Vous êtes sur la page 1sur 132

Rev. peru. biol.

ISSN 1561-0837
Universidad nacional Mayor de san Marcos
FacUltad de ciencias Biolgicas
volUMen 17 dicieMBre, 2010 nMero 3
LIMA, PER
revista
PerUana de
Biologa
2
Rector
Dr. Luis Izquierdo Vsquez
Vicerrectora de Investigacin
Dra. Aurora Marrou Roldn
Consejo Superior de Investigacin
Dr. Armando Yarlequ Chocas
Decano de la Facultad de Ciencias Biolgicas
Mag. Martha Valdivia Cuya
Director Instituto de Investigacin en Ciencias Biolgicas Antonio Raimondi
Mag. Jaime Descailleaux
La Revista Peruana de Biologa es una publicacin cientfca arbi-
trada, editada por el Instituto de Ciencias Biolgicas Antonio Raimondi,
Facultad de Ciencias Biolgicas de la Universidad Nacional Mayor
de San Marcos, Lima, Per, y auspiciada por el Consejo Superior de
Investigacin. La Revista aparece con una periodicidad semestral
(agosto y diciembre) y esta dedicada a la publicacin de artculos
cientfcos originales e inditos en las reas de Biodiversidad, Biotec-
nologa, Manejo ambiental, Ecologa y Biomedicina. La Revista publica
los trabajos realizados por acadmicos e investigadores nacionales y
extranjeros, en idioma espaol o ingls. Los trabajos recepcionados
son evaluados por rbitros segn criterios internacionales de calidad,
creatividad, originalidad y contribucin al conocimiento. La Revista es
publicada simultneamente en la pgina web de la Universidad.
Revista Peruana de Biologa -
Rev. peru. biol. - ISSN 1561-0837
Rev. peru. biol. - ISSN 1727-9933 (on line)
http://www.unmsm.edu.pe/revperubiol
http://www.scielo.org.pe
http://redalyc.uaemex.mx/
Copyright 2010
Facultad de Ciencias Biolgicas, UNMSM
Hecho el Depsito Legal 98-3017
Informacin adicional a:
Revista Peruana de Biologa
Facultad de Ciencias Biolgicas UNMSM
Ciudad Universitaria, Av. Venezuela Cdra. 34 s/n. Lima
Casilla Postal: 11-0058 Lima-11, Per.
Telfono 619-7000-1502 / Telefax 619-7000-1509
Editor Jefe, email: editor.revperubiol@gmail.com
revista PerUana de Biologa
rgano Ofcial de la Facultad de Ciencias Biolgicas de la
Universidad Nacional Mayor de San Marcos
Resumida/Indizada (Abstracted/Indexed) en:
Peridica (ndice de Revistas Latinoamericanas en Ciencias),
LIPECS (Literatura Peruana en Ciencias de la Salud), Zoological
Record (BIOSIS), Scielo (Scientifc Electronic Library Online),
Index to American Botanical Literature (Te New York Botanical
Garden), BIOSIS Previews, Biological Abstracts (BIOSIS), ProQuest
(Biological Science Journals), Redalyc.
Foto en cartula: Volantn de Phytotoma raimondii, Michael Tweddle
Editor jefe
Leonardo Romero
Comit Editor
Csar Arana
Carlos Paredes
Rina Ramrez
Carlos Pea
Comit consultivo en los recientes nmeros
Maximilian Weigend
Freie Universitt Berlin- Alemania
Sebastin Barrionuevo
Fundacin Miguel Lillo- Argentina
Luis Aguirre
Universidad Mayor de San Simn, Bolivia
Rodney Ramiro Cavichioli
Universidade Federal do Paran- Brasil
Hlio Ricardo da Silva
Universidade Federal Rural do Rio de Janeiro, Brazil
Carlos Frederico Duarte da Rocha
Universidade do Estado do Rio de Janeiro- Brasil
Fabrcio Rodrigues dos Santos
Universidade Federal de Minas Gerais- Brasil
Suzete Rodrigues Gomes
Instituto Butantan- Brasil
Davor Vrcibradic
Universidade do Estado do Rio de Janeiro- Brasil
Stefan Dennenmoser
University of Calgary, Canada
Roberto Melndez
Museo Nacional de Historia Natural- Chile
Pedro Alejandro Orihuela Diaz
Universidad de Santiago de Chile- Chile
Berta Calonge Camargo
Pontifcia Universidad Javeriana, Bogot, Colombia
Sergio Solari
Universidad de Antioquia- Colombia
Jos Mara Gutirrez
Universidad de Costa Rica, Costa Rica
Finn Borchsenius
Aarhus University- Denmark
Julissa Roncal
Aarhus University- Denmark
Juan Rigoberto Tejedo Huaman
Universidad Pablo de Olavide- Espaa
Arnaud Bertrand
IRD. Institut de recherche pour le dveloppement- Francia
Francis Kahn
IRD. Institut de recherche pour le dveloppement, - Francia
Jean-Christophe Pintaud
Institut de Recherche pour le Dveloppement- Francia
Mutsunori Tokeshi
Kyushu University - Japon
Francisco Alonso Sols Marn
Universidad Nacional Autnoma de Mxico- Mxico
Ross Robertson
Smithsonian Tropical Research Institute- Panam
Mnica Romo
Asociacin Peruana para la Conservacin de la Naturaleza- Per
Renato Guevara-Carrasco
Instituto del Mar del Per- Per
Csar Nquira
Instituto Nacional de Salud- Per
Reynaldo Linares-Palomino
Universidad Nacional Agraria La Molina- Per
Marcel Gutirrez-Correa
Universidad Nacional Agraria La Molina - Per
Gretty K. Villena
Universidad Nacional Agraria La Molina - Per
Gerardo Lamas
Universidad Nacional Mayor de San Marcos- Per
Pablo Ramrez
Universidad Nacional Mayor de San Marcos- Per
Diana Silva
Universidad Nacional Mayor de San Marcos- Per
Juan Tarazona
Universidad Nacional Mayor de San Marcos- Per
Armando Yarlequ
Universidad Nacional Mayor de San Marcos- Per
Manuel Tantalen
Universidad Peruana Cayetano Heredia- Per
Nigel Pitman
Duke University- USA
Sergio Solari
Texas Tech University- USA
Lucia Luna
University of Michigan- USA
Maria del Carmen Ulloa Ulloa
University of Missouri- USA
Blanca Len
University of Texas at Austin - USA
Kenneth Young
University of Texas at Austin USA
Paul Velazco
American Museum of Natural History, USA
271

(Contina...)
Revista PeRuana de Biologa
Volumen 17 Diciembre, 2010 Nmero 3
Rev. peru. biol. ISSN 1561-0837
Contenido
Editorial
273 Quiero ser citado
Leonardo Romero
Trabajos originales
277 Respuestas de los murcilagos a la fragmentacin del bosque en Pozuzo, Per
Responses of bats to forest fragmentation at Pozuzo, Peru
Jos Luis Mena
285 Caractersticas de una poblacin sobreexplotada de concha navaja, Ensis macha, en Baha Independencia, Per, durante el 2004
Overfshing population characteristics of razor clam, Ensis macha, from Independencia Bay, Peru, in 2004 year
Roberto Espinoza, Juan Tarazona y Jrgen Laudien
293 Varamientos y captura incidental de tortugas marinas en el litoral de Tumbes, Per
Stranding and incidental catch of sea turtles in the coastal Tumbes, Peru
Carlos A. Rosales, Manuel Vera y Jorge Llanos
303 Lista de cigarritas (Hemiptera: Cicadellidae) de Cusco, Per
Checklist of leafhoppers (Hemiptera: Cicadellidae) from Cusco, Peru
Juan F. Costa y Pedro W. Lozada
317 Anlisis numrico de las especies de Prosopis L. (Fabaceae) de las costas de Per y Ecuador
Numerical analysis of Prosopis L. (Fabaceae) species from the coasts of Peru and Ecuador
Alicia D. Burghardt, M. Magdalena Brizuela, M. Pa Mom, Luis Albn y Ramn A. Palacios
325 Diferenciacin morfolgica y por ISSR (Inter simple sequence repeats) de especies del gnero Plukenetia (Euphorbiaceae) de la Amazona
peruana: propuesta de una nueva especie
Diferentiation morphological and by Inter simple sequence repeats (ISSR) of species of genus Plukenetia (Euphorbiaceae) from Peruvian
Amazon: suggestion for a new species
ngel Rodrguez, Mike Corazon-Guivin, Danter Cachique, Kember Meja, Dennis Del Castillo, Jean-Franois Renno y Carmen
Garca-Dvila
331 Medicinal plants used in Peru for the treatment of respiratory disorders
Plantas medicinales utilizadas en Per para el tratamiento de enfermedades respiratorias
Rainer W. Bussmann and Ashley Glenn
347 Palmeras usadas por los indgenas Ashninkas en la Amazona Peruana
Palms used by Ashaninka indigenous people in Peruvian Amazon
Joanna Sosnowska, Damaso Ramirez y Betty Milln
353 Actividad inhibitoria de plantas in vitro de Drosera capillaris sobre Mycobacterium tuberculosis
Inhibitory activity of in vitro plants from Drosera capillaris against Mycobacterium tuberculosis
Jimmy Alvarado, Hilda Vsquez, Guillermo E. Delgado, Dalva Trevisan, Oscar Horna, Jurandir Pereira y Consuelo Rojas
359 Prevalencia y distribucin de los principales agentes etiolgicos que afectan los langostinos silvestres en Tumbes, Per
Prevalence and distribution of the principal etiologic agents that afecting wild shrimps from Tumbes, Peru
Rubn Alfaro Aguilera, Mervin Guevara Torres, Isaas Gonzales Chvez
365 Identifcacin molecular y actividad sobre sustratos cromognicos de la venombina A del veneno de la serpiente peruana Bothrops atrox
Molecular identifcation and activity upon chromogenic substrates of a venombin A from Bothrops atrox Peruvian snake venom
Gustavo A. Sandoval, Fanny Lazo, Edith Rodriguez, Armando Yarlequ y Russolina B. Zingali
Notas cientfcas
371 Toxicidad aguda y crnica del lindano sobre Ceriodaphnia cornuta (Cladocera: Daphniidae)
Acute and chronic toxicity of lindane on Ceriodaphnia cornuta (Cladocera: Daphniidae)
Jorgelina Jurez y Alcira Villagra de Gamundi
272
377 Nuevas evidencias de la presencia del Oso Andino (Tremarctos ornatus) en las Yungas de Puno, el registro ms austral de Per
Presence of the Andean Bears (Tremarctos ornatus) new evidences in the Yungas of Puno, Perus southernmost record
Gisella Mrquez y Vctor Pacheco
381 Efects of aqueous extract of Origanum vulgare L. (Lamiaceae) on the preimplantational mouse embryos
Efecto del extracto acuoso de Origanum vulgare L. (Lamiaceae) en embriones preimplantacionales de ratn
Vctor Benavides, Guadalupe DArrigo and Jos Pino
385 Efecto antitumoral del extracto acuoso de Bomarea cornigera (Alstroemeriaceae) en sarcomas inducidos en ratones
Antitumoral efect of the aqueous extracts of Bomarea cornigera (Alstroemeriaceae) on the sarcoma induced in mice
Jos Surez, Christian Villanueva, Claudia Rodrguez, Karito Lavado, Melissa Barbieri, Luis Guzmn, Ricardo Alfaro y Jos Pino
389 Efecto citoprotector del camu-camu Myrciaria dubia en tres lneas celulares de ratn expuestos in vivo a bromato de potasio
Citoprotective efect of camu-camu Myrciaria dubia on three celular lines of mouse exposed in vivo to potassium bromate
Alvis Rafael, Pino Jos, Gonzles Jos, Francia Juan C., y Betty Shiga
Fe de errata
393 La familia Conidae en el mar peruano
Te family Conidae from Peruvian Sea
Carlos Paredes, Franz Cardoso, Katherine Altamirano, Paul Baltazar y Leonardo Romero
394 A fortuitous ant-fern association in the Amazon lowlands of Peru
Una asociacin fortuita planta-hormiga en la Amazona baja del Per
Blanca Len and Kenneth R. Young
273

Editorial
Rev. peru. biol. 17(3): 273 - 276 (December 2010)
Rev. peru. biol. 17(3): 273 - 276 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Quiero ser citado
EDITORIAL
Leonardo Romero
Editor Jefe, Instituto de Investigacin de Ciencias Biolgicas Antonio Raimondi, Facultad de Ciencias Biolgicas, Universidad Nacional Mayor de San Marcos. Apartado 11-0058,
Lima 11, Per. Email: lromeroc@unmsm.edu.pe
Publicado impreso: 29/01/2011
Publicado online: 20/01/2011
Despus de varios aos de ser editor, muchos de mis jefes
confunden la revista con el editor, y es comn or cosas como
conferencia a cargo de la revista o en conversaciones se dirijan
a m para decir y porque no te citan, refrindose al motivo
porqu la Rev peru biol. no es citada por otros trabajos. Apro-
vechando ese desquicio, en los siguientes prrafos encarnare a
la revista y al editor, en la fusin mgica en la que algunos de
mis jefes me imaginan.
Alguien me cita?
Desde hace varios aos intentamos interpretar nuestra si-
tuacin como revista, plantear objetivos y ser ms efcientes.
Escribimos sobre la calidad de los contenidos
1
; inventamos
conceptos como el anfmercado para explicar el porqu de las
exigencias
2
, argumentamos la relacin de una revista cientfca
con la ciencia y la sociedad
3
; resaltamos la importancia de la
biodiversidad como tema
4
; analizamos la maraa de conceptos
politicolgicos de CTyI, desarrollo sustentable y ciencia, todos
confundidos en una torre de babel de oscuras lenguas movidas
por la ignorancia y conveniencia
5
. Tambin tratamos de recurrir a
la comunidad cientfca como un soporte para nuestro desarrollo
o cmo pensamos sobrevivir
6
y refexionamos sobre la realidad
del Per
7
. Personas imaginarias nos preguntaron con las miradas
y entre las lneas del email que nos enviaban, y respondimos
tratando de interpretar buscando alguna solucin
8
. Por ltimo,
hemos querido sentirnos bien y nos dimos aliento comparando
lo que ramos con lo que somos
9
. Todos estos escritos fueron
momentos, con las intenciones de sentirnos conscientes, expli-
cando lo que vemos y tomando decisiones para tratar de mejorar,
pero todas esas conversaciones nos deslumbraron cuando fueron
correctas o tenan visos de serlo, y a la vez fueron el velo de algo
que no percibimos al inicio, o lo percibimos pero no tomamos
conciencia que estaba ah.
Quin lee nuestras pginas, cuntos la leen, cuntos usan el
contenido de la revista? Son esas las preguntas que no nos hicimos
y que quedaban veladas por el hecho de haber avanzado algo en
nuestro crecimiento. Pero llegar a respuestas objetivas puede ser
muy difcil, porque la informacin no es tan fcil de acceder, o
simplemente porque no existe.
En un trabajo, la cita es la forma como el autor refrenda su
afrmacin en otro u otros trabajos a los que el lector puede
acudir para investigar o comprobar lo tratado en el artculo.
Pero, para que ocurra esta citacin, varias cosas deben haber
sucedi. La revista debe estar accesible, en la biblioteca o por
INTERNET, debe ser fcil de ubicar, algo as como escribir y
presionar un botn. Para llegar a ese momento, muchos procesos,
y cosas han pasado; mucho esfuerzo, tiempo y dinero han sido
invertidos, casi siempre todo pasa desapercibido.
Explorando la base de datos Scopus
10
, podemos buscar los
artculos que han citado algn trabajo publicado en la Rev peru
biol. y tratar de describir lo que ha sucedido en los ltimos aos.
Aunque la Rev peru biol. sali a la luz en 1974, recin a partir
de 1998 comienza una vida continua, y despus del ao 2005
comienza un incremento continuo de citas hasta el ao 2010.
Entre los aos 1996 y 2010, en Scopus se registran 273 artculos
que citan entre 1 y 4 veces la Rev peru biol. periodo en el que se
Nmero de citas de trabajos publicados en la Rev peru biol por ao en revistas indizadas en la base de datos Scopus. Despus del ao
1998 la Rev peru biol, adquiere continuidad, incrementa constantemente el nmero de artculos, la variedad de autores, las instituciones que
participan, los artculos en ingles, su distribucin y visibilidad.
0
10
20
30
40
50
60
70
80
1995 2000 2005 2010
N

m
e
r
o

d
e

c
i
t
a
s
Nmero de citas por ao en Scopus (n= 273)
274
Editorial
Rev. peru. biol. 17(3): 273 - 276 (Diciembre 2010)
0
2
4
6
8
10
12
14
16
1998 2000 2002 2004 2006 2008 2010
N

m
e
r
o

d
e

c
i
t
a
s
Ao de publicacin de artculos de la Rev peru biol.
citados en los aos 2009 y 2010 en Scopus
2009
2010
tenan publicados casi 550 artculos. Entre el ao 2009 y 2010
encontramos 130 citas, el 47,6% de las citas de todo el periodo
1996 2010; estas 130 citas son de 91 artculos de la Rev peru
biol., lo que representan aproximadamente el 16% de todos los
trabajos publicados desde 1998.
Quin me quiere citar?
Si analizamos las citas de los aos 2009 al 2010, vemos que
hay aos en que los artculos publicados tienden a ser ms ci-
tados, fenmeno que recuerda a un perfl andino. Los artculos
publicados el 2003, 2005 y 2007 son ms citados, lo que puede
ocurrir por lo amplio de la temtica de la Rev peru biol. y la falta
de mecanismos de difusin para ciertos temas.
Scopus clasifca a sus revistas en reas y podemos tener infor-
macin sobre cmo las citas de la Rev peru biol. se distribuyen
en ellas. Debemos tener presente que una revista puede ser
clasifcada en una o ms categoras por lo que las citas pueden
duplicarse, por lo que usar el porcentaje de citas seria una opcin
adecuada. Agricultural and Biological Sciences, Environmental
Science y Earth and Planetary Sciences acumulan el 68% de las
citas, estas reas corresponderan principalmente a las nuestras
de biodiversidad y ecologa, mientras que las de Immunology
and Microbiology , Biochemistry, Genetics and Molecular Biology,
Medicine, Social Sciences, Pharmacology, Toxicology and Phar-
maceutics, Veterinary y Otras corresponderan principalmente
a nuestras reas de biotecnologa y biomdicas. Dos temas son
necesarios discernir, uno es el de entobiologa principalmente
botnica cuyos artculos son citados en temas sociales, de medi-
cina y farmacia, y otro es el de taxonoma de parsitos, citados
en temas de medicina y veterinaria.
Hemos podido registrar 89 ttulos de revistas que nos citan
entre el ao 2009 y 2010. Entre 5 y tres citas en orden decre-
ciente estn Zootaxa, Journal of Ethnopharmacology, American
Museum Novitates, Revista de Biologa Marina y Oceanografa,
Zoologica Scripta, Applied Microbiology and Biotechnology, Bio-
resource Technology, Neotropical Entomology, estas acumulan el
39% de las citas del periodo 2009 2010. Un aspecto que parece
resaltar en esta variedad de ttulos es el tipo de informacin que
proporciona la Rev peru biol.; descripciones de nuevas especies,
reportes de especies, listas de especies, especies endmicas, son
la informacin ms citada y til que otros investigadores parece
que pueden encontrar en la Rev peru biol.
Qu hacer para que me citen
La nica forma para que nos citen es que conozcan lo bueno
que es nuestro trabajo y nos lean. Para eso, nosotros nos podemos
citar y publicar (auto-cita, por ejemplo yo me cite 9 veces en este
editorial, lstima que no ser indizado); que es algo saludable si
se realiza correctamente. Otra forma es trabajar en equipo con
otros investigadores y que ellos nos citen, lo cual es importante,
recomendable y lo ms frecuente. Por ltimo, como investigador
podemos enviar nuestro trabajo a alguna de las revistas de alto
factor de impacto (muy citada) con la esperanza que de todas
maneras nos citen por el prestigio de la revista; como revista
tenemos que indexarnos en bases de datos y buscadores, distri-
buirnos en diferentes medios de comunicacin, tradicionales
(impresos, online), sofsticados (ebook) y de vanguardia (twiter,
facebook, blog, y los que vendrn), y lograr adquirir visibilidad
e importancia en la comunidad cientfca.
Con un poco mas de trabajo podemos revisar a los autores
de los 273 artculos que citan a la Rev peru biol. en el periodo
1996 2010, en busca de posibles autores que se auto-citen.
Incluimos a cualquier autor que haya publicado en la Rev peru
biol., o miembro de Comit consultivo o Editor. Encontramos
que solamente 56 de los 273 (20,5%) aparecen como autor del
artculo donde ocurre la cita; casi todos en realidad estn en el
periodo entre 2007 y 2010. Esto quiere decir que la alternativa
de que las citas dependen de la labor de visibilidad de la revista
estara jugando un importante papel en la cantidad de citas.
Entonces Qu hacer para que me citen? Adems de esforzarnos
ms para tener mejor informacin que publicar, tenemos pre-
pararnos para las nuevas necesidades, que como investigadores
a su vez son nuestras exigencias. Tener informacin arrastrando
nuestro dedo sobre un touch pad cuando estamos en el campo,
o que aparezca en Google Earth cuando lo consultamos a travs
de nuestro iphone, leerlo en un ebook cuando vamos al trabajo,
subirlo a una red social, a un banco de datos o asegurarnos de
Anlisis de las citas que recibe la Rev peru biol en los aos 2009 y 2010 en las revistas indizadas en la base de datos Scopus. Ambos aos
coinciden en que los artculos del ao 2005 son ms citados. En el ao 2010 artculos anteriores a 1998 son citados hasta 11 veces.
275

