and
more vivid and of" more- intensity . "TurnInw ards" .
7Qf- Wa-rod --- s :
n 1st position :
In 2nd position :
In 3rd position :
In 4th position :
In 5th position :
In 6th position :
In 7th position :
In 8th position :
In 9th position :
In 10th position :
n 11th position