Editorial
Rev. peru. biol. 17(3): 273 - 276 (December 2010)
0 20 40 60
Agricultural and Biological Sciences
Environmental Science
Earth and Planetary Sciences
Immunology and Microbiology
Biochemistry, Genetics and Molecular Biology
Medicine
Social Sciences
Pharmacology, Toxicology and Pharmaceutics
Veterinary
Otras
Porcentaje de citas por reas segn clasificacin de Scopus desde 1998 al 2011
ser los primeros en algo y decirlo cuanto antes; para toda esas
vertiginosas necesidades los autores y las revistas tenemos que
aportar, en nuestro caso trabajar ms desde los cimientos de
nuestra investigacin.
Si lo hago me citaran?
Run for your lives! End of the World! Electronic publication
of new plant names es el ttulo con el que Sandra Knapp et al.
11

nos presenta varios problemas con las publicaciones referidas a
taxonoma, nuevos registros y distribucin. Afecta a las conocidas
como check list, publicaciones que hace una dcada las revistas
prestigiosa no aceptaban, o no daban cabida, mientras que esa
informacin era, y es cada vez mas requerida por la sociedad.
En la actualidad algunas revistas ya han afrontado el reto de
publicar esa informacin que fue despreciada por no constituir
investigaciones o un seminal paper. Notable ejemplo son las re-
vistas Check List (http://www.checklist.org.br/index), ZooKeys
(http://pensoftonline.net/zookeys/index.php/journal/index),
PhytoKeys (http://www.pensoft.net/journals/phytokeys/). Todas
ellas dedicadas a la misin de poner en orden la informacin
taxonmica, hacerla accesible y disponible tan rpidamente
como sea posible o soable (en el universo de posible lo im-
posible tiene su lugar). Todos esos objetivos con la fnalidad de
coadyuvar a la toma de decisiones para la conservacin de la
biodiversidad. Mientras, otras revistas se han ido adecuando de
una u otra manera.
Tambin es exigencia en las normas de las revistas
12
toda la
informacin que pudiera a ayudar a discutir y refrendar el trabajo
expuesto en el artculo, as las revistas alojan bases de datos para-
lelas y archivos extras al artculo, y se exigen que las imgenes,
material biolgico y la informacin deban ser depositados en
repositorios pblicos (como museos, en el caso de colectas o bases
de datos como el GeneBank) e indicar los cdigos o vouchers
respectivos; algo que nosotros denominamos hace algn tiempo
denominamos trazabilidad
13
. La informacin que se presenta
debe tener un orden y est dado entre otros por los esquemas
XML (en su mayora) que permiten el aprovechamiento de la in-
formacin organizndola en forma de metadatos o simplemente
en protocolos de transferencia de la informacin. Un esfuerzo
bastante aceptado es el Darwin Core (DwC, http://rs.tdwg.
org/dwc/index.htm) que permite la asociacin de informacin
geogrfca y biolgica que puede ser fcilmente procesado.
Sandra Knapp et al. tambin sealan los tiempos de publi-
cacin como factores importantes para tomar en cuenta en la
eleccin de revistas que se adecuen a la necesidad de publica-
ciones de taxonoma y sistemtica. De inicio, las que presentan
publicacin impresa en papel ya tienen demora, sin embargo
la preocupacin de Sandra Knapp et al. es ms porque aun hay
reticencia en los miembros de la comunidad para aceptar las
publicaciones online de especies nuevas. Una solucin propuesta
sera un registro de especies nuevas; algo que no es novedoso
en botnica (International Plant Names Index (IPNI), http://
www.ipni.org/) y que se est llevando a la prctica en zoologa
(ZooBank, http://zoobank.org/). Los cdigos que relacionen
toda la informacin sobre los nombres de las especies, los cre-
adores, los documentos de creacin e informacin adicional
son la expresin de complejos sistemas en las que debe existir
consenso en la comunidad de investigadores para que sea exi-
toso; es ms creemos que solo hay una alternativa, el xito. El
consenso de la comunidad ser desde los niveles de colecta, para
que los protocolos de informacin sean completos y el producto
(la informacin) tenga la calidad necesaria; podramos decir que
con informacin colectada con esa rigurosidad estaremos ms
cerca de ser citados.
276
Editorial
Rev. peru. biol. 17(3): 273 - 276 (Diciembre 2010)
Por otro lado, una buena noticia a fnes del ao 2010 fue la
inclusin de la Rev peru biol. en la Red de Revistas Cientfcas
de Amrica Latina y el Caribe, Espaa y Portugal, Sistema de
Informacin Cientfca Redalyc o simplemente Redalyc
14
; un
sistema impulsado por la Universidad Autnoma de Estado
de Mxico. Este sistema va ms all de un simple repositorio;
integra tecnologa que permite dar mayor visibilidad a las revistas
que integran su acervo. Muchas revistas que se han integrado
a Redalyc han incrementado el nmero de citaciones gracias a
la capacidad de Redalyc de conectarse con redes acadmicas.
Con el tiempo Redalyc incluir toda la produccin de la Rev
peru biol. convirtindose en un referente de la versin online,
por lo que estamos incluyendo el protal de Redalyc como un
URL para la divulgacin de nuestros artculos. Adems, este
sistema se retroalimenta con la informacin que proporciona
y presenta un anlisis de citas, de lecturas, bibliomtricas y de
relaciones (de colaboracin) entre autores, servicios que permiten
el anlisis de la actividad cientfca y editorial, lo cual redunda
en el mejor funcionamiento y calidad de las revistas. Redalyc se
suma a otras bases de datos como Peridica, LIPECS, Zoological
Record, Scielo, BIOSIS Previews y Biological Abstracts donde
la Rev peru biol. esta indizada y que le permiten dar visibilidad
a sus artculos, acercndonos tambin a la deseada meta de ser
ms citados.

1 RomeroL.2003.LacalidadyelroldelasRevistasCientfcas.
Rev peru biol. 10(1): 3 - 4
2 RomeroL.2005.Pinitosdeunapublicacincientfcaenun
escenario de mercados. Rev peru biol. 12(1): 3-4
3 Romero L. 2005. Divulgacin cientfca y la biodiversidad.
Rev peru biol. 12(2): 182
4 Romero L. 2005. El difcil mercado de una necesaria publica-
cincientfca.Revperubiol.12(3):339-340
5 Kahn F. 2007. Ciencias empricas, tica y desarrollo sostenible.
Rev peru biol. 13(3): 151- 154
6 RomeroL.2008.Lascomunidadesysusrevistascientfcas.
Rev peru biol. 15(supl. 1): 003- 004
7 RomeroL.2009.UnpocodelarealidaddelPer.Revperu
biol. 15(2): 006
8 Romero L. 2009. Respondiendo preguntas. Rev peru biol.
16(1): 003- 004
9 RomeroL.2009.Los35aosdelaRevistaPeruanadeBiologa.
Rev. peru. biol. 16(2): 145 - 146
10 http://www.scopus.com/home.url
11 Sandra Knapp et al. 2010. Run for your lives! End of the
World! Electronic publication
ofnewplantnames.TAXON59(4):10091010
12 Revisar los requerimientos de PLoSOne (http://www.plosone.
org/static/guidelines.action#requirements)
13 Romero L. 2007. Trazabilidad una caracterstica para un artculo
cientfco.Rev.peru.biol.14(1):003-004
14 http://redalyc.uaemex.mx/
277

Murcilagos y la fragmentacin del bosque en Pozuzo
Rev. peru. biol. 17(3): 277 - 284 (December 2010)
Rev. peru. biol. 17(3): 277 - 284 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Respuestas de los murcilagos a la fragmentacin del bosque en
Pozuzo, Per
Jos Luis Mena
Responses of bats to forest fragmentation at Pozuzo, Peru
Museo de Historia Natural, Facultad
de Ciencias Biolgicas, Universidad
Ricardo Palma, Av. Benavides
5440, Santiago de Surco, Lima 33,
Per. Lima, Per.
Email: menaa.jl@gmail.com
Presentado: 08/06/2010
Aceptado: 30/11/2010
Publicado online: 00/11/2010
Resumen
La deforestacin y la fragmentacin de los bosques son unas de las amenazas ms importantes para la super-
vivencia de los murcilagos en el Per. Sin embargo, se conoce muy poco sobre el impacto de estas en sitios
o lugares por encima de los 500 m de altitud. En este estudio, considerando la escala de paisaje, analic las
respuestas de los murcilagos (Chiroptera) a la fragmentacin en un paisaje perturbado en Pozuzo (Regin
Pasco). En ese sentido, considerando el rol de los murcilagos como indicadores de perturbacin del hbitat,
plante dos hiptesis. Una primera prediccin se refri a que muestras de paisajes altamente fragmentados
y con mayor cantidad de bordes presentarn una mayor abundancia de especies frugvoras que prosperan
en hbitats perturbados (Stenodermatinae y Carollinae). La segunda prediccin se refera a que muestras de
paisaje con una mayor cobertura de bosque deberan tener una mayor abundancia de murcilagos del gremio
animalvoro (Phyllostominae), ya que estos son sensibles a las perturbaciones y suelen ser ms abundantes
en bosques maduros y en buen estado de conservacin. Encontr evidencia apoyando la prediccin sobre
el gremio animalvoro pero apoyo parcial para la prediccin sobre los frugvoros. Se resalta la importancia
de la conservacin de los fragmentos de bosque para asegurar la supervivencia de los murcilagos y de los
servicios que estos prestan, en especial para la regeneracin del bosque en paisajes tropicales modifcados
por las actividades humanas.
Palabras claves: murcilagos; fragmentacin; bosques tropicales; bosque siempreverde subandino del suro-
este de la Amazona; paisajes modifcados por el hombre; conservacin; Pozuzo; Per.
Abstract
Forest fragmentation and deforestation are among the major threats to Peruvian bats conservation. Unfortu-
nately, information about the effects of these threats above 500 m elevation is lacking. In this study, I assessed
bat responses to fragmentation in Pozuzo (Pasco) at a landscape scale approach. I evaluate two hypotheses
regarding the role of bats as indicators of habitat disturbance. The frst prediction says that landscapes highly
disturbed will show higher abundances of habitat generalist species such as frugivorous bats belonging to the
subfamilies Stenodermatinae and Carollinae. The second prediction regards that landscapes with greater forest
cover will show higher abundance of habitat specialist species such as animalivorous bat species belonging
to the subfamily Phyllostominae, a guild sensitive to forest disturbance. I found evidence supporting the ani-
malivorous hypothesis but it was partial to the frugivorous hypothesis. This study highlights the importance of
forest fragments to bat conservation in human-modifed landscapes.
Keywords: bats; fragmentation; tropical forests; Southwestern Amazon subandean evergreen forest; human-
modifed landscapes; conservation; Pozuzo; Peru.
Introduccin
A nivel mundial los bosques tropicales estn desapareciendo
rpidamente debido a la deforestacin y al cambio de uso de la
tierra, causando as una tendencia general de reemplazo de los
bosques por tierras agrcolas y pastizales para ganado y acoplados
con una progresiva prdida de hbitat y fragmentacin (Noss
et al. 2006). En cuanto a la fragmentacin, su impacto sobre la
biodiversidad debe ser analizado a partir del entendimiento de esta
perturbacin como un proceso, el cual implica cuatro efectos: la
reduccin en la cantidad del hbitat, el incremento en el nmero
de parches de hbitat, la disminucin en el tamao de los parches
y el incremento en el aislamiento de los parches (Fahrig 2003).
La deforestacin y la fragmentacin producen modifcaciones
en la disponibilidad y confguracin del hbitat, a los cuales las
especies pueden o no ajustarse. Por ejemplo, una parte impor-
tante de la diversidad de aves terrestres nativas presentes en los
bosques tropicales suelen utilizar los campos agrcolas que han
surgido luego de la deforestacin (Perfecto et al. 2003). Similares
resultados han sido encontrados para artrpodos (Perfecto, et
al. 2003, Schonberg et al. 2004), algunos grupos de mamferos
terrestres (Daily et al. 2003, Mena & Medelln 2010, Naughton-
Treves et al. 2003) y en murcilagos (Castro-Luna et al. 2007,
Medelln et al. 2000).
En general, el impacto de la fragmentacin incluye cambios
en la diversidad y la abundancia, la dinmica del bosque, la es-
tructura trfca y otros procesos ecolgicos y debe ser analizado
en la escala de paisaje (Fahrig 2003, Laurance & Bierregaard
1997). As, mientras que en la escala de parche se incluyen pa-
rmetros como el rea, la diversidad de plantas y la estructura
de la vegetacin; en la escala de paisaje son importantes otros
factores tales como el aislamiento y la proximidad entre los
tipos de hbitat. Por ejemplo, estudios realizados en la escala
de paisaje, revelan la importancia de la cobertura de bosque,
el tamao de los parches y la confguracin del paisaje en la
diversidad de aves (Graham & Blake 2001). Adems, se tienen
evidencias de la importancia del uso de diferentes escalas para
entender mejor la respuesta de los murcilagos a la fragmentacin
(Pinto & Keitt 2008).
Debido a su abundancia local, riqueza de especies y diversidad
ecolgica, los murcilagos han sido reconocidos como un grupo
indicador de la perturbacin antropognica (Fenton et al. 1992,
Medelln et al. 2000, Wilson et al. 1996). De hecho, algunos
estudios revelan que en los fragmentos de bosque tropical, la
diversidad y abundancia de murcilagos es infuenciada por la
distancia entre los parches, las estrategias de forrajeo y el tamao
del espacio vital (Cosson et al. 1999, Estrada et al. 1993). Sin em-
278
Mena
Rev. peru. biol. 17(3): 277 - 284 (Diciembre 2010)
bargo, otros estudios revelan que si bien algunas especies suelen
usar campos agrcolas y vegetacin secundaria, tambin preferen
ubicar sus sitios de descanso en el bosque maduro (Evelyn &
Stiles 2003), resaltando as el rol de los bosques remanentes en
la conservacin de estos mamferos, especialmente en los paisa-
jes rurales tropicales formados a partir de la deforestacin y el
reemplazo de bosques por reas agrcolas y ganaderas.
El Per es uno de los pases en Sudamrica que cuenta
con mayor extensin de bosques primarios pero tambin con
prdidas importantes debido a deforestacin (FAO 2010). Des-
afortunadamente, existen pocos estudios que hayan evaluado el
impacto de la deforestacin o fragmentacin sobre la diversidad
de murcilagos o la respuesta de ellos ante las perturbaciones an-
tropognicas (excepto Wilson et al. 1996); aunque recientemente
se ha analizado la respuesta de los murcilagos a la fragmentacin
del bosque tropical amaznico (Klingbeil & Willig 2009), no se
cuenta con informacin de otras reas, especialmente en altitu-
des de la vertiente oriental por encima de los 500 m de altitud.
El objetivo de este estudio es analizar como los murcilagos
responden a la fragmentacin del bosque siempreverde suban-
dino del suroeste de la Amazona, uno de los sistemas ecolgicos
ms diversos pero poco estudiados (Josse et al. 2007). Para este
propsito defn dos hiptesis de trabajo que se basaron en varios
hallazgos de la respuesta de los murcilagos a las perturbaciones
humanas. Por ejemplo, varios estudios han demostrado que por
sus requerimientos de dieta, de refugios y hbitat de forrajeo,
algunas especies de la subfamilia Stenodermatinae o Carollinae
se benefcian con cierto grado de perturbacin y son abun-
dantes en la vegetacin secundaria (Castro-Luna, et al. 2007,
Galindo-Leal 2004, Medelln, et al. 2000, Schulze et al. 2000).
Por otro lado, los murcilagos de la subfamilia Phyllostominae
(Phyllostomidae) y en especial aquellos del gremio animalvoro
(aquellos que consumen vertebrados e invertebrados, ver Stevens
1996) suelen ser muy sensibles a las perturbaciones de hbitat y
son ms abundantes en los bosques maduros (Castro-Luna et al.
2007, Wilson et al. 1996). En este sentido, en la escala de paisaje
se puede esperar que muestras de paisajes altamente fragmenta-
dos y con un gran efecto de borde deban presentar una mayor
abundancia de especies frugvoras oportunistas (principalmente
de los gneros Sturnira o Carollia) (Hiptesis 1). Igualmente,
se puede predecir una relacin positiva entre la cobertura de
bosque y la abundancia de murcilagos animalvoros; de este
modo, muestras de paisaje con una mayor cobertura de bosque
deberan tener una mayor abundancia de estos murcilagos (Hi-
ptesis 2). Complementariamente inclu anlisis similares con los
otros gremios presentes en la comunidad y con las abundancias
de las especies en forma individual, adems de una descripcin
general de la comunidad de murcilagos de Pozuzo.
Materiales y mtodos
rea de estudio
El estudio se realiz en el valle de Pozuzo (Provincia de
Oxapampa, Regin Pasco) (Fig. 1), el cual est caracterizado
por la presencia de zonas antrpicas y remanentes de bosque
siempreverde subandino del suroeste de la Amazona. Oxapampa
es ampliamente reconocida por su biodiversidad y cuenta con dos
reas protegidas muy importantes: el Parque Nacional Yanachaga
Chemilln y la Reserva Comunal Yanesha. La precipitacin
anual promedio de Pozuzo es aproximadamente de 2300 mm,
con una estacin lluviosa entre los meses de noviembre y abril,
y una estacin seca entre los meses de mayo y octubre. La tem-
peratura es ms o menos uniforme a lo largo del ao, con un
promedio anual de 22,6 C. En Pozuzo, predomina un paisaje
caracterizado principalmente por actividades humanas, en el
cual los bosques remanentes ocurren en fragmentos pequeos
o parches (< 50 ha) a lo largo de las zonas de pendientes y en
fragmentos grandes (> 100 ha) localizados principalmente en
las zonas ms alejadas de los centros poblados, ambos inmersos
en una matriz de pastizales para ganado y tierras agrcolas (Fig.
Figura 1. Clasifcacin de la cobertura vegetal del rea de estudio, basado en un imagen de satlite LandSat TM (Septiembre 1997), en donde
se puede apreciar los bosques remanentes, pastizales de ganado y el arreglo de las muestras de paisaje: Yanahuanca (1), Sereno-Toropampa
(2), Ro Negro (3), Palmira (4) y Delfn (5).
279

Murcilagos y la fragmentacin del bosque en Pozuzo
Rev. peru. biol. 17(3): 277 - 284 (December 2010)
1). En general, los bosques remanentes presentan un dosel
compuesto principalmente de especies de las familias Bomba-
caceae, Burseraceae, Combretaceae, Euphorbiaceae, Fabaceae,
Meliaceae, Moraceae, Polygonaceae, Sapindaceae, Boraginaceae
y Arecaceae; un sotobosque con representantes de Melastomata-
ceae y Piperaceae; y un estrato herbceo dominado por Araceae,
Cyclanthaceae y Heliconaceae. Los pastizales para ganado estn
caracterizados por la dominancia del pasto extico Brachiaria
decumbens con algunos rboles asociados; mientras que las tierras
agrcolas incluyen cultivos como la yuca, el pltano, la papaya,
el maz, entre otros.
Estimacin de la diversidad y abundancia de murcilagos
Entre febrero y agosto de 1996 evale 5 localidades (Fig. 1):
Delfn (1200 m de altitud), Palmira (900 m), Ro Negro (900
m), Sereno-Toropampa (1000 m) y Yanahuanca (1200 m).
En cada localidad se colocaron de dos a tres redes de neblina a
nivel del suelo (3 x 12 m, ojo de malla de 30 mm), las cuales
fueron abiertas desde las 18:00 hasta las 00:00 horas. Se registr
el nmero de metros extendidos y el tiempo en horas que las
redes estuvieron abiertas durante cada noche de trabajo. Las
redes fueron ubicadas siempre sobre cursos de agua, dentro del
bosque, en los bordes del bosque y cerca de los caminos. Luego de
la captura se determin en cuanto fue posible la especie, adems
se tomaron datos morfolgicos externos, el peso corporal y su
condicin reproductiva. Una parte de los individuos capturados
fueron colectados y depositados en la coleccin de mamferos del
Museo de Historia Natural, de la Universidad Nacional Mayor
de San Marcos (MUSM). Para la determinacin de las especies
se reviso especmenes del MUSM, adems de revisiones taxo-
nmicas para la identifcacin defnitiva del material examinado
(Pacheco & Patterson 1991, Simmons & Voss 1998, Velazco
2005). La nomenclatura adoptada en este trabajo se basa en
Pacheco et al. (2009), la cual sigue la taxonoma de Wilson y
Reeder (2005) y Gardner (2008).
Para cuantifcar el esfuerzo de captura se obtuvo para cada
localidad el producto del total de metros de red (sumando los
de cada noche de evaluacin) por el total de horas trabajadas
(Medelln 1993), lo cual permiti obtener el total de metros de
red por hora (M x H) en cada localidad (Tabla 1). Este valor (M
x H) sirvi para estimar la abundancia relativa por especie o por
gremio, al dividir el nmero de animales capturados entre M x
H (# de murcilagos por metro de red por hora).
Se elaboraron curvas de acumulacin de especies consideran-
do el nmero de especies capturadas y el nmero total de capturas
para evaluar la calidad del inventario (Sobern & Llorente 1993).
Siguiendo las recomendaciones de Colwell y Coddington (1994)
las curvas fueron afnadas por medio de eventos aleatorios (100
veces) para cada localidad y para el total de especies capturadas
en Pozuzo. Para cuantifcar la totalidad del inventario se usaron
los estimadores no paramtricos Chao2 y Jacknife 2 en los
datos de capturas, los cuales fueron estimados con el programa
EstimateS (Colwell 2005). Finalmente, se estim la riqueza de
especies esperada en Pozuzo basado en el modelo de Clench
(Sobern & Llorente 1993). La caracterizacin de los gremios se
bas en Kalko y Handley (2001) y Sampaio et al. (2003). Bajo
estas defniciones, se identifcaron ocho gremios, los cuales se
encuentran compuestos por especies que forrajean en hbitats
equivalentes y consumiendo alimentos similares (ver Tabla 2).
Como animalvoros se agrupa a los gremios de insectvoros y
carnvoros acechadores de espacios muy densos (Stevens 1996).
Anlisis de paisaje
La medicin de las caractersticas del paisaje se bas en una
clasifcacin no supervisada de la cobertura del suelo a partir
del anlisis de una imagen LandSat TM (septiembre de 1997)
con el programa ArcGIS 9.2 (Environmental Systems Research
Institute Inc, Redlands, CA). Para motivos de ste anlisis se
identifcaron slo dos clases: bosque y no bosque (matriz). En
trminos generales, la estructura del paisaje se caracteriza por
su composicin y por su confguracin y ambos aspectos pue-
den afectar los procesos ecolgicos y a las especies (Bissonette
1997). La composicin comprende a la variedad y la abundancia
de parches dentro de un paisaje. De hecho, muchas especies
de vertebrados requieren de tipos de hbitat especfcos (p.ej.
bosques), de modo tal que la cantidad total de dicho hbitat
Localidad Metros de red Horas Noches M x H Capturas # especies Chao2 Jack 2
Delfn 168 28 7 4704 35 15 20,1 (74) 26,2 (57)
Palmira 216 24 6 5184 135 27 31,2 (87) 37,7 (72)
Ro Negro 120 20 5 2400 32 11 15,2 (73) 17,9 (61)
Sereno-Toropampa 144 24 6 3456 29 13 45,0 (29) 24,5 (53)
Yanahuanca 216 24 6 5184 25 16 25,2 (64) 30,4 (53)
TOTAL 864 120 30 20928 256 42
Tabla 1. Localidades y esfuerzo de captura en las localidades evaluadas en Pozuzo (Total de metros de red por hora: M x H). Tambin se
incluye el nmero esperado de especies segn el modelo de Chao y Jacknife (En parntesis se presenta el porcentaje respecto a lo obser-
vado en cada localidad).
Gremios Descripcin
N.o de
especies
I
Insectvoros areos de espacios
abiertos
2
II
Insectvoros areos de espacios de
fondo denso
6
IV
Insectvoros acechadores de espacios
muy densos
4
V
Carnvoros acechadores de espacios
muy densos
1
VII
Hematfagos acechadores de espacios
muy densos
1
VIII
Frugvoros acechadores de espacios
muy densos
25
IX
Nectarvoros acechadores de espacios
muy densos
5
X
Omnvoros acechadores de espacios
muy densos
2
Tabla 2. Defnicin de los gremios presentes en Pozuzo de acuerdo
a Kalko y Handley (2001) y Sampaio (2003).
280
Mena
Rev. peru. biol. 17(3): 277 - 284 (Diciembre 2010)
probablemente infuencie su ocurrencia y abundancia. Por otro
lado, la confguracin del paisaje se refere a la distribucin
fsica o al arreglo espacial de los parches. En cada localidad (5)
se seleccionaron dos muestras circulares de paisaje, una de 500
m y otra de 1000 m de radio (lo cual permiti evaluar alguna
asociacin que sea dependiente de la escala). La eleccin de estas
dos escalas se bas en lo sugerido en estudios previos (Gorresen &
Willig 2004, Klingbeil & Willig 2009). Cada muestra de paisaje
fue caracterizada con base en su composicin y confguracin,
considerando las variables descritas en Gorresen y Willig (2004)
y Klingbeil y Willig (2009). As, las variables que caracterizaron
la composicin del paisaje fueron el porcentaje de la cobertura
de bosque (COVER) y la densidad de parches (PD). Mientras
que las variables que caracterizaron la confguracin fueron la
densidad de borde (ED) y el promedio del ndice de la forma
de los parches (SHAPE). El valor de estas variables fue obtenido
a travs de un anlisis realizado con el programa Fragstat 3.3
(McGarigal et al. 2002).
Anlisis estadstico
La existencia de una relacin entre las variables que carac-
terizaron la estructura del paisaje con la riqueza de especies,
la abundancia de cada especie y la abundancia de los gremios
trfcos (N= 5) fue analizada con la prueba no paramtrica de
Spearman. Esta prueba es til con tamaos pequeos de muestra
y cuando se desconoce la distribucin de los datos; de modo
que nos permite determinar si existe una relacin monotnica
entre dos variables (Ramsey & Schafer 2002). Con esta prueba
tambin se analiz la existencia de correlacin entre las variables
que caracterizan el paisaje. Estos anlisis se realizaron en el pro-
grama R 2.10.1 (R

Development Core Team 2005).
Resultados
El muestreo comprendi un total de 864 m de red con 120
horas trabajadas durante 30 noches (Tabla 1). Se capturaron 256
individuos que correspondieron a 42 especies, 23 gneros y 4
familias (Apndice 1). La familia con ms especies fue Phyllos-
tomidae (38 especies). Entre los Phyllostomidae, la subfamilia
Stenodermatinae (21 especies) fue la ms diversa. Palmira fue la
localidad donde se registr el mayor nmero de especies y fue
la mejor muestreada segn los estimadores Chao2 y Jacknife2,
seguidos de Delfn y Ro Negro (Tabla 1). En total, en las 30
noches de trabajo se colect el 76% de las especies esperadas
para Pozuzo segn el modelo de Clench (58 especies). Adems,
la curva de acumulacin de las especies capturadas en Pozuzo,
sugiere que sta se aproxima a una asntota (Fig. 2).
El histograma de abundancia relativa (Fig. 3) revela que
existen tres especies dominantes en Pozuzo (Carollia brevicauda,
Carollia perspicillata y Platyrrhinus infuscus), las cuales represen-
tan cerca del 40% del total de capturas. En cuanto a los gremios
trfcos, los frugvoros acechadores de fondo denso fueron el
gremio ms diverso (54% del total de especies), seguidos de
los insectvoros areos de espacios de fondo denso (13%) y de
los nectarvoros (11%). Pozuzo est caracterizado por especies
tpicas de tierras bajas como Chiroderma trinitatum, Micronyc-
teris minuta y Tyroptera tricolor, as como, de especies de las
vertientes orientales de los Andes como Platyrrhinus albericoi,
P. masu, P. nigellus y Sturnira erythromos.
Se encontraron relaciones dependientes de la escala entre
la abundancia de los murcilagos y la estructura del paisaje.
Es decir, algunas variables son importantes en una escala pero
no en la otra (Tabla 3). La relacin entre la abundancia de
Carollia benkeithi y la densidad de borde es la nica que pro-
vee soporte a la hiptesis 1. Se encontr una relacin positiva
entre la cobertura de bosque con la abundancia del gremio IV
(murcilagos insectvoros acechadores de espacios altamente
densos: Micronycteris hirsuta, M. megalotis, M. minuta y Tonatia
saurophila) y los animalvoros (Gremios IV y V), lo cual provee
soporte a la hiptesis 2.
Discusin
A pesar de ser una zona altamente perturbada y adems
ubicada por encima de los 800 m de altitud, la diversidad de
murcilagos de Pozuzo es realmente destacable. En total se docu-
mentan 46 especies incluyendo registros adicionales reportados
Figura 2. Curva de acumulacin de especies basado en el nmero
de murcilagos capturados en Pozuzo.
Figura 3. Histograma de abundancias de las especies de murci-
lagos capturados en Pozuzo, basado en el nmero de individuos
por metro por hora. Para una mejor apreciacin los valores estn
multiplicados por mil.
281

Murcilagos y la fragmentacin del bosque en Pozuzo
Rev. peru. biol. 17(3): 277 - 284 (December 2010)
en Solari et al. (1999) y capturas fuera de los eventos de muestreo
(Apndice 1). Es ms, segn el modelo de Clench se podra espe-
rar hasta 12 especies ms. En efecto, la composicin de especies
es muy similar a la registrada en altitudes similares del Parque
Nacional Yanachaga Chemilln con 47 especies (Vivar 2006).
En general, los efectos de la fragmentacin sobre la diversi-
dad de murcilagos han sido documentados principalmente en
bosques de tierras bajas (Bernard & Fenton 2007, Presley et al.
2009). Sus efectos parecen ser dependientes principalmente de
los rasgos particulares a nivel de la especie y tambin de la escala
espacial, tal y como ha sido reportado en algunas especies de
murcilagos frugvoros de la familia Phyllostomidae (Pinto &
Keitt 2008). En Pozuzo, la respuesta de Carollia benkeithi a la
fragmentacin es concordante con lo esperado para las especies
de ste gnero, las cuales se alimentan principalmente de las fru-
tas de Piper (Piperaceae), prosperando en bosques perturbados y
en vegetacin secundaria (de Lima & dos Reis 2004, Giannini &
Kalko 2004). Efectivamente, algunas de las especies de murcila-
gos frugvoros responden signifcativamente a las caractersticas
de la composicin y confguracin del paisaje, incrementando
su abundancia en sitios moderadamente fragmentados, explo-
tando densidades elevadas de recursos de alimento despus de
la conversin del bosque a campos agrcolas y tambin durante
la subsecuente sucesin (Klingbeil & Willig 2009).
Varios estudios han demostrado que la mortalidad de rboles
y la formacin de claros en el dosel se incrementan cerca de los
bordes, lo cual modifca la estructura de los gremios y la compo-
sicin de plantas leosas (Laurance et al. 2006). Estos cambios
implican la prdida de hbitat de forrajeo y refugio para algunas
especies de murcilagos. Por ejemplo, el murcilago frugvoro
Artibeus glaucus, que al igual que otras especies pequeas de Ar-
tibeus, suelen usar principalmente el dosel del bosque (Peters et
al. 2006, Sampaio et al. 2003) sera una especie potencialmente
afectada, como parece ser el caso en Pozuzo. La abundancia
de A. glaucus en la escala de 1000 m, parece estar relacionada
positivamente con una mayor cobertura de bosque y en escalas
menores esta parece estar afectada negativamente por la densidad
de borde y la densidad de parches de bosque (ver Tabla 3). En
Per, esta especie ha sido principalmente capturada en bosques
primarios (Hice et al. 2004) aunque tambin en reas perturba-
das (Pacheco et al. 2007) Probablemente, el pequeo tamao de
esta especie es una limitante para volar grandes distancias entre
los fragmentos de bosque.
En reas con bajos niveles de deforestacin, los murcilagos
frugvoros suelen cruzar las reas abiertas o perturbadas en
bsqueda de alimento y refugio en los fragmentos de bosque
(Bernard & Fenton 2007, Morrison 1980). Sin embargo, con
el incremento de las reas deforestadas, la conectividad de los
parches de bosque remanentes disminuye y probablemente
pocas especies de frugvoros podran ser capaces de cruzar las
grandes reas sin cobertura de bosque (Klingbeil & Willig 2009).
Por ejemplo, algunos estudios sugieren que la fragmentacin
infuye negativamente en la abundancia de Artibeus obscurus
(Faria 2006), aunque otros estudios sugieren que esta especie
parece ser menos sensible a la fragmentacin que otras especies
de Artibeus grandes (Henry et al. 2007) o simplemente no es
afectada (Bernard & Fenton 2007). En efecto, A. obscurus fue
uno de los frugvoros ms abundantes en Pozuzo, tal y como ha
sido reportado en otros paisajes fragmentados por la accin del
hombre (Bernard & Fenton 2007, Cosson et al. 1999).
En cuanto a los murcilagos animalvoros, estos han sido
reconocidos como un grupo sensible al efecto de borde y res-
ponden negativamente a la perturbacin y a la fragmentacin
(Medelln, et al. 2000, Wilson, et al. 1996). No obstante, en
algunos casos parecen ser favorecidos por la perturbacin del
hbitat (Klingbeil & Willig 2009). En Pozuzo, los resultados
son ms consistentes con la hiptesis de sensibilidad a la frag-
mentacin y a la perturbacin del hbitat. Estos murcilagos son
sensibles a los cambios en la estructura de los bosques (Clarke
et al. 2005, Jimnez-Ortega & Mantilla-Meluk 2008), adems
estn morfolgicamente limitados a vuelos de corta distancia,
cuentan con mbitos hogareos reducidos, con sitios de forra-
jeo a menudo localizados en el interior del bosque (Bernard &
Fenton 2007, Kalko et al. 1999). Al parecer, estos murcilagos
COMPOSICION CONFIGURACION
Variable Escala COVER PD ED SHAPE
Artibeus glaucus 1000 m 0,89* -0,89* ns ns
500 m ns ns -0,89* -0,89*
Artibeus obscurus 1000 m ns ns ns 0,89*
500 m ns ns ns ns
Carollia benkeithi 1000 m ns ns 0,89* ns
500 m ns ns ns ns
Carollia brevicauda 1000 m ns ns ns ns
500 m ns ns ns 0,97**
Sturnira spp. 1000 m 1,00* ns ns ns
500 m ns ns -1,00* ns
Carollia spp. 1000 m ns ns ns ns
500 m ns -0,89* ns ns
Gremio II 1000 m ns ns ns ns
500 m ns -0,89* ns ns
Gremio IV 1000 m 1,00* ns ns ns
500 m ns ns -1,00* ns
Animalvoros 1000 m 1,00* ns ns ns
500 m ns ns -1,00* ns
* P < 0,05; **P < 0,01
Tabla 3. Relaciones entre caractersticas del paisaje con las especies y gremios de murcilagos de Pozuzo. COVER: porcentaje de la cober-
tura de bosque, PD: la densidad de parches, ED: densidad de borde y SHAPE: promedio del ndice de la forma de los parches. Los valores
de signifcancia corresponden a la prueba de Spearman.
282
Mena
Rev. peru. biol. 17(3): 277 - 284 (Diciembre 2010)
son capaces de sobrevivir en paisajes altamente fragmentados
slo si el grado de aislamiento de los remanentes de bosque es
bajo y si hay proximidad espacial a los bosques continuos ms
grandes (Meyer et al. 2008).
En los ltimos aos, la conservacin fuera de las reas pro-
tegidas ha tomado gran importancia, en la medida que se ha
reconocido que las reas naturales protegidas son por lo general
insufcientes para conservar la mayor parte de la biodiversidad.
Fuera de las reas protegidas, las especies nativas pueden con-
tinuar viviendo en hbitats que, aunque sujetos a actividades
productivas, mantienen la estructura y las funciones bsicas
de sus ecosistemas originales. Este ltimo es el caso de los
murcilagos. Por ejemplo, Artibeus obscurus y otras especies de
murcilagos frugvoros como Carollia perspicillata y Sturnira
lilium, funcionan como especies clave para el bosque tropical
por su rol en la dispersin de semillas y cualquier impacto
negativo en sus poblaciones provocaran serios problemas a la
conservacin y regeneracin del bosque en paisajes fragmentados
(Aguiar & Marinho-Filho 2007, de Lima & dos Reis 2004). En
este caso, la conservacin de poblaciones saludables de murci-
lagos en los bosques continuos y en los fragmentos de bosque
son fundamentales para asegurar que los servicios que prestan
estas especies puedan mantenerse (p.ej. dispersin de semillas
o polinizacin). Desafortunadamente, con los incrementos
de la poblacin humana en zonas rurales, la tendencia a la
ampliacin de la frontera agrcola es cada vez mayor. Por esta
razn, es importante conocer la ecologa de las especies en los
bosques fragmentados, lo cual permitir contar con informacin
valiosa para el diseo de estrategias de conservacin en este tipo
de paisajes. Este estudio contribuye con informacin original
sobre el uso de hbitat por los murcilagos en paisajes tropicales
modifcados por las actividades humanas por encima de los 500
m de altitud, la cual puede ser reevaluada posteriormente, para
conocer el impacto de la fragmentacin en la supervivencia de
estos mamferos en el mediano y en el largo plazo.
Agradecimientos
Este estudio conto con el apoyo de la ONG PROTERRA.
Agradezco de manera especial a todos los asistentes que colabo-
raron en la evaluacin de campo. Al entonces Instituto Nacional
de Recursos Naturales por la emisin de los permisos correspon-
dientes para la investigacin en Pozuzo. A Sergio Solari por su
apoyo en la determinacin de los especmenes y asesoramiento
para las evaluaciones de campo. A Juan Carlos Riveros por sus
valiosos comentarios a una versin anterior de este manuscrito.
Armando Mercado colabor con la clasifcacin de la imagen
satelital de Pozuzo. Al Departamento de Mastozoologa del
Museo de Historia Natural (MUSM) de la Universidad nacional
mayor de San Marcos por su apoyo con el equipo de campo y
por brindarme las facilidades para la revisin de los especmenes
y la base de datos de la coleccin de mamferos.
Literatura citada
Aguiar L.M.S. & J. Marinho-Filho. 2007. Bat frugivory in a remnant
of Southeastern Brazilian Atlantic forest. Acta Chiropte-
rologica9:251-260.
Bernard E. & M.B. Fenton. 2007. Bats in a fragmented landscape:
Species composition, diversity and habitat interactions in
savannas of Santarem, Central Amazonia, Brazil. Biolo-
gical Conservation 134: 332-343.
Bissonette J.A. 1997. Wildlife and landscape ecology: effects of
pattern and scale. Springer-Verlag.
Castro-Luna A.A., V.J. Sosa & G. Castillo-Campos. 2007. Quanti-
fying phyllostomid bats at different taxonomic levels as
ecological indicators in a disturbed tropical forest. Acta
Chiropterologica9:219-228.
Clarke F.M., L.V. Rostant & P.A. Racey. 2005. Life after logging:
post-logging recovery of a neotropical bat community.
JournalofAppliedEcology42:409-420.
Colwell R.K. 2005. EstimateS: statistical estimation of species rich-
ness and shared species from samples, Ver 7.5.1. Persistent
URL <purl.oclc.org/estimates>.
ColwellR.K.&J.A.Coddington.1994.Estimatingterrestrialbiodi-
versity through extrapolation. Philosophical Transactions
of the Royal Society B. Biological Sciences 345: 101-118.
CossonJ.-F.,J.-M.Pons&D.Masson.1999.Effectofforestfrag-
mentation on frugivorous and nectarivorous bats in French
Guiana. Journal of Tropical Ecology 15: 515-534.
Daily G.C., G. Ceballos, J. Pacheco, et al. 2003. Countryside
biogeography of Neotropical mammals: conservation
opportunities in agricultural landscapes of Costa Rica.
Conservation Biology 17: 1814-1826.
de Lima, I.P. & N.R. dos Reis. 2004. The availability of Piperaceae
and the search for this resource by Carollia perspicillata
(Linnaeus) (Chiroptera, Phyllostomidae, Carolliinae)
in Parque Municipal Arthur Thomas, Londrina, Paran,
Brazil. Revista Brasileira de Zoologia 21: 371.
EstradaA., R. Coates-Estrada & J.D. Merritt. 1993. Bat species
richness and abundance in tropical rain forest fragmentsand
in agricultural habitats at Los Tuxtlas, Mexico. Ecography
16:309-318.
Evelyn M.J. & D.A. Stiles. 2003. Roosting requirements of two
frugivorous bats (Sturnira lilium and Artibeus intermedius)
in fragmented Neotropical forest. Biotropica 35: 405-418.
Fahrig L. 2003. Effects of Habitat Fragmentation on Biodiversity.
Annual Review of Ecology, Evolution, and Systematics
34: 487-515.
FAO. 2010. Evaluacin de los recursos forestales mundiales 2010:
Informe principal.
Faria D. 2006. Phyllostomid bats of a fragmented landscape in the
north-eastern Atlantic forest, Brazil. Journal of Tropical
Ecology 22: 531-542.
FentonM.B.,L.Acharya,D.Audet,etal.1992.Phyllostomidbats
(Chiroptera: Phyllostomidae) as indicators of habitat dis-
ruption in the Neotropics. Biotropica 24: 440-446.
Galindo-Leal C. 2004. Clasifcacin de los murcilagos de la re-
gin de los Tuxtlas, Veracruz, respecto a su respuesta a
la fragmentacin del hbitat. Acta Zoolgica Mexicana
(n.s.)20:239-243.
Gardner A.L. (ed.). 2008. Mammals of South America, vol. 1:
marsupials, xenarthrans, shrews, and bats. University of
Chicago Press.
Giannini N.P. & E.K.V. Kalko. 2004. Trophic structure in a large
assemblage of phyllostomid bats in Panama. Oikos 105:
209-220.
Gorresen P.M. & M.R. Willig. 2004. Landscape responses of bats
to habitat fragmentation in Atlantic forest of Paraguay.
JournalofMammalogy85:688-697.
GrahamC.H.&J.G.Blake.2001.Infuenceofpatchandlanscape
level factors on bird assemblages in a fragmented tropical
landscape.EcologicalApplications11:1709-1721.
Henry M., J.-F. Cosson & J.-M. Pons. 2007. Abundance may be a
misleading indicator of fragmentation-sensitivity: the case
offg-eatingbats.BiologicalConservation139:462-467.
Hice C.L., P.M. Velazco & M.R. Willig. 2004. Bats of the Reserva Na-
cional Allpahuayo-Mishana, northeastern Peru, with notes
oncommunitystructure.ActaChiropterologica6:319-334.
283

Murcilagos y la fragmentacin del bosque en Pozuzo
Rev. peru. biol. 17(3): 277 - 284 (December 2010)
Jimnez-Ortega A.M. & H. Mantilla-Meluk. 2008. El papel de la
tala selectiva en la conservacin de bosques neotropicales
y la utilidad de los murcilagos como bioindicadores de
disturbio. Revista Institucional Universidad Tecnolgica
del Choc: Investigacin, Biodiversidad y Desarrollo 27:
100-108.
Josse C., G. Navarro, F. Encarnacin, et al. 2007. Sistemas Ecol-
gicosdelaCuencaAmaznicadePeryBolivia.Clasif-
cacin y mapeo. NatureServe.
Kalko E.K. & C.O. Handley, Jr. 2001. Neotropical bats in the cano-
py: diversity, community structure, and implications for
conservation.PlantEcology153:319-333.
Kalko E.K.V., D. Friernel, C.O. Handley, Jr. & H.U. Schnitzler.
1999.RoostingandforagingbehavioroftwoNeotropical
gleaning bats, Tonatia silvicola and Trachops cirrhosus
(Phyllostomidae). Biotropica 31: 344-353.
KlingbeilB.T.&M.R.Willig.2009.Guild-specifcresponsesofbats
tolandscapecompositionandconfgurationinfragmented
Amazonian rainforest. Journal of Applied Ecology 46:
203-213.
Laurance W.F. & R.O. Bierregaard (eds.). 1997. Tropical Forest
Remnants. Ecology, Management, and Conservation of
Fragmented Communities. The University of Chicago
Press.
Laurance W.F., H.E.M. Nascimento, S.G. Laurance, et al. 2006.
Rapid decay of tree-community composition in Amazonian
forest fragments. Proceedings of the National Academy of
Sciences103:19010.
McGarigal K., S.A. Cushman, M.C. Neel & E. Ene. 2002. FRAGS-
TATS: spatial pattern analysis program for categorical
maps [online]. Disponible en www.umass.edu/landeco/
research/fragstats/fragstats.html [acceso en septiembre
del2009].
MedellnR.A.1993.Estructuraydiversidaddeunacomunidadde
murcilagos en el tropico humedo Mexicano. - En: Mede-
lln, R. A. and Ceballos, G. (eds.), Avances en el Estudio
de los Mamferos de Mexico. Publicaciones Especiales.
Asociacin Mexicana de Mastozoologa, A. C., Mxico
D. F. Pp. 333-354.
Medelln R.A., M. Equihua & M.A. Amin. 2000. Bat diversity and
abundance as indicators of disturbance in Neotropical
rainforests. Conservation Biology 14: 1666-1675.
Mena J.L. & R.A. Medelln. 2010. Small mammal assemblages in a
disturbed tropical landscape at Pozuzo, Peru. Mammalian
Biology75:83-91.
Meyer C.F.J., J. Frnd, W.P. Lizano & E.K.V. Kalko. 2008. Eco-
logical correlates of vulnerability to fragmentation in
Neotropicalbats.JournalofAppliedEcology45:381-391.
MorrisonD.W.1980.Foragingandday-roostingdynamicsofcanopy
fruitbatsinPanama.JournalofMammalogy61:20-29.
Naughton-Treves L., J.L. Mena, A. Treves, et al. 2003. Wildlife Sur-
vival Beyond Park Boundaries: the Impact of Slash-and-
Burn Agriculture and Hunting on Mammals in Tambopata,
Peru. Conservation Biology 17: 1106-1117.
Noss R., B. Custi & M. J. Groom. 2006. Habitat fragmentation. -
En: Groom, M. J. et al. (eds.), Principles of Conservation
Biology. Sinauer Associates, Inc., Sunderland, USA. Pp.
213-251.
PachecoV.,R.Cadenillas,E.Salas,etal.2009.Diversidadyen-
demismodelosmamferosdelPer.RevistaPeruanade
Biologa 16: 5-32.
PachecoV.&B.D.Patterson.1991.Phylogeneticrelationshipsof
the New World bat genus Stunira (Chiroptera: Phyllos-
tomidae). Bulletin of the American Museum of Natural
History 206: 101-121.
Pacheco V., E. Salas, L. Cairampoma, et al. 2007. Contribucin
al conocimiento de la diversidad y conservacin de los
mamferosenlacuencadelroApurmac,Per.Revista
PeruanadeBiologa14:169-180.
Perfecto I., A. Mas, T. Dietsch & J. Vandermeer. 2003. Conservation
of biodiversity in coffee agroecosystems: a tri-taxa compa-
rison in southern Mexico. Biodiversity and Conservation
12:1239-1252.
Peters S.L., J.R. Malcolm & B.L. Zimmerman. 2006. Effects of
selective logging on bat communities in the southeastern
Amazon. Conservation Biology 20: 1410-1421.
Pinto N. & T. H. Keitt. 2008. Scale-dependent responses to forest
cover displayed by frugivore bats. Oikos 117: 1725-1731.
PresleyS.J.,M.R.Willig,I.Castro-Arellano&S.C.Weaver.2009.
Effects of habitat conversion on temporal activity patterns
of phyllostomid bats in lowland Amazonian rain forest.
JournalofMammalogy90:210-221.
Ramsey F.L. & D.W. Schafer. 2002. The statistical sleuth: A course
in methods of data analysis. Duxbury-Thomson Learning.
742
Sampaio E.M., E.K. Kalko, E. Bernard, et al. 2003. A biodiversity
assessment of bats (Chiroptera) in a tropical lowland ra-
inforest of Central Amazonia, including methodological
and conservation considerations. Studies on Neotropical
Fauna and Environment 38: 17-31.
Schonberg L.A., J.T. Longino, N.M. Nadkarni, et al. 2004. Arboreal
ant species richness in primary forest, secondary forest,
and pasture habitats of a tropical montane landscape.
Biotropica36:402-409.
Schulze M.D., N.E. Seavy & D.F. Whitacre. 2000. A comparison of
the phyllostomid bat assemblages in undisturbed Neotropi-
cal forest and in forest fragments of a slash-and-burn far-
ming mosaic in Petn, Guatemala. Biotropica 32: 174-184.
SimmonsN.B.&R.S.Voss.1998.ThemammalsofParacou,French
Guiana: a Neotropical rainforest fauna. Part I: Bats. Bulle-
tin of the American Museum of Natural History 237: 237.
SobernJ.M.&J.Llorente.1993.TheUseofspeciesaccumulation
functions for the prediction of species richness. Conserva-
tion Biology 7: 480-488.
SolariS.,V.Pacheco&E.Vivar.1999.NewDistributionrecords
ofPeruvianbats.RevistaPeruanadeBiologa6:152-159.
StevensR.D.1996.Ecomorphologicalstructureofbatcommunities:
alternative models and environmental gradients. A thesis
submitted to the Graduate Faculty of Texas Tech University
inPartialFulfllmentoftheRequirementsfortheDegree
of Master of Science.
Velazco P.M. 2005. Morphological phylogeny of the bat genus
Platyrrhinus Saussure, 1860 (Chiroptera: Phyllostomi-
dae) with the description of four new species. Fieldiana
Zoology 105: 1-53.
Vivar E. 2006. Anlisis de distribucin altitudinal de mamferos pe-
queosenelparquenacionalYanachagaChemilln,Pasco,
Per.Tesis,MagisterenZoologia,mencinSistemticay
Evolucin. Facultad de Ciencias Biolgicas, Universidad
NacionalMayordeSanMarcos,Lima,Per.103
Wilson D.E., C.F. Ascorra, S. Solari, D.E. Wilson & A. Sandoval.
1996.Batsasindicatorsofhabitatdisturbance.-En:Manu:
The Biodiversity of Southeastern Peru. Smithsonian Ins-
titution Press, Lima. Pp. 613-625.
Wilson D.E. & D.M. Reeder (eds.). 2005. Mammal species of the
World. Johns Hopkins University Press. 2142
284
Mena
Rev. peru. biol. 17(3): 277 - 284 (Diciembre 2010)
Nombre cientfco N Peso (g) AB (mm) Reproduccin
PHYLLOSTOMIDAE
Subfamilia Desmodontinae
1. Desmodus rotundus (E. Geoffroy, 1810) 13 33,4 62,0 (4,6)
Subfamilia Glossophaginae
2. Anoura caudifer (E. Geoffroy, 1818) 2 9,5 36,0 (1,4) L (08)
3. Anoura cultrata Handley, 1960 2 15 40,5
4. Anoura geoffroyi Gray, 1838 9 12 41,5 (4,0)
Subfamilia Lonchophyllinae
5. Lonchophylla handleyi Hill, 1980 2
6. Lonchophylla robusta* Miller, 1912
Subfamilia Phyllostominae
7. Chrotopterus auritus (Peters, 1856) 1 71 81
8. Lophostoma silvicolum dOrbigny, 1836 4 32,5 59,6 (0,71)
9. Micronycteris hirsuta (Peters, 1869) 1 13 46
10. Micronycteris megalotis (Gray, 1842) 3 5 33,0 (2,7)
11. Micronycteris minuta (Gervais, 1856) 2 7 37
12. Phylloderma stenops Peters, 1865 2 54 71,5 (2,1) L (02)
13. Phyllostomus elongatus* (E. Geoffroy, 1810)
14. Phyllostomus hastatus (Pallas, 1767) 9 94,3 88,7 (3,1) P (02)
Subfamilia Carolliinae
15. Carollia benkeithi Solari y Baker, 2006 10 11,1 37,7 (7,1)
16. Carollia brevicauda (Schinz, 1821) 36 14,8 40,9
17. Carollia perspicillata (Linnaeus, 1758) 33 17,1 42,4 (1,3) L (02)
Subfamilia Stenodermatinae
18. Artibeus anderseni Osgood, 1916 3 21 37,0 (1,4)
19. Artibeus cf. cinereus (Gervais, 1856) 3 11 40
20. Artibeus glaucus Thomas, 1893 9 12 39,2 (1,5)
21. Artibeus lituratus (Olfers, 1818) 4 81,5 74,0 (1,4)
22. Artibeus obscurus (Schinz, 1821) 11 36,7 58,5 (2,7) L(02), P(02 y 08)
23. Artibeus planirostris (Spix, 1823) 7 66 72,5 (2,1)
24. Chiroderma salvini Dobson, 1878 3 39 54 P(02)
25. Chiroderma trinitatum Goodwin, 1958 1
26. Enchistenes hartii (Thomas, 1892) 4 14,5 41,5 (0,7)
27. Mesophylla macconelli Thomas, 1901 4 8 32,7 (2,1)
28. Platyrrhinus albericoi Velazco, 2005 3
29. Platyrrhinus incarum (Thomas, 1912) 2
30. Platyrrhinus infuscus (Peters, 1880) 30 42,8 57,7 (1,6) L y P (02)
31. Platyrrhinus masu Velazco, 2005 6 26 50,5 (0,8)
32. Platyrrhinus nigellus Gardner y Carter, 1972 4 19,5 45,0 (1,4)
33. Sturnira erythromos (Tschudi, 1844) 1 15 42
34. Sturnira lilium (E. Geoffroy, 1810) 14 20,3 43,1 (1,7) L (02,08), P (08)
35. Sturnira oporaphilum (Tschudi, 1844) 4 20 46
36. Uroderma bilobatum Peters, 1866 1 18 44
37. Vampyressa thyone Thomas, 1909 1 8 32
38. Vampyrodes caraccioli (Thomas, 1889) 3 30,7 52,7 (2,5)
THYROPTERIDAE
39. Thyroptera tricolor Spix, 1823 1 5 38
MOLOSSIDAE
40. Molossus molossus (Pallas, 1766) 2 16,3 36,0 (3,6)
41. Molossus rufus E. Geoffroy, 1805 1 46 54
VESPERTILIONIDAE
42. Eptesicus brasilienis** (Desmarest, 1819)
43. Lasiurus blossevillii** (Lesson y Garnot, 1826) 7 41
44. Myotis nigricans (Schinz, 1821) 2 5,8 36,0 (3,5) L (02)
45. Myotis riparius Handley, 1960 2 5,5 39,0 (0,0)
46. Myotis simus Thomas, 1901 1 6 37
Apndice 1. Lista de especies de murcilagos registrados en Pozuzo. En la columna de peso (en gramos); se seala entre parntesis la
desviacin estndar y en la columna de reproduccin los meses de febrero (02) y agosto (08). Estado reproductivo L: lactando, P: preadas.
N = nmero de individuos y AB = Antebrazo. *Reportado por Solari et al. (1999). **Capturas fuera de los eventos de muestreo.
285

Caractersticas de una poblacin sobreexplotada Ensis macha
Rev. peru. biol. 17(3): 285 - 292 (December 2010)
Rev. peru. biol. 17(3): 285 - 292 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Caractersticas de una poblacin sobreexplotada de concha navaja,
Ensis macha, en Baha Independencia, Per, durante el 2004
Roberto Espinoza
1
, Juan Tarazona
1
y Jrgen Laudien
2
Overfshing population characteristics of razor clam, Ensis macha, from
Independencia Bay, Peru, in 2004 year
1Laboratorio de Ecologa Marina,
Facultad de Ciencias Biolgicas,
Universidad nacional Mayor de San
Marcos, Apartado 110058 Lima
11. Email Juan Tarazona: jltarazo-
na@yahoo.com.
Email Roberto Espinoza: respinoza.
unmsm@gmail.com
2 Divisin de Biociencias, Alfred
Wegener Institut fr Polar und
Meeresforschung (AWI)
Presentado: 02/03/2010
Aceptado: 21/10/2010
Publicado online: 00/11/2010
Resumen
Muestreos cuantitativos mensuales, durante el ao 2004, fueron realizados para estimar la densidad y biomasa
de una poblacin de Ensis macha (Molina 1782) en Morro Quemado, Baha Independencia. Se estudian las
relaciones biomtricas, los parmetros de crecimiento y de produccin poblacional, utilizando la rutina ELEFAN I
y el mtodo de Crisp. Durante el 2004 se encontr valores signifcativamente mayores de la tasa de explotacin
(E= 0,69 a
-1
) y una duplicacin de los desembarques mensuales (mximo de 335 t) y esfuerzo pesquero (mximo
de 848 viajes). Estos cambios repercutieron en el mismo ao con una disminucin signifcativa de la densidad
promedio de la poblacin (D = 54,13 ind.m
-2
) y la reduccin a la mitad de los valores de produccin somtica
(P= 81,99 gPSLC

m
-2
a
-1
) y tasa P/B (0,38 a
-1
), respecto a los valores del ao anterior. Tambin se observ un
incremento signifcativo de la tasa de mortalidad total (2,84 a
-1
) y una duplicacin de la tasa de mortalidad por
pesca (1,97 a
-1
), respecto al ao anterior. Se concluye que la poblacin estudiada de E. macha era un recurso
comercial sobreexplotado en el 2003 y que el incremento de la presin pesquera en el 2004, particularmente
durante el segundo semestre, intensifc su condicin de recurso sobreexplotado.
Palabras clave: Concha navaja, Pesca artesanal, Sobrepesca, Motobombas hidrulicas, produccin.
Abstract
Quantitative monthly samplings, in 2004, were carried out to estimate the density and biomass of Ensis macha
(Molina 1782), from Morro Quemado area, Bay Independence, Pisco. The present study analyzes biometric
relationships, growth parameters and somatic production using the ELEFAN I routine and the Crisps method.
During the year 2004 the rate of exploitation (E= 0.69 y
-1
) was signifcantly bigger than the values of 2003 and
the monthly landings (maximum of 335 t) and fshing effort (maximum of 848 trips) were twice increased. These
changes induced in the same year a signifcant decrease of population mean density (D= 54.13 ind. m
-2
) and
the halfway reduction of somatic production (P= 81.99 gAFDW m
-2
y
-1
) and P/B rate (0.38 y
-1
) values, regard-
ing the values of the previous year. Also, a signifcant increment of total mortality rate (2.84 y
-1
) and the fshing
mortality rate (1.97 y
-1
) were twice increased, regarding the previous year. It is assumed that the population
of razor clams already was a overfshing commercial resource in the 2003 and that the increment of fshing
pressure in the 2004, particularly during the second semester, intensifed its overfshing resource condition.
Keywords: Razor clam, artisanal fsheries, overfshing, clam kicking, production.
Introduccin
En el Per la concha navaja, Ensis macha (Molina 1782),
comenz a ser registrada en la pesquera artesanal desde el ao
2000, en el rea de Pisco, principalmente en la zona de Morro
Quemado en baha Independencia (1419'S - 7607'W). Pos-
teriormente fue registrada desde San Juan de Marcona (1522S
7509W) hasta baha Samanco (0910S 7833W), y en
el 2006 adems en baha Sechura (0549S 8101W); siendo
considerada en la actualidad como un importante recurso ben-
tnico. Desde el ao 2003 es reportado el uso de motobombas
hidrulicas en la extraccin de E. macha, arte que incrementa
la extraccin hasta en cuatro veces con respecto a la forma
tradicional (J. Zavala, comunicacin personal). En el ao 2005
el Ministerio de la Produccin de Per prohibi el uso de las
motobombas (R.M. N025-2005-PRODUCE, 2 de febrero de
2005) y fueron establecidas vedas con la fnalidad de recuperar el
recurso en las diferentes reas de extraccin y en particular la po-
blacin de Morro Quemado (R.M. N266-2005-PRODUCE,
6 de octubre de 2005).
Los estudios sobre la biologa o ecologa de E. macha son escasos
en Per (Espinoza 2006), sin embargo se puede encontrar infor-
macin sobre el crecimiento, produccin e ndices reproductivos
de poblaciones en Chile y Argentina (Urban 1996, Aracena et al.
2003; Barn et al. 2004), la cual nos permitir evaluar el estado
de las poblaciones peruanas, que en la actualidad pueden ser
consideradas en colapso.
En el presente trabajo son evaluadas las caractersticas de
la poblacin E. macha del rea de Morro Quemado (baha
Independencia, Pisco, Per), durante el ao 2004; ao en la
que ocurri la mayor intensidad de extraccin pesquera sobre
la concha navaja.
Material y mtodos
Obtencin y procesamiento de muestras.- La poblacin de
E. macha fue muestreada mensualmente de enero a diciembre del
2004, en la zona de Morro Quemado, en baha Independencia
(1419'35S, 7607'43W) (Fig. 1).
Se realizaron dos tipos de muestreos, uno cuantitativo usando
un marco cuadrado de 0,5 m de lado, con 5 rplicas en cada una
de las estaciones de muestreo, ubicadas a profundidades de 4; 8
y 12 m. Otro muestreo cualitativo, tambin mensual, consisti
en la colecta ad libitum de 40 80 ejemplares.
En cada individuo fue determinada la longitud (L= distancia
del borde anterior al borde posterior, con un vernier 0,05 mm),
el peso total (PT), peso hmedo de visceras (PHV) y peso seco
de visceras (PSV) con una balanza de 0,01 g de precisin. El
peso seco se obtuvo colocando los tejidos blandos en una estufa
286
Espinoza et al.
Rev. peru. biol. 17(3): 285 - 292 (Diciembre 2010)
(90 C; 48 h). El peso seco libre de cenizas (PSLC) fue obtenido
incinerando las partes blandas y secas de los individuos en una
mufa (600 C; 3 h) y pesadas en una balanza analtica ( 0,0001
g). Adicionalmente, se tomaron datos de temperatura, oxgeno
y clorofla a, usando un equipo perflador CTD.
Anlisis de datos y estadstica
Pesquera.- Para evaluar la actividad pesquera fueron utili-
zadas las estadsticas de desembarques y esfuerzos de pesca del
ao 2004 para el rea de estudio (expresado en nmero de viajes
y buzos dedicados a la extraccin de la concha navaja), propor-
cionados por el IMARPE (Yamashiro com. pers.).
Estructura poblacional.- Las relaciones longitudpeso
total, peso hmedo visceral, peso seco visceral y peso seco libre
de cenizas se determinaron utilizando la ecuacin de alometra
Ps = aLt
b
, la cual fue ajustada por el mtodo de los mnimos
cuadrados. Se determin el peso estndar mensual y promedio
(g PT) para un individuo de longitud de 150 mm, que puede
ser considerada la talla comercial (Aracena et al. 1998).
Se analiz la distribucin mensual de tallas agrupadas en
intervalos de 5 mm, y se hallaron las variables estadsticas de
longitud mxima observada, longitud promedio, moda, varianza
y desviacin estndar.
Dinmica poblacional
Crecimiento y mortalidad. -Para la estimacin de los pa-
rmetros de crecimiento fueron utilizados los datos mensuales
de frecuencia de tallas del 2004, mediante el software FISAT
(Gayanilo et al. 1995). ELEFAN I (Pauly & David 1981) per-
miti estimar los parmetros de crecimiento K y L

a partir de la
frecuencia de tallas, en base a la identifcacin de grupos de edad
en cada muestra, obtenindose una curva de crecimiento dada
por la funcin de crecimiento no oscilante de von Bertalanfy:
L
t
= L

(1e
K(tt
0
)
),
donde:
L
t
es la longitud de la valva (talla) a la edad t,
L

es la media asinttica de la longitud de la valva,


K es la constante de crecimiento en aos
1
,
t es la edad en aos, y
t
0
es la edad a la longitud cero.
Para la determinacin del valor de t
0
, que representa el tiempo
en que el organismo tiene cero milimetros de longitud, se utiliz
la siguiente ecuacin de acuerdo a Pauly (1983):
Log(t
0
) = 0,3922 0,2752*Log(L

) 1,038*Log(K )
Como mtodo de comparacin de los parmetros estimados,
en base a la relacin estadstica entre K y L

,

con otros repor-
tados en la literatura, fue estimado un ndice de rendimiento
del crecimiento (Pauly & Munro 1984) usando la ecuacin:
= Log(K)+2*Log(L

)
La mortalidad total Z (ao
1
) fue estimada a partir de los
datos de frecuencia de tallas, mediante el mtodo de curva de
captura basada en la conversin de tallas (Pauly 1983). Usando
los parmetros de crecimiento del modelo de von Bertalanfy, las
longitudes de todas las navajas agrupadas en intervalos de tallas
fueron convertidas a edad mediante la ecuacin:
N
j
/t
j
= N
0

e
Ztj
donde:
N
j
es el nmero de individuos en el intervalo de talla j,
t
j
es el tiempo necesario para crecer a travs del intervalo j,
N
0
es el nmero de individuos en el tiempo 0.
t
j
es la edad relativa correspondiente a la talla media del
intervalo de j.
La edad t
j
fue calculada utilizando el modelo de crecimiento
de von Bertalanfy inverso:
t
j
= (1/K) Ln(1 - L
j
/ L

)+ t
0
,
donde:
Hj es la altura de la valva (talla) a la edad t
j
.
La mortalidad Z fue fnalmente calculada mediante un an-
lisis de regresin lineal de la ecuacin:
Ln(N
j
/t
j
) = Ln(N
0
) Zt
j
donde: b = Z
La mortalidad natural M (ao
1
) fue estimada de acuerdo a
Hewitt y Hoenig (2005), mediante la ecuacin:
M = 4,22/E
max

donde E
max
es la edad mxima.
La mortalidad por pesca F (ao
1
) y la tasa de explotacin E
(ao
1
), fueron calculadas mediante las ecuaciones:
F = Z M y E = F / Z
76,5W 76W
14,5S
14S
13,5S
Pisco
Baha Independencia
13,8S
14,3S
76,3W
Morro Quemado
Figura 1. Ubicacin del rea de muestreo de la concha navaja,
Ensis macha, en Morro Quemado, Baha Independencia durante el
ao 2004.
287

Caractersticas de una poblacin sobreexplotada Ensis macha
Rev. peru. biol. 17(3): 285 - 292 (December 2010)
Donde:
Z: mortalidad total
M: mortalidad natural
Produccin secundaria.- La produccin somtica de la
poblacin P (en g PSLC m
2
ao
1
) fue calculada por el mtodo
de la tasa de crecimiento especfco en peso (Crisp 1984) usando
la distribucin de frecuencia de tallas, los parmetros VBGF y
las relaciones longitud-PSLC:
P = N
i
W
i
G
i
donde: N
i
= nmero

promedio de ejemplares (N Indm
2
)
W
i
= peso corporal promedio (en g, PSLC) en la clase de
longitud i
G
i
= tasa de crecimiento especfco en peso (ao
-1
):
G
i
= b K ((L

/L
i
) 1)
donde b es el exponente de la relacin longitud-peso, L

y
K son los parmetros VBGF y L
i
es la longitud promedio en la
clase de longitud i.
La biomasa promedio anualB (en g PSLC por m
2
por ao)
fue hallada por:
B= N
i
W
i
La relacin anual P/B fue calculada a partir de la produccin
somtica anual P y de la biomasa media anual B.
Resultados
Condiciones oceanogrfcas.- Ensis macha habita en los
fondos arenosos del submareal de Morro Quemado y se distri-
buye desde 3 a 18 m de profundidad. El 2004 la temperatura de
fondo tuvo un promedio de 15,1 C (enero-marzo) y de 14,3 C
(julio-setiembre) durante el verano e invierno, respectivamente.
Las concentraciones de oxgeno disuelto cerca al fondo fueron
ms bajas en el verano, fuctuando entre 0,5 y 1,0 mL.L
-1
,

en
relacin al resto del ao (1,0 3,5 mL.L
-1
). Los valores de
clorofla-a fueron altos durante todo el perodo de estudio, con
valores mayores de 10 g.L
1
.
Estructura poblacional
Pesquera, densidad y biomasa.- En el ao 2004 se observ
una tendencia descendente de la densidad y biomasa poblacional.
La densidad disminuy desde valores mximos en enero (77,87
ind.m
2
), hasta valores mnimos en diciembre (22,93 ind.m
-2
),
con promedio de 54,13 ind.m
2
. La biomasa fuctu entre 2,95
kg.m
2
(enero 2004) y 1,35kg.m
2
(diciembre 2004), con un
promedio de 2,51 kg.m
-2
(Fig. 2).
Los desembarques registraron una tendencia ascendente
desde enero (98,18 t) a diciembre (335,02 t). De igual forma,
se observ en el esfuerzo pesquero, con valores de 287 (enero
a b r
2
N Relacin Localidad Referencia
2,00E-06 3,34 0,75 554 Longitud-PT Baha Independencia, Per Espinoza 2006
2,00E-07 3,73 0,73 474 Longitud-PHV Baha Independencia, Per Espinoza 2006
3,00E-10 4,68 0,69 475 Longitud-PSV Baha Independencia, Per Espinoza 2006
1,00E-05 3,07 0,73 810 Longitud-PT Baha Independencia, Per Este estudio
3,00E-05 2,75 0,58 389 Longitud-PHV Baha Independencia, Per Este estudio
6,00E-06 2,73 0,48 386 Longitud-PSV Baha Independencia, Per Este estudio
2,90E-07 2,93 0,74 718 Longitud-PT Chile Central Aracena et al. 1998
8,84E-03 3,22 0,99 243 Longitud-PT Chile Central Lpez et al. 1997
5,32E-03 3,35 0,98 221 Longitud-PT Chile Central Aracena et al. 1998
1,00E-05 3,12 0,98 662 Longitud-PT Tubul-Chile
Universidad Austral de Chile 1998.
1,00E-05 3,10 0,98 226 Longitud-PT Corral-Chile
Universidad Austral de Chile 1998.
1,04E-05 3,03 0,86 270 Longitud-PT Golfo San Matas, Argentina Barn et al. 2004
3,79E-05 2,66 0,68 270 Longitud-PHV Golfo San Matas, Argentina Barn et al. 2004
Tabla 1. Comparacin de los parmetros de la ecuacin Longitud = aPeso
b
para la concha navaja Ensis macha en Baha Independencia
durante el ao 2004 con valores de la literatura. Peso total (PT), Peso hmedo visceral (PHV) y Peso seco visceral (PSV).
Especie L

(mm) K t
0
Localidad Mtodo Referencia
E. macha 184,10 0,48 -0,39 4,21 Baha Independencia, Per AFT Espinoza 2006
E. macha 184,70 0,55 -0,33 4,27 Baha Independencia, Per AFT Este estudio
E. macha 196,73 0,30 n, d, 4,07 Chile Central AFT Aracena et al. 1998
E. macha 189,90 0,21 -0,58 3,88 Chile Central AFT Urban 1996
E. macha 216,51 0,25 -0,28 4,07 Chile Central AFT Aracena et al. 1998
E. macha 154,00 0,25 -0,08 3,77 Golfo San Matas, Argentina OAC Barn et al. 2004
E. macha 153,70 0,20 -0,72 3,67 Golfo San Matas, Argentina OAC Barn et al. 2004
E. arcuatus 139,80 0,37 n.d. 3,86 Baha de Orphir, Irlanda OAC Robinson y Richardson 1998
E. arcuatus 166,60 0,26 n.d. 3,85 Baha de Irlanda, Irlanda OAC Robinson y Richardson 1998
E. ensis 131,60 0,57 n.d. 3,99 Gales del Norte, Inglaterra OAC Robinson y Richardson 1998
E. siliqua 154,70 0,54 n.d. 4,11 Gales del Norte, Inglaterra OAC Robinson y Richardson 1998
E. siliqua 139.60 0.65 n.d. 4,10 Barrinha. Portugal OAC Gaspar et al. 1994
Tabla 2. Parmetros de crecimiento estimados para la navaja Ensis macha en Baha Independencia durante el ao 2004 y comparados con
valores obtenidos con otras especies del Ensis. Mtodos: anlisis de frecuencia de tallas (AFT) y observacin de anillos de crecimiento (OAC).
288
Espinoza et al.
Rev. peru. biol. 17(3): 285 - 292 (Diciembre 2010)
0
20
40
60
80
100
D
e
n
s
i
d
a
d

(
I
n
d
.

m
-
2
)
0
2
4
6
Ene Feb Mar Abr May Jun Jul Ago Sep Oct Nov Dic
B
i
o
m
a
s
a

(
1
0
0
0
g

m
-
2
)
2004
Figura 2. Densidad y biomasa promedio mensual de la concha navaja Ensis macha en Morro Quemado, Baha Independencia durante el
ao 2004.
y = 0,4663x - 17620
R = 0,4017 y = 0,1455x - 5264
R = 0,1148
0
50
100
150
200
250
300
350
400
D
e
s
e
m
b
a
r
q
u
e

(
t
)
y = 0,551x - 20641
R = 0,1831
y = 0,8613x - 32240
R = 0,3384
0
100
200
300
400
500
600
700
800
900
ene feb mar abr may jun jul ago sep oct nov dic
E
s
f
u
e
r
z
o

p
e
s
q
u
e
r
o

(
N


d
e

v
i
a
j
e
s
)
2004
b
a
Figura 3. Desembarque (a) y esfuerzo pesquero (b) de la concha navaja Ensis macha en Morro Quemado, Baha Independencia, durante
el ao 2004.
289

Caractersticas de una poblacin sobreexplotada Ensis macha
Rev. peru. biol. 17(3): 285 - 292 (December 2010)
2004) a 848 viajes (diciembre 2004) y de 894 (enero) a 4901
buzos (diciembre) dedicados a la extraccin de la concha navaja
(Fig. 3a, b).
La actividad pesquera muestra dos etapas bien diferenciadas
durante el ao 2004; el primer semestre (enero-junio 2004)
caracterizado por desembarques menores a 180 t y un esfuerzo
menor a 425 viajes (Fig. 3a) y el segundo trimestre (julio-
diciembre 2004), con desembarques relativamente altos entre
260 a 335 y una mayor esfuerzo pesquero con valores entre 580
y 850 viajes (Fig. 3b).
Se observ una correlacin signifcativa inversa entre desem-
barque y densidad (p= 0,029), pero no con la biomasa. De la
misma forma, se evidenci una correlacin signifcativa inversa
entre el esfuerzo pesquero (nmero de viajes y nmero de buzos)
y la densidad mensual para el ao 2004 (p<0,05).
Estructura de tallas y relacin talla-peso.- La estructura de
tallas de la poblacin tuvo un rango entre 90 y 175 mm para el
perodo de estudio, con notoria ausencia de la fraccin juvenil.
La distribucin de tallas fue unimodal (150 mm). La longitud
mxima y promedio observada fue de 172 y 146,5 mm + 10,8
(EE), respectivamente.
Figure 4. Curva de crecimiento de la navaja Ensis macha en base a
frecuencia de tallas dada por la rutina FISAT, durante el ao 2004.
Especie B (g PSLC m
-2
) Psom (g PSLC m
-2
yr
-1
) P/B (a
-1
) Perodo Localidad Referencia
Gari solida 2,69 27,60 0,33 1991-92 Chile Urban & Campos 1994
G. solida 189,30 107,90 0,57 1990 Per Urban & Tarazona 1996
G. solida 71,60 21,30 0,30 1992 Per Urban & Tarazona 1996
G. solida 23,50 14,00 0,60 1993 Per Urban & Tarazona 1996
G. solida 14,40 8,60 0,60 1994 Per Urban & Tarazona 1996
Protothaca thaca 2,30 16,90 0,27 1991-92 Chile Urban & Campos 1994
Semele solida 1,91 4,80 0,19 1991-93 Chile Urban & Campos 1994
Tagelus dombeii 26,70 7,80 0,29 1991-94 Chile Urban 1996
Venus antiqua 69,56 40,69 0,59 1994 Chile Clasing et al. 1994
V. antiqua 122,00 22,00 0,18 1991-92 Chile Urban 1996
E. macha 43,60 9,70 0,22 1991-92 Chile Urban 1996
E. macha 275,92 191,07 0,69 2003 Per Espinoza 2006
E. macha 215,14 81,99 0,38 2004 Per Presente estudio
Tabla 3. Parmetros de la produccin secundaria obtenidos de la navaja Ensis macha en Baha Independencia y comparados con otros
valores de bivalvos del Pacfco Sudeste.
0
5
10
15
20
0
2
4
6
8
10
5 25 45 65 85 105 125 145 165
P
r
o
d
u
c
c
i

n
/
i
n
t
e
r
v
.

c
l
a
s
e

(
g

P
S
L
C
)
D
e
n
s
i
d
a
d

m
e
d
i
a

(
I
n
d
.

m
-
2
)
Longitud (mm)
0,0
0,5
1,0
1,5
2,0
2,5
P
r
o
d
u
c
c
i

n

(
g

P
S
L
C

a
-
1
)
A)
B)
P = 81,99 g PSLC m
2
a
1
B = 215,14 g PSLC m
2
P/B = 0,38 ao
1
Figure 5. Produccin somtica individual y poblacional, y tasa de
renovacin poblacional (P/B) de la navaja Ensis macha de Morro
Quemado, Baha Independencia, durante el ao 2004.
2004
M
a
r
A
b
r
M
a
y
A
g
o
O
c
t
S
e
t
J
u
n
F
e
b
D
i
c
N
o
v
E
n
e
175
150
125
100
75
50
25
290
Espinoza et al.
Rev. peru. biol. 17(3): 285 - 292 (Diciembre 2010)
La relacin talla-peso fue mejor descrita por una regresin
potencial para todos los pesos usando PT, PHV, PSV Y PSLC
(Tabla 1). Los pesos promedio de individuos fuctuaron entre
37,89 g (enero 2004) a 58,80 g (diciembre 2004). Se observ
una correlacin signifcativa directa entre el peso individual y
el desembarque y esfuerzo pesquero (p< 0,05).
El peso estndar promedio calculado para una talla comercial
de 150 mm en el 2004 fue de 47,91 g, mientras los pesos es-
tndares mensuales fuctuaron entre 41,60 g (noviembre 2004)
a 67,08 g (marzo 2004).
Dinmica poblacional
Crecimiento y mortalidad.- Se obtuvo una tasa de creci-
miento (K) de 0,55 ao
1
, una longitud infnita (L

) de 184,7
mm y un t
0
= -0,33 (R
n
= 0,242) para el perodo 2004 (Fig. 4;
Tabla 2). La curva terica de crecimiento mostr que la mayor
parte de la poblacin estudiada (135 150 mm) tuvo una edad
entre 2 y 2,75 aos para este estudio. La edad mxima y masa
mxima fueron calculados en 4,87 aos y 6,47 g PSLC, respecti-
vamente, correspondiente a una longitud mxima observada de
172 mm. El ndice de rendimiento del crecimiento fue estimado
en = 4,27 a
1
.
La tasa de mortalidad total (Z) estimada por la curva de
captura fue de 2,84 a
1
. De acuerdo al modelo de Hewitt y
Hoenig (2005), la tasa de mortalidad natural fue de 0,87 a
1
.
La mortalidad por pesca (F) y la tasa de explotacin (E) fueron
estimadas en 1,97 y 0,69 a
1
, respectivamente.
Produccin secundaria.- Los estimados de produccin fue-
ron calculados a partir de una biomasa anual por clase de 215,14
g PSLC m
2
y la regresin longitud-PSLC [y= 1e 06x
3,05
(r
2
=
0,50; n= 400)]. La produccin individual de la concha navaja
en el 2004 alcanz 1,97 g PSLC a
1
a los 125 mm, decreciendo
luego paulatinamente en las tallas mayores.
Las navajas comprendidas entre 140 y 160 mm de longitud
fueron las ms abundantes y por tanto las que aportaron signi-
fcativamente a la produccin somtica poblacional de 81,99 g
PSLC

m
2
a
1
, siendo escasa la contribucin de tallas menores
a la produccin (Fig. 5; Tabla 3). La tasa P/B para el 2004 fue
estimada en 0,38 ao
1
.
Discusin
La pesquera de la concha navaja Ensis macha constituye una
actividad artesanal importante debido a su consumo y expor-
tacin. Sin embargo, en Baha Independencia esta pesquera
disminuy drsticamente y casi colaps como consecuencia de
la sobreexplotacin y falta de regulacin pesquera (Mendo &
Espinoza 2008).
La densidad promedio de E. macha en Morro Quemado,
observada en los aos 2002 y 2003 fueron de 150,98 y de 79,7
ind.m
2
, respectivamente; posiblemente causadas por las con-
diciones oceanogrfcas favorables, propias del sistema peruano
de surgencias costeras, y al estado incipiente de esta pesquera
(Espinoza 2006). Durante el ao 2004 la densidad promedio
decreci hasta 50,6 ind.m
2
, principalmente relacionado con el
incremento de las capturas y del esfuerzo pesquero.
Aunque la biomasa no mostr una correlacin signifcativa
con las variables pesqueras, si disminuy respecto a los aos
anteriores, de 2,9 kg.m
2
en el 2003 a 2,5 kg.m
2
en el 2004
(Espinoza 2006). La escasa correlacin de la biomasa con las
variables pesqueras podra ser explicada por el mayor peso in-
dividual estimado en el 2004 y el incremento de biomasa en la
etapa de maduracin gondica.
La estructura por tallas de E. macha durante el 2004 en
baha Independencia fue similar al reportado en el 2003, con
un rango comprendido entre 90 175 mm (Espinoza, 2006),
lo que indica que se trataba de una poblacin compuesta slo
de individuos adultos.
La mxima longitud de E. macha observada en el estudio (L
max,
2004
= 172 mm) tambin fue menor que las reportadas en pobla-
ciones de Chile Central (185 220 mm; Universidad Austral
de Chile 1998). Esta diferencia podra explicarse por la presin
pesquera y la falta de un plan de ordenamiento en Per, en
contraste con la pesquera chilena que si contaba con regulacin
pesquera; pero tambin, Urban & Tesch (1996) han postulado
una posible gradiente latitudinal, con individuos ms grandes en
latitudes ms altas; hiptesis que queda por comprobar.
Por otro lado, la ausencia de tallas pequeas durante el estudio
puede explicarse por muchos factores, como la falta de un des-
ove intenso, la alta mortalidad larval, el reducido asentamiento
exitoso y fallas en el patrn de dispersin larval y otros efectos
debidos al impacto pesquero sobre el recurso.
Consideramos que la hiptesis ms factible sera una falla
en el patrn de dispersin y asentamiento larval dentro de la
baha, asociados al disturbio del fondo por la intensa actividad
extractiva, ya que se han encontrado especmenes juveniles en
zonas alejadas de la poblacin estudiada y sin impacto de la
pesquera (Espinoza 2006).
La tasa de crecimiento de la navaja peruana de 0,55 en el 2004
result similar que lo estimado en el 2003 (K = 0,48, Espinoza
2006), pero mayor que las tasas calculadas para poblaciones
chilenas (Canales y Ponce 1995, Urban 1996, Urban y Tesch
1996, Aracena et al. 1998) y argentinas (Barn et al. 2004).
Por otro lado, la edad mxima de 4,87 aos, encontrada en
el presente trabajo, result signifcativamente menor al de las
poblaciones chilenas (10 aos, Aracena et al. 1998 y Universidad
Austral de Chile 1998; 14 aos, Urban 1996), demostrando una
mayor tasa de crecimiento en la poblacin peruana de concha
navaja, lo que podra ser explicado por las condiciones ambien-
tales favorables del ecosistema peruano de surgencias costeras
(Tarazona & Arntz 2001). Estos aspectos concordarian con el
hecho de que especies de zonas tropicales o subtropicales tienen
una tasa de crecimiento mayor y alcanzan la longitud infnita
en un menor tiempo, al contrario de las ubicadas en latitudes
ms altas (Urban & Tesch 1996).
Por otro lado, se estim una tasa de mortalidad total y de
pesca de 2,84 a
1
y 1,97 a
1
en el 2004 que resultaron con-
siderablemente mayores que las observadas en el 2003, con
valores de 1,94 a
1
y 0,98 a
1
(Espinoza 2006). Esto debido
a una alta tasa de explotacin en el 2004 (E= 0,69 a
1
), que
resulta mayor que la estimada en el 2003 (E= 0,60 a
1
). Segn
Caddy y Csirke (1983), una tasa de explotacin de 0,5 es la
tasa ptima de explotacin de una pesquera, por lo cual es
una evidencia ms de que la poblacin de E. macha en el 2003
ya estaba sobreexplotada y que en el 2004 se intensifc con el
cambio de arte de pesca.
291

Caractersticas de una poblacin sobreexplotada Ensis macha
Rev. peru. biol. 17(3): 285 - 292 (December 2010)
Las estadsticas de la pesquera de la concha navaja en el
2002 y 2003 demuestran desembarques que variaron entre
valores entre 47 y 190 t, y entre 44 y 180 t, respectivamente,
que resultaron mayores a los de aos anteriores. Mientras que,
en el 2004 los valores de desembarque fueron mayores, entre
64 y 335 t, lo cual estuvo tambin acorde con los ms altos
valores de esfuerzo pesquero registrados en la baha. Adems,
podemos destacar que el nmero de viajes dedicados a la ex-
traccin de la concha navaja en la baha durante los meses de
julio a diciembre del 2004 (entre 582 a 848) fue casi el doble
que el del primer semestre (entre 249 a 422). Este importante
incremento del esfuerzo pesquero fue debido al cambio de arte
de pesca en las embarcaciones pesqueras durante el segundo
semestre, cuando se generaliz el uso de un sistema de moto-
bomba o clam kicking (Mendo & Espinoza 2008, Gaspar
et al. 2008). Esta mayor efciencia del arte permiti mayores
capturas del recurso, con lo cual aument la presin pesquera
en el rea (Espinoza 2006), y se increment la mortalidad por
pesca. De esta forma el mayor impacto pesquero en la estruc-
tura poblacional, sobre todo a nivel de densidad y biomasa, se
dio en el segundo semestre del 2004.
El cambio de arte de pesca sera tambin el responsable del
incremento de la mortalidad natural, ya que la presin de agua,
generada por la motobomba, no slo matara directamente los
individuos al daar sus valvas, sino que ademas muchos indi-
viduos no seran capaces de enterrarse y quedaran vulnerables
a los depredadores o moriran por lesiones o stress, lo cual se
traducira en una importante mortalidad post-pesca, (Gaspar
et al. 1994, Robinson & Richardson 1998). Asimismo, Tuck et
al. (2000) demostraron el impacto de la presin de agua de las
motobombas como un factor fsico disturbante sobre el sustrato
y la comunidad biolgica asociada a Ensis spp.
En cuanto a la produccin secundaria, la produccin so-
mtica poblacional de E. macha disminuy signifcativamente
desde valores de 191,07 g PSLC

m
2
a
1
en el 2003 (Espinoza
2006) a 81,99 g PSLC

m
2
a
1
en el 2004, evidentemente aso-
ciado al incremento de la presin pesquera. Si se postula que la
produccin poblacional es igualmente dependiente de la tasa
de crecimiento de su biomasa (Benke 1993), se puede sugerir
que la menor produccin en el 2004 estuvo relacionada sobre
todo a menores valores de densidad y la ausencia de individuos
juveniles. Sin embargo, el valor de produccin de la navaja del
2004 fue relativamente ms alto que el de otros bivalvos dentro
de la regin del Pacfco Sudeste (Urban & Tarazona 1996).
Asimismo la tasa P/B durante el ao 2003 mostr un valor
de 0,69 a
1
(Espinoza 2006), pero decay signifcativamente a
0.38a
1
en el 2004, debido a las bajas densidades y alta mor-
talidad por pesca. Sin embargo, estos valores que fueron ms
altos que los hallado en Chile (0,22 a
1
; Urban 1996); y los
estimados para otros bivalvos del Pacfco Sudeste, tales como
G. solida, Semele solida y Protothaca thaca (Urban & Campos
1994, Urban & Tarazona 1996), Venus antiqua (Clasing et al.
1994), V. antiqua y Tagelus dombeii (Urban 1996). Se ha postu-
lado que altos valores de P/B estn relacionados a altas tasas de
mortalidad total, baja masa promedio y altas tasas de crecimiento
(Lomovasky et al. 2002).
Se concluye que la poblacin de concha navaja de baha
Independencia ya mostraba indicios de sobreexplotacin en el
2003 y el elevado esfuerzo pesquero y desembarque del recurso
en el ao 2004, sobre todo a partir del segundo semestre en que
se cambi el arte de pesca, intensifc su condicin de recurso
sobreexplotado. Es recomendable mantener el seguimiento de
los parmetros biolgicos y pesqueros de esta poblacin, para
establecer medidas efectivas de regulacin pesquera y de recu-
peracin de la poblacin.
Agradecimientos
Al Instituto Alfred Wegener para Estudios Marinos y Polares
(Alemania), a la Universidad Nacional Mayor de San Marcos
y al proyecto CENSOR, que brindaron el apoyo acadmico,
fnanciero y logstico para el desarrollo de esta investigacin.
A los integrantes del Grupo DePSEA, Laboratorio de Ecologa
Marina, quienes colaboraron en el trabajo de campo, anlisis de
datos y sugerencias en la elaboracin de esta evaluacin.
Literatura citada
AracenaO.,M.Carmona&L.Medina.1998.LanavajaenlaVIII
regin. Documento N1, Proyecto FONDEF d96/1095.
Instituto de Fomento Pesquero, Universidad de Concep-
cin, Chile. 14 pp.
Aracena O., I. Lpez, J. Snchez, A. Carmona, I. Medina & A. Saave-
dra. 2003. On two new macroscopic indexes to evaluate
the reproductive cycle of Ensis macha (Molina, 1782).
JournalofShellfshResearch2(3):675-680.
AvellanalM.,E.Jaramillo,E.Clasing,P.Quijn&H.Contreras.
2002. Reproductive cycles of the bivalves Ensis macha
(Molina, 1782) (Solenidae), Tagelus tombeii (Lamarck,
1818) (Solecurtidae), and Mulinia edulis (King, 1831)
(Mactridae) in southern Chile. The veliger 45(1): 33-44.
Barn P., L. Real L, N. Ciocco & M. R. 2004. Morphometry,
growth and reproduction of an Atlantic population of the
razor clam Ensis macha (Molina, 1782). Scientia Marina,
68(2): 211-217.
BenkeA.C.1993.Conceptsandpatternsofinvertebrateproduction
in running waters. Verh Internat. Verein. Limnol. 25: 15-38.
Caddy,J.F.&J.Csirke.1983.Approximationstosustainableyield
for exploited and unexploited stocks. Ocanogr.trop.
18(1):3-15.
ClasingE,T.Brey,R.Stead,J.Navarro,G.Ascencios.1994.Popu-
lation dynamics of Venus antiqua (Bivalvia: Veneracea) in
theBahadeYaldad,IsladeChilo,southernChile.JExp
Mar Bio Ecol 177:171-186.
Crisp D. 1984. Energy fow measurements. In: N. Holme andA.
McIntyre, eds. Methods for the study of marine benthos.
Blackwell, Londres. Pp. 284-372.
Espinoza R. 2006. Estructura y dinmica poblacional de Ensis macha
(Molina,1782)enBahaIndependencia,Pisco,Per.Tesis
para optar el ttulo profesional de Bilogo, Mencin en
Hidrobiologa y Pesquera, Universidad Nacional Mayor
deSanMarcos,Per.61pp.
Gaspar M., C.A. Richardson & C.C. Monteiro. 1994.The effects
dredging on shell formation in the razor clam Ensis siliqua
from Barrinha, southern Portugal. J. Mar. Bio. Ass. UK
74:927-938.
Gaspar M.B., R. Constantino, A. Guerra & S. Carvalho. 2008. Ca-
ptulo 10: Impactos medioambientales de las pesqueras
denavajasylongueironesenfuncindelastcnicasde
pesca y de los hbitos de explotacin. En: A. Guerra y C.
Lodeiros.Navajasylongueirones:biologa,pesquerasy
cultivo. Xunta de Galicia, Consellera de Pesca e Asuntos
Martimos.Pp.223-269.
GayaniloF.C.,P.Sparre&D.Pauly.1995.TheFAO-ICLAMStock
Assessment Tools (FISAT) Users Guide. FAO Compute-
rized Information. Series Fisheries 6. 126 pp.
292
Espinoza et al.
Rev. peru. biol. 17(3): 285 - 292 (Diciembre 2010)
GuzmnN.,S.Sa&L.Ortlieb.1998.Catlogodescriptivodelos
moluscos litorales (Gastropoda y Pelecypoda) de la zona
de Antofagasta, 23S (Chile). Estudios Oceanolgicos
17: 17-86
Hewitt D.A. & J.M. Hoenig. 2005. Comparison of two approaches
for estimating natural mortality based on longevity. Fishery
Bulletin US 103: 433437.
Lpez I., O. Aracena, A. Carmona, et al. 1997. Caracterizacin
bioeconmica de las pesqueras de huepo (Ensis macha)
ynavajuela(Tagelusdombeii)enlaVIIIregin.Informe
FinalProyectoFIP95-20A.ConvenioU.deConcepcin-
FEREPA Bio Bio, Chile. Fondo de Investigacin Pesquera,
Subsecretara de Pesca. Ministerio de Fomento, Economa
y Reconstruccin, Chile. 229 pp. <http://www.fip.cl/
FIP/Archivos/pdf/informes/IT%2095-20a.pdf> Acceso:
02/03/2010
Lomovasky B., T. Brey, E. Morriconi & J. Calvo. 2002. Growth and
production of the venerid bivalve Eurhomalea exalbida
in the Beagle Channel, Tierra del Fuego. Journal of Sea
Research48:209-216.
Mendo J. & R. Espinoza. 2008. Captulo 16: Pesquera y algunos
aspectosbiolgicosdelanavaja(Ensismacha)enPer.
En:A.GuerrayC.Lodeiros.Navajasylongueirones:bio-
loga, pesqueras y cultivo. Xunta de Galicia, Consellera
dePescaeAsuntosMartimos.Pp.359-378.
Paredes C., J.Tarazona, E. Canahuire, L. Romero & O. Cornejo.
1988.InvertebradosmacrobnticosdelreadePisco,Per.
En: H. Salzwedel y A. Landa, eds. Recursos y dinmica
delecosistemadeaforamientoperuano.BoletnInstituto
del Mar del Per, Callao, Volumen Extraordinario. Pp.
121-132.
PaulyD.&J.L.Munro.1984.Oncemoreongrowthcomparisonin
fshandinvertebrates.Fishbyte2:21.
Pauly D. & N. David. 1981. ELEFAN I, a basic program for the
objective extraction of growth parameters from length-
frequency data. Meeresforschung 28(4): 205-211.
PaulyD.1983.Algunosmtodossimplesparalaevaluacinderecur-
sospesquerostropicales.Fao,Doc.Tec.Pesca234.49pp.
RobinsonR.F.&C.A.RichardsonCA.1998.Thedirectandindirect
effects of suction dredging on a razor clam (Ensis arcuatus)
population.JournalofMarineScience55:970-977
Tarazona, J. & W. Arntz. 2001. The Peruvian Coastal Upwelling
System. En: Ecological Studies. Coastal Marine Ecosys-
temsofLatinAmerica.U.SeeligerandB.Kjerfve(eds).
Berln,p.229-244.
Tuck I.D., N. Bailey, M. Harding , G. Sangster, T. Howell, N. Gra-
ham&M.Breen.2000.Theimpactofwaterjetdredging
for razor clams, Ensis spp., in a shallow sandy subtidal
environment. Journal of Sea Research 43 (1): 65-81.
UniversidadAustral de Chile. 1998. Estudio biolgico pesquero
delosrecursosalmeja,navajuelayhuepoenlaVIIIyX
regiones. Proyecto FIP-IT/96-46. Informe Tcnico FIP.
Fondo de Investigacin Pesquera, Subsecretaria de Pesca,
Ministerio de Fomento, Economa y Reconstruccin, Chi-
le.<http://www.fp.cl/FIP/Archivos/pdf/informes/IT%20
96-46.pdf>Acceso:02/03/2010.
Urban H.J. & B. Campos B. 1994. Population Dynamics of the
bivalves Gari solida, Semele solda and Protothaca thaca
populationfromasmallbayinChileat36S.Mar.Ecol.
Prog.Ser.115:93-102.
UrbanH.J.&C.Tesch.1996.Aspectsofthepopulationdynamics
of six bivalve species from Southern Chile. Results of
the Victor Hensen Cruise to the Magellan Strait and the
BeagleChannelinOctober/November1994.Arch.Fish.
Mar. Res. 44: 243-256.
UrbanH.J.&J.Tarazona.1996.EffectsofElNio/SouthernOscilla-
tion on the population dynamics of a Gari solida population
(Bivalvia: Psammobiidae) from Baha Independencia,
Per.Mar.Biol.125:725-734.
UrbanH.J.1996.PopulationdynamicsofthebivalvesVenusantiqua,
Tagelus dombeii, and Ensis macha from Chile at 36S. J.
ShellfshResearch15:719-727.
293

Varamientos y captura incidental de tortugas marinas en Tumbes
Rev. peru. biol. 17(3): 293 - 301 (December 2010)
Rev. peru. biol. 17(3): 293 - 301 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Varamientos y captura incidental de tortugas marinas en el litoral
de Tumbes, Per
Carlos A. Rosales
1
, Manuel Vera
1
y Jorge Llanos
2
Stranding and incidental catch of sea turtles in the coastal Tumbes, Peru
1 IMARPE, Instituto del Mar del
Per Sede Tumbes, Calle Jos
Olaya S/N, C.P. Nueva Esperanza,
Zorritos, Ctralm. Villar, Tumbes.
2 IMARPE, Instituto del Mar del
Per Sede Lambayeque. Calle
Los Pinos S/N, Santa Rosa, Chi-
clayo, Lambayeque.
Email Carlos Rosales:
carlo209hot@hotmail.com
Presentado: 22/03/2010
Aceptado: 24/09/2010
Publicado online: 00/11/2010
Resumen
Entre agosto de 2007 y agosto de 2009 se registraron varamientos y capturas incidentales de cuatro especies
de tortugas marinas (Chelonia mydas, Lepidochelys olivacea, Dermochelys coriacea y Eretmochelys imbricata)
en la Regin Tumbes, norte del Per. Estos registros (52,6% de varamientos y 47,4% de capturas incidentales)
ocurrieron todo el ao, principalmente en Punta Picos (50,5%), Canoas (20,0%) y Baja de Punta Mero (14,7%).
Las especies ms abundantes fueron C. mydas (64,2%) y L. olivacea (30,5%), cuyas tallas no presentaron
diferencias signifcativas entre zonas ni entre pocas climticas. El mayor porcentaje de ejemplares de C.
mydas, L. olivacea y D. coriacea se consideraron sub-adultos, incluyendo el nico ejemplar de E. imbricata.
Todas las capturas incidentales fueron realizadas con redes de enmalle de diferentes tamaos de malla, pero
la de mayor frecuencia fue de 8 pulgadas. El alto porcentaje de ejemplares encontrados muertos con signos
de ahogamiento (22,2%) se debi al prolongado tiempo de calado (aproximadamente 12 horas). No se encon-
traron diferencias signifcativas de CPUE entre pocas climticas y no fue evidente ningn patrn estacional.
El 14% de ejemplares varados presentaron lesiones causadas posiblemente por ataques humanos o por co-
lisin con embarcaciones pesqueras. El 77,8% de ejemplares capturados incidentalmente fueron sacrifcados
para la comercializacin de su carne, y en algunas ocasiones de su caparazn, lo que evidenci la falta de
conciencia conservacionista. Estas observaciones indican que el litoral de Tumbes es una importante zona de
forrajeo y desarrollo de ejemplares sub-adultos de tortugas marinas, por lo que recomendamos el desarrollo
de programas de monitoreo, concienciacin y de proteccin de zonas crticas para lograr la conservacin de
estos organismos en el Pacfco Oriental.
Palabras clave: Tortuga verde, Tortuga olivcea, Tortuga dorso de cuero, Tortuga carey, Pacfco Oriental Tropical.
Abstract
Strandings and incidental catches of four sea turtles species (Chelonia mydas, Lepidochelys olivacea, Dermo-
chelys coriacea and Eretmochelys imbricata) were registered in Tumbes Region since August 2007 to August
2009. These registers (52.6% of strandings and 47.4% of incidental catches) occurred during all year; most
frequently in Punta Picos (50.5%), Canoas (20.0%) and Baja de Punta Mero (14.7%). The most registered
species were C. mydas (64.2%) and L. olivacea (30.5%); their sizes did not present signifcant differences
between areas and climatic seasons. The higher percentage of C. mydas, L. olivacea and D. coriacea were
considered sub-adults, including the only specimen of E. imbricata. The incidental catches were made with
gillnets of different mesh sizes, but 8 inches mesh was most frequently. A high proportions of specimens were
died with signs of drowning (22.2%) this was due to the prolonged time of soak time of gillnet (approximately 12
hours). No signifcant differences in CPUE were found between climatic seasons and no seasonal pattern was
evident. Lesions in 14% of stranded specimens were caused possibly by human attacks or by collisions with
fshing boats. 77.8% of incidental catch specimens were sacrifced for the commercialization of his meat, and
sometimes of his shell, this shows the lack of awareness of conservation. These observations indicate that the
coast of Tumbes is an important foraging area and development of sub-adult specimens of sea turtles; so it is
recomend to develop monitoring, awareness and critical areas protection programs to foment the conservation
of these organisms in the Eastern Pacifc.
Keywords: Green sea turtle, Olive Ridley, Leatherback turtle, Hawksbill turtle, Tropical Eastern Pacifc.
Introduccin
En la actualidad, las siete especies de tortugas marinas existen-
tes se encuentran en la Lista Roja de Animales Amenazados de
la IUCN (2010). De estas especies, cinco usan el mar peruano
en sus movimientos migratorios, como reas de forrajeo y po-
siblemente como hbitat de desarrollo de individuos jvenes, y
son: la tortuga lad o tortuga dorso de cuero Dermochelys coria-
cea (Vandelli, 1761), tortuga verde Chelonia mydas (Linnaeus,
1758), tortuga golfna o tortuga pico de loro Lepidochelys oli-
vacea (Eschscholtz, 1829), tortuga carey Eretmochelys imbricata
(Linnaeus, 1766) y tortuga cabezona Caretta caretta (Linnaeus,
1758) (Hays-Brown & Brown 1982).
Por su ecologa y hbitos alimenticios, las tortugas marinas
interactan frecuentemente con diversos artes de pesca lo que
da lugar a capturas incidentales (Lezama et al. 2003), eventos
reconocidos como factores de alta mortalidad para estos orga-
nismos (Oravetz 2000). Varios tipos de artes o aparejos de pesca
son fuentes importantes de daos y mortalidad (redes de arrastre,
redes agalleras, palangres pelgicos y de fondo), a esto se suma
la mortalidad causada por los desechos de artes de pesca tirados
al mar (National Research Council 1990, Oravetz 2000). Por
la naturaleza no selectiva de las redes agalleras (de enmalle), es
probable que las tortugas marinas sean capturadas tanto en los
hbitats pelgicos como en los costeros (Oravetz 2000). Frazier
y Montero (1990), estiman que en Chile, la mortalidad de
tortugas marinas enmalladas en las redes agalleras es del 80%;
adems, Eckert y Sarti (1997) consideran que el uso comercial
de redes agalleras en Chile y Per ha contribuido al colapso de
la poblacin de tortuga dorso de cuero del Pacfco.
La pesca artesanal es una actividad de captura que emplea
tcnicas simples con un alto componente de trabajo manual
(Crossa et al. 1991). En la regin Tumbes, la pesquera artesanal
utiliza modalidades de pesca esttica, como las redes de enmalle,
con tamaos de malla que varan de 2 a 12 pulgadas; estas
294
Rosales et al.
Rev. peru. biol. 17(3): 293 - 301 (Diciembre 2010)
redes se colocan en zonas costeras, donde las tortugas marinas
forrajean, en estas condiciones suceden las capturas incidentales.
Algunos individuos mueren ahogados y otros son capturados
vivos, y debido a la falta de conciencia conservacionista de los
pescadores, son sacrifcados para la comercializacin de su carne
y caparazn. Adems, se registran frecuentes varamientos de
tortugas marinas en las playas.
En el presente trabajo se informa sobre la ocurrencia de
capturas incidentales de tortugas marinas causadas por las ac-
tividades de pesca y de los varamientos observados en el litoral
del Tumbes, Per. Se espera que esta informacin contribuya
en planes de manejo y conservacin que mitiguen el impacto
ocasionado sobre las tortugas marinas.
Material y mtodos
rea de estudio.- La zona de estudio comprende el lito-
ral de Tumbes, Per; entre las playas Barrio El 19, La Cruz
(3389,5S 80362,48W), y Punta Sal Chico (35721,3S
805745,72W), desde la lnea de costa hasta una distancia
aproximada de 500 m (Fig. 1). A lo largo de esta zona, de aproxi-
madamente 58 km de extensin, se encuentran las localidades
de Zorritos, Acapulco, Punta Mero y Cancas, caracterizadas
por presentar numerosas quebradas que permanecen activas
en pocas de lluvia y secas el resto del ao, adems de algunas
playas amplias, muchas playas pequeas con sus respectivas
puntas, y algunas playas intercaladas con peas sumergidas en la
zona submareal (Ordinola et al. 2010). Las playas amplias en su
mayora son de suave pendiente, con escasa vegetacin, de fcil
acceso desde el mar, y con caladeros visitados frecuentemente
por pescadores artesanales de toda la regin. La temperatura
superfcial del mar (TSM) vara de 25,4 a 30,4 C, y la salinidad
entre 29,1 y 34,0 ups (Montero et al. 2010).
Colecta de informacin y muestreos.- Los datos sobre
varamientos y capturas incidentales de tortugas marinas fueron
recolectados en los recorridos de playas y exploraciones, entre
agosto de 2006 a noviembre de 2007 y en julio, septiembre y
octubre de 2008 y agosto de 2009.
En Punta Picos, un observador de campo registr los datos
de captura (nmero de ejemplares) y esfuerzo pesquero (nmero
de redes), por observacin directa, por entrevista y dilogo con
los pescadores.
Los ejemplares encontrados fueron identifcados de acuerdo
a Pritchard y Mortimer (2000) y Wyneken (2001) y medidos en
su largo curvo del caparazn (LCC) y ancho curvo del caparazn
(ACC), con una cinta mtrica fexible (graduada en mm). El
largo curvo del caparazn registrado en las tortugas de caparazn
duro fue el nucal-supracaudal (LCCn-s). Cuando los ejemplares
se encontraron intactos o con signos de descomposicin inicial,
se registr el largo post-cloacal (Bolten 2000). Adems, se reali-
zaron observaciones detalladas de los ejemplares para encontrar
marcas de identifcacin y posibles causas de mortalidad.
Anlisis de datos.- Los datos de LCC permitieron determinar
el porcentaje de los estados de madurez aparente (jvenes, sub-
adultos y adultos), considerando la talla promedio de hembras
anidantes de acuerdo a Steyermark et al. (1996) para D. coriacea
(128 cm LCC), Zrate et al. (2007) para C. mydas (84 cm LCC),
Barrientos y Ramrez (2008) para L. olivacea (65 cm LCC), y
Miller (1997) para E. imbricata (79 cm LCC).
Los valores de LCC de varamientos y capturas incidentales
de las especies ms abundantes se compararon entre zonas
y entre pocas climticas con la prueba no paramtrica de
Kruskal-Wallis.
Con los datos de capturas incidentales de Punta Picos y Bo-
nanza, se calcul la captura por unidad de esfuerzo:
CPUE= nmero de tortugas registradas / nmero de redes utilizadas
Figura 1. Ubicacin de la zona de estudio (lnea punteada), en el litoral de Tumbes, entre agosto de 2007 y agosto de 2009.
Tumbes
Per
81,0W 80,5W 80,0W
4,0S
3,5S
Pto. Pizarro
La Cruz
Zorritos
Punta Picos
Punta Mero
Canoas
Punta Sal Chico
E
c
u
a
d
o
r
Piura
Tumbes
0 10
millas nuticas
295

Varamientos y captura incidental de tortugas marinas en Tumbes
Rev. peru. biol. 17(3): 293 - 301 (December 2010)
Los datos de CPUE no se ajustaron a una distribucin nor-
mal (prueba de Kolmogorov-Smirnov: D= 0,462; p= 0), pero
tuvieron igualdad de varianzas (prueba de Levene, W= 0,275;
p> 0,05), por lo que se realiz el anlisis de varianza (ANOVA)
para comparar los valores de CPUE entre pocas climticas, en el
supuesto de que la falta de normalidad no induce necesariamente
a rechazar una hiptesis nula cuando existe homogeneidad de
varianzas (Underwood 1997).
Resultados
En la Regin Tumbes, desde agosto de 2006 hasta agosto de
2009 se registraron 95 ejemplares de cuatro especies de tortugas
marinas, C. mydas (64,2%), L. olivacea (30,5%), D. coriacea
(4,2%) y E. imbricata (1,1%); correspondiendo el 52,6% a
varamientos y el 47,4 % a capturas incidentales (Fig. 2).
Los mayores registros ocurrieron en la primavera de 2006 y
verano e invierno de 2007 (Fig. 3). Ambos eventos se registraron
principalmente en Punta Picos (50,5%), Canoas (20,0%) y Baja
de Punta Mero (14,7%) (Tabla 1).
El 98,4% de ejemplares de C. mydas se consideraron sub-
adultos (64,2 5,4 DS cm LCC; n= 60); el 24,1% de L. olivacea,
adultos (68,1 3,5 DS cm LCC; n= 7); el 100% de D. coria-
cea, sub-adultos (115,5 11,0 DS cm LCC; n= 4); y el nico
ejemplar de E. imbricata, sub-adulto (34,0 cm LCC) (Tabla 2).
Chelonia mydas y L. olivacea fueron las especies ms frecuen-
tes, y en Punta Picos, Canoas y Baja de Punta Mero (zonas en que
se registraron ms de dos ejemplares por especie), presentaron
promedios de LCC similares durante el estudio (Fig. 4), con un
amplio espectro de tamaos. Segn la prueba de Kruskal-Wallis,
las tallas de estas especies no presentaron diferencias signifcativas
entre zonas de varamientos y capturas incidentales (Tabla 3) ni
entre pocas climticas (Tabla 4).
Varamientos.- Se registraron 50 ejemplares varados: 28 de C.
mydas (56,0%), 19 de L. olivacea (38,0%) y tres de D. coriacea
(6,0%) (Fig. 2). De estos, dos ejemplares fueron avistados muer-
tos fotando cerca a la costa: uno de C. mydas (hembra, 59 cm
LCC), en Punta Sal, y otro de L. olivacea (sexo no determinado,
68 cm LCC), en Tres Puntas, los que no presentaron signos de
ataque por depredadores o por el hombre (laceraciones, heri-
das o marcas de redes). Adems, se registraron dos ejemplares
moribundos de C. mydas: uno en Nueva Esperanza (sexo no
determinado, 62 cm LCC), que no present signos de ataques
28
19
3
33
10
1 1
61
29
4
1
0
10
20
30
40
50
60
70
C. mydas L. olivacea D. coriacea E. imbricata
N


e
j
e
m
p
l
a
r
e
s
Varamiento
Captura incidental
Total
Figura 2. Nmero de ejemplares registrados por especie de tortuga
marina en Tumbes, entre agosto de 2007 y agosto de 2009.
Zona
Varamiento Captura incidental Total
n % n % n %
La Cruz 3 6,0 - 0,0 3 3,1
Nueva Esperanza 2 4,0 - 0,0 2 2,1
Grau 1 2,0 - 0,0 1 1,1
Zorritos 2 4,0 - 0,0 2 2,1
Contralmirante Villar 1 2,0 - 0,0 1 1,1
Bonanza - 0,0 2 4,4 2 2,1
Punta Picos 5 10,0 43 95,6 48 50,5
Punta Mero 2 4,0 - 0,0 2 2,1
Baja de Punta Mero 14 28,0 - 0,0 14 14,7
Canoas 19 38,0 - 0,0 19 20,0
Punta Sal 1 2,0 - 0,0 1 1,1
Total 50 100,0 45 100,0 95 100,0
Tabla 1. Nmero de ejemplares registrados por evento y zonas de muestreo en Tumbes, entre agosto de 2007 y agosto de 2009.
0
5
10
15
20
25
30
Inv. Pri. Ver. Oto. Inv. Pri. Inv. Pri. Inv.
2006 2007 2008 2009
N


e
j
e
m
p
l
a
r
e
s
Estaciones del ao
Varamiento
Captura incidental
Total
Figura 3. Nmero de ejemplares registrados por evento y estaciones
del ao en Tumbes, entre agosto de 2007 y agosto de 2009.
296
Rosales et al.
Rev. peru. biol. 17(3): 293 - 301 (Diciembre 2010)
o colisin, y otro en Caleta Grau (sexo no determinado, 66 cm
LCC), que present el crneo lesionado y la parte posterior del
caparazn quebrada. Asimismo, slo tres ejemplares varados de
L. olivacea presentaron lesiones en el crneo, plastrn y extremi-
dades, que as como el caso anterior habran sido causadas por
ataques humanos o por colisin con embarcaciones pesqueras.
La mayor cantidad de varamientos ocurrieron en verano e
invierno de 2007 (Fig. 3) y se registraron principalmente en
Canoas (38,0%) y Baja de Punta Mero (28,0%) (Tabla 1). Todos
los ejemplares de C. mydas se consideraron sub-adultos (65,0
4,7 DS cm LCC; n= 28); el 21,1% de L. olivacea, adultos (66,8
2,1 DS cm LCC; n= 4); y todos los ejemplares de D. coriacea,
sub-adultos (113,7 12,7 DS cm LCC; n= 3) (Tabla 5).
El 36,0% de ejemplares varados (uno moribundo y 17 muer-
tos) fueron sacrifcados para la comercializacin de su carne, y en
algunas ocasiones de su caparazn (Tabla 6). El 44,0% se registr
muerto y sin signos de descuartizamiento, encontrndose entre
ellos los tres ejemplares de D. coriacea.
Capturas incidentales.- Fueron capturados incidentalmente
45 ejemplares de cuatro especies: C. mydas (73,3%), L. olivacea
(22,2%), D. coriacea (2,2%) y E. imbricata (2,2%) (Fig. 2). Estos
eventos slo fueron registrados en Punta Picos (43 ejemplares) y
Bonanza (dos ejemplares) (Tabla 1), y ocurrieron principalmente
en la primavera de 2006 (Fig. 3), los que se registraron en 40 fae-
nas de pesca (38 en Punta Picos y dos en Bonanza), con promedio
de 1,15 0,36 DS ejemplar/faena. Los ejemplares registrados
en Punta Picos correspondieron a C. mydas (31 ejemplares), L.
olivacea (10 ejemplares), D. coriacea (un ejemplar) y E. imbricata
(un ejemplar); mientras que los dos de Bonanza, a C. mydas. De
Especie EMA n Mn Mx Prom DS
Chelonia mydas
Sub-adulto 60 53 81 64,2 5,4
Adulto 1 90
Total 61 53 90 64,7 6,3
Dermochelys coriacea
Sub-adulto 4 99 122 115,5 11,0
Total 4 99 122 115,5 11,0
Eretmochelys imbricata
Sub-adulto 1 34
Total 1 34
Lepidochelys olivacea
Sub-adulto 22 48 63,5 59,9 3,5
Adulto 7 65 75 68,1 3,5
Total 29 48 75 61,9 4,9
Tabla 2. Estadsticos de tallas (largo curvo del caparazn, LCC,
cm) de las especies de tortugas marinas por estados de madurez
aparente (EMA) en Tumbes, entre agosto de 2007 y agosto de 2009.
Especie Zona n Prom. DS Rango Rango promedio p-valor
Chelonia mydas
Punta Picos 34 64,7 7,3 53 90 24,81
Canoas 13 66,1 5,3 61 79 27,92
Baja de Punta Mero 4 66,5 4,9 62 73 29,88
Total 51 0,700*
Lepidochelys olivacea
Punta Picos 11 61,7 7,0 48 75 14,05
Canoas 5 60,7 2,9 58 65 12,10
Baja de Punta Mero 10 61,3 2,5 57 65 13,60
Total 26 0,893*
Tabla 3. Prueba de Kruskal-Wallis para comparar el LCC (largo curvo del caparazn, cm) de las especies ms abundantes entre zonas de
registro, con el promedio y rango de tallas, en Tumbes, entre agosto de 2007 y agosto de 2009.
n: tamao de la muestra; Prom.: promedio; DS: desviacin estndar; * no signifcativo.
0
10
20
30
40
50
60
70
80
90
100
C. mydas L. olivacea
L
C
C

(
c
m
)
Punta Picos Baja Punta Mero Canoas
Figura 4. Promedio de longitud curva del caparazn (LCC, cm), y
desviacin estndar, de las principales especies de tortugas marinas
capturadas en Tumbes, entre agosto de 2007 y agosto de 2009.
0,0
0,2
0,4
0,6
0,8
1,0
1,2
Inv Pri Ver Oto Inv Pri Inv
C
P
U
E

(
e
j
e
m
p
l
a
r
/
r
e
d
)
Estaciones del ao
2006 2007 2008
Figura 5. Valores promedio de CPUE, y desviacin estndar, por es-
taciones del ao en Tumbes, entre agosto de 2007 y agosto de 2009.
n: nmero de ejemplares; Mn.: LCC mnima; Mx.: LCC mxima; Prom: pro-
medio, DS: desviacin estndar.
297

Varamientos y captura incidental de tortugas marinas en Tumbes
Rev. peru. biol. 17(3): 293 - 301 (December 2010)
La CPUE promedio fue de 0,61 0,22 DS ejemplar/red,
con rango entre 0,25 y 1,00 ejemplar/red. Las mayores CPUE
se registraron en invierno de 2006 y verano de 2007, cada uno
con 0,70 0,27 DS ejemplar/red (Fig. 5). El ANOVA (Tabla
8) no revel diferencias estadsticamente signifcativas de CPUE
entre las pocas climticas (F= 0,001; p> 0,05).
El 77,8% de ejemplares capturados incidentalmente fue
sacrifcado en playa para la comercializacin de su carne, y
en algunas ocasiones de su caparazn (Tabla 6). Los dems
ejemplares capturados fueron hallados muertos (con signos de
ahogamiento) y se mantuvieron intactos, encontrndose entre
ellos el nico ejemplar de E. imbricata.
Discusin
La informacin registrada en el presente trabajo no se recolec-
t sistemticamente en tiempo y espacio, debido a la limitacin
de recursos humanos y econmicos. Sin embargo, sirvi de base
para conocer la situacin actual de las tortugas marinas en la
Regin Tumbes, as como para efectuar conclusiones prelimi-
nares que permitan iniciar futuras investigaciones orientadas a
la conservacin de estas especies.
Las poblaciones de tortugas marinas se encuentran amena-
zadas a nivel mundial. En la actualidad, la Unin Internacional
para la Conservacin de la Naturaleza (UICN) categoriza a
D. coriacea y a E. imbricata como especies en peligro crtico, a
C. mydas como especie en peligro y a L. olivacea como especie
vulnerable, pues sus tendencias poblacionales estn en descenso
debido principalmente a la explotacin selectiva (recoleccin de
huevos y captura de adultos), la captura incidental en la pesca, la
Especie poca climtica n Prom. DS Rango Rango promedio p-valor
Chelonia mydas
Lluviosa 20 66,2 7,3 56-90 35,35
Seca 41 63,9 5,7 53-81 28,88
Total 61 0,180*
Lepidochelys olivacea
Lluviosa 21 60,9 4,4 48-68 13,93
Seca 8 64,3 5,8 58-75 17,81
Total 29 0,271*
Tabla 4. Prueba de Kruskal-Wallis para comparar el LCC (largo curvo del caparazn, cm) de las especies ms abundantes entre pocas
climticas, con el promedio y rango de tallas, en Tumbes, entre agosto de 2007 y agosto de 2009.
n: tamao de la muestra; Prom.: promedio; DS: desviacin estndar; * no signifcativo.
Especie EMA n Mn Mx Prom DS
Chelonia mydas
Sub-adulto 28 57 79 65,0 4,7
Total 28 57 79 65,0 4,7
Dermochelys coriacea
Sub-adulto 3 99 122 113,7 12,7
Total 3 99 122 113,7 12,7
Lepidochelys olivacea
Sub-adulto 15 57 63.5 60,5 2,1
Adulto 4 65 69 66,8 2,1
Total 19 57 69 61,8 3,3
Tabla 5. Estadsticos de tallas (LCC, largo curvo del caparazn, cm)
de las especies de tortugas marinas varadas por estados de madurez
aparente (EMA) en Tumbes, entre agosto de 2007 y agosto de 2009.
n: tamao de la muestra; Prom.: promedio; DS: desviacin estndar.
Evento Condicin anatmica C, mydas D, coriacea E, imbricata L, olivacea Total %
V
a
r
a
m
i
e
n
t
o
Moribundo con crneo lesionado 1 1 2,0
Moribundo sacrifcado 1 1 2,0
Muerto con caparazn quebrado 1 1 2,0
Muerto con crneo lesionado 1 1 2,0
Muerto con crneo roto 1 1 2,0
Muerto fotando 1 1 2 4,0
Muerto intacto 14 3 5 22 44,0
Muerto con plastrn perforado 1 1 2,0
Muerto sacrifcado 7 10 17 34,0
Muerto sin patas posteriores 2 2 4,0
Sin cabeza 1 1 2,0
Total 28 3 19 50 100,0
C
a
p
t
u
r
a

i
n
c
i
d
e
n
t
a
l
Muerto intacto 8 1 1 10 22,2
Muerto sacrifcado 17 1 5 23 51,1
Vivo sacrifcado 8 4 12 26,7
Total 33 1 1 10 45 100,0
Tabla 6. Nmero de ejemplares registrados por evento y condicin observada en Tumbes, entre agosto de 2007 y agosto de 2009.
estos, 38 ejemplares fueron sacrifcados para aprovechar su carne
o comercializar su caparazn: 30 de C. mydas (28 en Punta Picos
y dos en Bonanza) y 8 de L. olivacea (todos en Punta Picos). De
los ejemplares de C. mydas capturados en Punta Picos, nueve se
recuperaron muertos.
El 97% de ejemplares de C. mydas se consideraron sub-adultos
(63,6 6,0 DS cm LCC; n= 32); el 30% de L. olivacea, adultos
(69,8 4,6 DS cm LCC; n= 3); y los nicos ejemplares de D.
coriacea (121,0 cm LCC) y E. imbricata (34,0 cm LCC), sub-
adultos (Tabla 7).
Durante el perodo de estudio, todas las capturas incidentales
de tortugas marinas fueron realizadas con redes de enmalle de
diferentes tamaos de malla (2 a 12 pulgadas), aunque ma-
yormente de 8 pulgadas, que tienen como objetivo la captura
de langosta verde Panulirus gracilis y algunas especies de rayas
y mantas.
298
Rosales et al.
Rev. peru. biol. 17(3): 293 - 301 (Diciembre 2010)
degradacin de las playas de anidamiento y las enfermedades y
depredacin (IUCN 2010), adems de la utilizacin de algunos
sub-productos, como la concha de carey en artesanas (Dueas
et al. 2000).
En la Regin Tumbes, de acuerdo a los pescadores locales, los
varamientos de tortugas marinas parecen ser un fenmeno muy
comn (Kelez et al. 2003). Al respecto, en el presente trabajo
el 52,6% de los ejemplares registrados correspondieron a este
evento, la mayora de los cuales ocurrieron en verano e invierno
de 2007, principalmente en Canoas y Baja de Punta Mero. Las
especies con mayores varamientos fueron C. mydas y L. olivacea,
caracterizadas por presentar hbitos costeros (Hays-Brown &
Brown 1982). Eretmochelys imbricata no registr varamientos,
posiblemente porque no interactu con la pesquera costera,
ya que sta presenta hbitos ocenicos (Hays-Brown & Brown
1982).
Una de las causas del declive de las poblaciones de tortugas
marinas es la interaccin con actividades pesqueras, dado que
stas son incidentalmente capturadas en casi todos los artes
y aparejos pesqueros como arrastre, cortina, espinel y cerco
(Renaud et al. 1997, Silvani et al. 1999, Lewison et al. 2004).
Segn De Paz et al. (2004), entre julio de 1999 y junio de 2000,
la especie ms capturada con redes cortina en el rea de Pisco,
Paracas, fue C. mydas (67,8%), seguida de L. olivacea (27,7%) y
D. coriacea (2,9%). Adems, De Paz et al. (2007), indicaron que
en la misma rea, en el verano de 2005, el 78,3% de ejemplares
correspondi a C. mydas; el 16,5%, a L. olivacea y el 5,2%, a D.
coriacea. Estas observaciones concuerdan con lo registrado en
la presente investigacin, excepto que aqu se registr adems
un ejemplar de E. imbricata (2,2%). Asimismo, Kelez et al.
(2008) sealan que, entre enero de 2003 y marzo de 2008, C.
Especie EMA n Mn Mx Prom DS
Chelonia mydas
Sub-adulto 32 53 81 63,6 6,0
Adulto 1 90 -
Total 33 53 90 64,4 7,5
Dermochelys coriacea
Sub-adulto 1 121 -
Total 1 121 -
Eretmochelys imbricata
Sub-adulto 1 34 -
Total 1 34 -
Lepidochelys olivacea
Sub-adulto 7 48 63 58,5 5,3
Adulto 3 66 75 69,8 4,6
Total 10 48 75 61,9 7,3
Tabla 7. Estadsticos de tallas (largo curvo del caparazn, LCC, cm)
de las especies de tortugas marinas capturadas incidentalmente por
estados de madurez aparente (EMA) en Tumbes, entre agosto de
2007 y agosto de 2009.
Fuente de variacin
Suma de
cuadrados
GL
Media
cuadrtica
F p-valor
Entre grupos 0,000 1 0,000 0,001 0,979*
Dentro de los grupos 1,861 38 0,049
Total 1,861 39
Tabla 8. Anlisis de varianza de una va (ANOVA) para comparar los
valores de CPUE entre pocas climticas en Tumbes entre agosto
de 2007 y agosto de 2009.
n: tamao de la muestra; Prom.: promedio; DS: desviacin estndar.
GL: grados de libertad; * no signifcativo.
mydas fue la especie ms capturada por espineles pelgicos en
Per (52%), seguida de C. caretta (26%), L. olivacea (20%) y D.
coriacea (2%). Del mismo modo, Cceres et al. (2008), afrman
que C. mydas fue la especie ms observada y capturada durante
las actividades de pesca en la Baha de Sechura, Piura, durante
noviembre de 2007 a julio de 2008.
En la zona de Punta Picos, Acapulco, se registr la mayor
cantidad de ejemplares de tortugas capturadas incidentalmente,
debido a que en este lugar, y durante el periodo de estudio, un
observador de campo de IMARPE Sede Tumbes registr los
desembarques realizados por los pescadores balsilleros. En
esta zona se realizan actividades de pesca netamente costeras y
artesanales, dedicndose a ellas aproximadamente 20 pescadores
(nmero que vara dependiendo de la disponibilidad y abun-
dancia de recursos en las diferentes pocas del ao), utilizando
balsillas de palo topa equipadas con una o dos redes cortina
de 2 a 12 pulgadas de tamao de malla para la captura de
langosta verde Panulirus gracilis, raya coluda Dasyatis longus, y
especies netamente costeras como chita Anisotremus sacapularis,
y corvina cherela Cynoscion phoxocephalus. Las redes se tienden
al atardecer, aproximadamente a las 17:00 h, y se recogen al da
siguiente, aproximadamente a las 06:00 h.
Durante el presente estudio se constat que la captura inci-
dental de tortugas marinas con redes de enmalle es un problema
muy frecuente en la zona de estudio, lo que coincide con lo
encontrado por Lezama et al. (2003) para la costa uruguaya. Las
capturas incidentales de C. mydas ocurrieron en zonas rocosas
poco profundas. La captura de un slo ejemplar de D. coriacea y
otro de E. imbricata, y el no registro de ejemplares de C. caretta,
probablemente se deba a que estas especies presentan hbitos de
vida no tan costeros como los de las dems especies de tortuga,
sino mas bien ocenicos (Hays-Brown & Brown 1982, Lezama
et al. 2003). Adems, el 73,3% de ejemplares capturados se
registraron muertos y con signos de ahogamiento, debido al
tiempo de reposo prolongado que los pescadores dan a sus redes.
A pesar que los promedios de la CPUE fueron mayores en
invierno de 2006 y verano de 2007, cada uno con 0,70 0,27 DS
ejemplar/red, este parmetro tuvo niveles similares de variacin
entre pocas climticas. Esto indicara que el ecosistema marino
de la Regin Tumbes posee caractersticas ambientales estables
en todo el ao. De esta manera, es probable que los cambios en
algunas caractersticas fsico-qumicas de la columna de agua, en
especial de los aportes fuviales en la poca de verano, no tengan
ningn efecto en la dinmica de las poblaciones de tortugas
marinas y los valores de CPUE.
En Bonanza slo se registraron dos ejemplares de tortugas
marinas, lo que impidi que los valores de CPUE (ejemplar/
red) se compararan por zonas de pesca y pocas climticas. Sin
embargo, la CPUE promedio registrada entre esta zona y Punta
Picos (0,61 0,22 DS ejemplar/red) no difri de lo registrado
slo en Punta Picos (0,60 0,21 DS ejemplar/red), pues el
esfuerzo aplicado es el mismo en ambas zonas (en general uno
a dos paos por balsilla).
Para reducir la captura incidental de tortugas marinas en las
redes de enmalle, Oravetz (2000) manifesta que el calado de este
arte debe ser realizado en reas donde la presencia de tortugas sea
poco probable, adems de limitar la profundidad de calado, la
longitud de las redes, reducir el tiempo que permanecen caladas
299

Varamientos y captura incidental de tortugas marinas en Tumbes
Rev. peru. biol. 17(3): 293 - 301 (December 2010)
y en el que son revisadas, as como utilizar un tamao de red
que reduzca la probabilidad de capturarlas.
La captura incidental no es la nica forma de mortalidad.
La colisin entre las tortugas y las embarcaciones pesqueras de
mayor tamao (arrastreras y cerqueras), causa igual preocupa-
cin, pues algunos ejemplares varados presentaron lesiones de
fracturas en el crneo, caparazn, plastrn y extremidades (14%).
A pesar que en el el Per, mediante D.S. N 034-2004-AG
(Ministerio de Agricultura), se prohbe la captura dirigida y
comercializacin de productos derivados de tortugas marinas,
en la Regin Tumbes durante el periodo de estudio, se observ
el incumplimiento de esta norma, pues los pescadores artesanales
comercializaron la carne y el caparazn de casi todas las tortugas
marinas capturadas incidentalmente (77,8%). Asimismo se
observ la poca conciencia conservacionista de los pescadores,
pues las tortugas encontradas vivas al recoger el arte de pesca
(26,7%) fueron sacrifcadas para la comercializacin de su carne
y caparazn. Esta situacin, se agrava porque la captura, desem-
barque y comercializacin de tortugas marinas se realizaron en
playas alejadas de los desembarcaderos pesqueros artesanales,
donde no existe control de los desembarques.
En general, la carne de tortuga se destina principalmente a los
restaurantes de la zona, y en menor proporcin se comercializa
en los mercados locales de manera clandestina (observ. pers.).
A diferencia de algunas otras regiones del pas, como Pisco y
Paita, donde se realizan operativos inopinados para sancionar la
comercializacin de productos de tortuga marina, estas acciones
son escasas en la Regin Tumbes, observndose que en algunas
playas y zonas tursticas se comercializan caparazones de estos
ejemplares como artesanas y ornamentos. Esta realidad es co-
mn en varias partes del mundo tal como lo sealan Lpez et al.
(2001), en su estudio del comercio ilegal y formas de uso de las
tortugas marinas en Uruguay, quienes indican que algunos pes-
cadores procesan y venden los caparazones al turismo generando
as una fuente de ingreso alternativa; mientras que en otros casos
existe consumo de la carne, prctica ocasional que constituye
una fuente suplementaria de alimento para algunas familias.
Los elevados porcentajes de individuos sub-adultos de C.
mydas y L. olivacea, presentes en las capturas incidentales y va-
ramientos en la Regin Tumbes, son preocupantes debido a que
son considerados extremadamente valiosos para la recuperacin y
estabilidad de las poblaciones (Crouse et al. 1987). Sin embargo
nuestros valores fueron similares a los registrados en el verano
de 2005 por De Paz et al. (2007), en Pisco (100% sub-adultos
de C. mydas y 72,7% sub-adultos de L. olivacea). Por su parte,
De Paz et al. (2004), indican que, entre julio de 1999 y junio de
2000, en el rea de Pisco, existi alta presin de captura sobre
sub-adultos de C. mydas (78%) y adultos L. olivacea (83%).
Lezama et al. (2003), afrman que C. mydas se distribuye a
lo largo de toda la costa de Uruguay, pero, al igual que en este
trabajo, principalmente en regiones donde las algas son ms
abundantes como zonas rocosas e insulares. Al respecto, Lpez-
Mendilaharsu et al. (2003), sugieren que reas con estas caracte-
rsticas representan hbitats de desarrollo y alimentacin de C.
mydas. En estas condiciones, Lezama et al. (2003), recomiendan
que, a partir de estudios de dieta y seleccin de alimento, as
como de patrones migratorios, estas zonas sean reas prioritarias
para futuros esfuerzos de recuperacin de esta especie.
En cuanto a L. olivacea, los porcentajes de ejemplares adultos
sealados por De Paz et al. (2007), en Pisco (27,3%), y por Kelez
et al. (2009), en toda la costa peruana (33%), son similares a los
registrados en esta investigacin para la Regin Tumbes (24,1%).
Esto signifcara que L. olivacea es una especie comn en Per y
que posee un gran componente adulto en aguas costeras.
En nuestras observaciones el LCC promedio de C. mydas
(64,7 6,3 DS cm LCC; n= 61) y L. olivacea (61,9 4,9 DS
cm LCC; n= 29), fue ligeramente superior al registrado por De
Paz et al. (2004) (63,3 cm LCC en C. mydas y 60,9 cm LCC en
L. olivacea), lo que podra evidenciar un patrn de distribucin
latitudinal, incluso en los estados de madurez aparente.
La comparacin de LCC entre pocas climticas y zonas de
registro no revel diferencias signifcativas en las tallas; adems,
los ejemplares sub-adultos (inmaduros) de estas especies se
capturaron incidentalmente en porcentajes superiores al 70%,
valores que atentan contra la capacidad de mantenimiento y
regeneracin de las poblaciones. Por ello, se debe continuar el
monitoreo de este parmetro, toda vez que la captura constante
de estas especies, incidental o dirigida, puede impactar negati-
vamente en sus poblaciones.
Los registros de D. coriacea en esta investigacin (100% sub-
adultos), concuerdan con lo sealado por De Paz et al. (2004),
entre julio de 1999 y junio de 2000 en Pisco (100%), por De
Paz et al. (2007), en el verano de 2005 en la misma localidad
(100%), y por Quiones et al. (2009), en San Andrs, Paracas
(86,3%). Respecto a los tamaos de esta especie en la zona de
Paracas, Alfaro-Shigueto et al. (2007), mencionan que las tortu-
gas capturadas entre 2000 y 2003 fueron en promedio menores
(LCC media de 104,8 cm) que las registradas en 1982 (LCC
media de 135 cm), y entre 1985 y 1999 (LCC media de 135,7
cm), lo que puede deberse al reducido tamao de muestra, pero
tambin puede indicar que existen menos adultos grandes en la
poblacin debido a la mortalidad asociada con la disminucin
de la poblacin en los ltimos 20 aos. Al respecto, Reynolds y
Sadove (2000) en su investigacin realizada en Nueva York entre
1986 y 1996, encontraron que los ejemplares de C. mydas y D.
coriacea, capturados con redes cortina de fondo, no registraron
cambios signifcativos en sus tallas medias (LCC). Adems in-
dican que durante el verano, el Noreste de EEUU se convierte
en una importante rea de forrajeo de ejemplares sub-adultos y
adultos de estas especies.
Por lo tanto, de acuerdo a lo observado en esta investigacin
se puede afrmar que el litoral de Tumbes es una importante
zona de forrajeo y desarrollo de tortugas marinas, ya que stas
se registraron casi todos los meses del ao. Sin embargo, y de
acuerdo a las recomendaciones de Barnes et al. (2000), es nece-
sario realizar un trabajo ms completo para evaluar si la Regin
Tumbes corresponde a un hbitat importante, especialmente de
sub-adultos de C. mydas, L. olivacea y D. coriacea.
Recomendaciones
Que el litoral de Tumbes sea considerada como una impor-
tante zona de forrajeo y desarrollo de tortugas marinas, debido
a que estn presentes durante todo el ao.
Deben identifcarse las reas de forrajeo y desarrollo de las
tortugas marinas sub-adultas en nuestro litoral a fn de proteger-
las y reducir su captura incidental. Para ello se debe desarrollar
300
Rosales et al.
Rev. peru. biol. 17(3): 293 - 301 (Diciembre 2010)
un programa de monitoreo que permita evaluar las condiciones
poblacionales de las diferentes especies de tortugas marinas en la
regin y establecer el real impacto que las pesqueras ocasionan
en ellas.
Establecer normas que reduzcan la captura incidental de
tortugas marinas con redes de enmalle, limitar el tiempo de
calado o prohibir su uso en zonas con alta incidencia de tor-
tugas marinas. Estas estrategias deben ser congruentes con las
necesidades de recuperacin de los recursos y la satisfaccin de
las necesidades socioeconmicas de las comunidades de usuarios
que se benefcian de los mismos.
Establecer programas educativos y culturales para concienciar
el tema de conservacin de las tortugas marinas en esta parte
del Per.
Agradecimientos
A los pescadores de las playas de Villar, por su apoyo para el
registro de datos, al Sr. Gonzalo Meneses, por la informacin
brindada sobre ejemplares varados en Playa Canoas, a los Blgos.
Nelly de Paz y Percy Montero, por las recomendaciones y bi-
bliografa alcanzada, y al Blgo. Francis van Oordt, por su apoyo
en la revisin, crticas y recomendaciones en la elaboracin del
presente trabajo.
Literatura citada
Alfaro-Shigueto J., P.H. Dutton, M. van Bressem & J. Mangel. 2007.
Interactions between leatherback turtles and Peruvian
artisanal fsheries. Chelonian Conservation and Biology
6(1):129134.
Barnes D.M., H. Miller-Woodson, W.M.D. Webster, et al. 2000.
Sea turtles of the Cape Fear River basin (North Carolina,
U.S.A.): an important nursery area? In: F.A. Abreu-
Grobois, R. Briseo-Dueas, R. Mrquez, F. Silva and
L. Sarti, eds. Proceedings of the Eighteenth International
Sea Turtle Symposium. U.S. Dep. Commer. NOAA Tech.
Memo. NMFS-SEFSC-436. p: 161-163.
Barrientos K. & C. Ramrez. 2008. Estado actual de Lepidochelys
olivaceaenelValle,PacfcoChocoano,Colombia.In:S.
Kelez, F. van Oordt, N. de Paz and K. Forsberg, eds. Libro
de Resmenes. II Simposio de Tortugas Marinas en el
PacifcoSurOriental.p.17-21.<http://www.ecOceanica.
org/publicaciones> Acceso 13/05/2010.
Bolten A.B. 2000. Tcnicas para la medicin de tortugas marinas. In:
K.L.Eckert,K.A.Bjorndal,F.A.Abreu-GroboisandM.
Donnelly,eds.TcnicasdeInvestigacinyManejoparala
Conservacin de las Tortugas Marinas. 2000 (Traduccin
al espaol). IUCN/CSE Grupo Especialista en Tortugas
Marinas Publicacin N 4. p. 126-131.
Cceres C., J. Alfaro-Shigueto & J. Mangel. 2008. Estudio sobre la
mortalidad de la tortuga verde Chelonia mydas agassizii
enlaBahadeSechura,PiuraPer.In:S.Kelez,F.van
Oordt,N.dePazandK.Forsberg,eds.LibrodeResme-
nes. II Simposio de tortugas marinas en el Pacfco Sur
Oriental. p. 61. <http://www.ecOceanica.org/publicacio-
nes> Acceso 13/05/2010.
CrouseD.T.,L.B.Crowder&H.Caswell.1987.Astage-basedpo-
pulation model for loggerhead sea turtles and implications
for conservation. Ecology. 68(5):1412-1423.
CrossaM.,R.Pereiro,J.Pinieiro,etal.1991.Anlisisdelaspes-
queras artesanales del Uruguay. Centro Cooperativista
Uruguayo. Sistema de Programas de Pesca Artesanal.
Montevideo. 236 pp.
De Paz N., J.C. Reyes & M. Echegaray. 2004. Capture and trade of
marine turtles at San Andres, southern Peru. In: M.S. Coyne
and R.D. Clark, eds. Procedings of the Twenty-First Annual
Symposium on Sea Turtle Biology and Conservation. NOAA
Technical Memorandum NMFS-SEFSC-528. p. 52-54.
DePazN.,J.C.Reyes,M.Echegaray,etal.2007.Identifcaciny
manejodehbitatscrticosdetortugasmarinasenPer:
Paracas, estudio de caso. In: C. Guerra-Correa, A. Falla-
brino, P. Bolados-Daz and C. Turner, eds. VII Simposio
Sobre Medio Ambiente. Estado Actual y Perspectivas de
la Investigacin y Conservacin de las Tortugas Marinas
enlasCostasdelPacfcoSurOriental.Antofagasta,Chile.
p. 28. <http://www.uantof.cl/CREA/simpo%20tortugas.
pdf> Acceso 13/05/2010.
DueasC.,M.Vsquez&C.Hasbn.2000.Conservacindelas
tortugas marinas en El Salvador. Sinopsis y perspectivas.
In:F.A.Abreu-Grobois,R.Briseo-Dueas,R.Mrquez,
F. Silva and L. Sarti, eds. Proceedings of the Eighteenth
International Sea Turtle Symposium. U.S. Dep. Commer.
NOAA Tech. Memo. NMFS-SEFSC-436. p: 130-132.
Eckert S.A. & L. Sarti. 1997. Distant fsheries implicated in the
loss of the worlds largest leatherback nesting population.
Marine Turtle Newsletter 78:2-7.
FrazierJ.&J.L.B.Montero.1990.Incidentalcaptureofmarineturt-
lesbytheswordfshfsheryatSanAntonioChile.Marine
TurtleNewsletter49:8-13.
Hays-Brown C. & W.M. Brown. 1982. Status of sea turtles in
SoutheasternPacifc:EmphasisonPeru.In:K.A.Bjorndal,
ed. Biology and Conservation of Sea Turtles. Smithsonian
Press, Washington D.C. p. 235-240.
IUCN (International Union for Conservation of Nature). 2010. (en
lnea). IUCN Red List of Threatened Species. Version
2010.2. <www.iucnredlist.org> Acceso 23/07/2010.
Kelez S., X. Velez-Zuazo & C. Manrique. 2003. Current status of sea
turtles along the northern coast of Peru: preliminary results.
In: J.A. Seminoff, ed. Proceedings of the Twenty-Second
Annual Symposium on Sea Turtle Biology and Conserva-
tion. NOAA Technical Memorandum NMFS-SEFSC-503.
p. 264-265. <http://www.nmfs.noaa.gov/pr/pdfs/species/
turtlesymposium2002.pdf> Acceso 23/06/2010.
Kelez S., X. Velez-Zuazo, C. Manrique, et al. 2008. Captura inciden-
taldetortugasmarinasenlapescaconpalangreenPer.
In: S. Kelez, F. van Oordt, N. de Paz and K. Forsberg, eds.
LibrodeResmenes.IISimposiodetortugasmarinasenel
PacfcoSurOriental.p.59-61.<http://www.ecOceanica.
org/publicaciones> Acceso 13/05/2010.
Kelez S., X. Velez-Zuazo, F.Angulo & C. Manrique. 2009. (en
lnea). Olive ridley Lepidochelys olivacea nesting in Peru:
ThesouthernmostrecordsintheEasternPacifc.Marine
TurtleNewsletter126:5-9.<http://www.seaturtle.org/mtn/
archives/mtn126/mtn126p5.shtml> Acceso 05/04/2010.
Lewison R.L., S.A. Freeman & L.B. Crowder. 2004. Quantifying
theeffectsoffsheriesonthreatenedspecies:theimpact
of pelagic longlines on loggerhead and leatherback sea
turtles. Ecology Letters 7:221-231.
Lezama C., P. Miller, A. Fallabrino, et al. 2003. Captura incidental
de tortugas marinas por la fota pesquera artesanal en
Uruguay. C.I.D., Proyecto Karumb, Tortugas Marinas
del Uruguay. 4 pp.
Lpez M., A. Fallabrino, A. Estrades, et al. 2001. Comercio ilegal
y formas de uso de las tortugas marinas en Uruguay. Act.
VI Jorn. Zool. Uruguay. 50 pp.
Lpez-Mendilaharsu M., A. Fallabrino, A. Bauza, et al. 2003. Re-
view and conservation of sea turtles in Uruguay: foraging
habitats, distribution, causes of mortality, education and
regional integration. Preliminary Report 2001-2002 to BP
Conservation. 18 pp.
301

Varamientos y captura incidental de tortugas marinas en Tumbes
Rev. peru. biol. 17(3): 293 - 301 (December 2010)
MillerJ.D.1997.Reproductioninseaturtle.In:P.LLutzandJ.A.
Musick, eds. The Biology of Sea Turtles. CRC Marine
Science Series. Boca de Raton, FL: CRC Press. p. 5181.
Montero P., M. Vera & I. Gonzales. 2010. Condiciones meteorolgi-
casyoceanogrfcasenlaestacinfjaCaletaLaCruz,Re-
ginTumbes,2009.InformeAnual.Inst.MarPer.10pp.
NationalResearchCouncil.1990.Declineoftheseaturtles:causes
and prevention. National Academy Press, Washington
D.C.259pp.
Oravetz C.A. 2000. Reduccin de la captura incidental en pesqueras.
In:K.L.Eckert,K.A.Bjorndal,F.A.Abreu-Groboisand
M. Donnelly, eds. Tcnicas de investigacin y manejo
para la conservacin de las tortugas marinas. IUCN/CSE
Grupo Especialista en Tortugas Marinas Publicacin N
4(Traduccinalespaol).p.217-222.
Ordinola E., E. Lpez, I. Gonzales, et al. 2010. Identifcacin y
delimitacin de bancos naturales de invertebrados ma-
rinos, zonas de pesca artesanal y reas propuestas para
maricultura en el litoral de la Regin Tumbes. Inf. Interno
Inst.MarPer.83pp.<http://www.imarpe.gob.pe/tumbes/
noticias/Ident_delimit_B_N_Z_12-04-2010.pdf> Acceso
09/12/2010.
Pritchard P.C.H. & J.A. Mortimer. 2000. Taxonoma, morfologa
externa e identifcacin de las especies. In: K.L Eckert,
K.A.Bjorndal,F.A.Abreu-GroboisandM.Donnelly,eds.
TcnicasdeInvestigacinyManejoparalaConservacin
de las Tortugas Marinas. 2000 (Traduccin al espaol).
IUCN/CSE Grupo Especialista en Tortugas Marinas Pu-
blicacin N 4. p. 23-41.
Quiones J., J. Zeballos, S. Quispe & J.Alfaro-Shigueto. 2009.
Captura incidental de la tortuga dorso de cuero (Dermo-
chelyscoriacea)duranteelfenmenoElNio1987enSan
Andrs,Per:posiblescausaseimplicaciones.Memoria
del III Simposio Regional sobre Tortugas Marinas del Pa-
cfcoSurOriental.UniversidaddeSantaElena,Ecuador.
RenaudM.L.,J.M.Nance,E.Scott-Denton&G.R.Gitschlag.1997.
Incidental capture of sea turtles in shrimp trawls with and
without TEDs in U.S. Atlantic and Gulf Waters. Chelonian
Conservation and Biology 2:425-427.
Reynolds D.P. & S.S. Sadove. 2000. Size class of sea turtles in
NewYorkfrom1986to1996.In:F.A.Abreu-Grobois,R.
Briseo-Dueas,R.Mrquez,F.SilvaandL.Sarti,eds.
Proceedings of the Eighteenth International Sea Turtle
Symposium. U.S. Dep. Commer. NOAA Tech. Memo.
NMFS-SEFSC-436. p: 152-153.
SilvaniL.,M.Gazo&A.Aguilar.1999.Spanishdriftnetfshingand
incidental catches in the western Mediterranean. Biological
Conservation90:79-85.
SteyermarkA.C., K. Williams, J.R. Spotila, et al. 1996. Nesting
leatherback turtles at Las Baulas National Park, Costa Rica.
Chelonian Conservation Biology 2(2):173183.
UnderwoodA.J.1997.Experimentsinecology:theirlogicaldesign
and interpretation using analysis of variance. Cambridge,
England. XX pp.
Wyneken J. 2001. The anatomy of sea turtles. US Department of
Commerce, NOAA TeC. Memor. NMFS-SEFSC-470,
172 pp.
Zrate P., M. Parra & J. Carrin. 2007. Informe fnal proyecto
anidacin de la tortuga verde Chelonia mydas, durante la
temporada de anidacin 2006-2007. Presentado al Servicio
Parque Nacional Galpagos. Fundacin Charles Darwin,
Santa Cruz, Galpagos, Ecuador. 66 pp.
302
Rosales et al.
Rev. peru. biol. 17(3): 293 - 301 (Diciembre 2010)
303

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Lista de cigarritas (Hemiptera: Cicadellidae) de Cusco, Per
Juan F. Costa
1
* y Pedro W. Lozada
2
Checklist of leafhoppers (Hemiptera: Cicadellidae) from Cusco, Peru
* Autor para correspondencia:
1. Laboratorio de Entomologa, Of-
cina C-333, Facultad de Ciencias
Biolgicas, Universidad Nacional
de San Antonio Abad del Cusco
(UNSAAC), Ciudad Universitaria
de Perayoc, Av. De La Cultura N
733, Cusco, Per.
Email Juan F. Costa:
jfrancosta@gmail.com
2. Investigador Asociado. Departa-
mento de Entomologa, Museo de
Historia Natural (MUHN), Universi-
dad Nacional Mayor de San Marcos
(UNMSM). Lima, Per.
Presentado: 13/09/2010
Aceptado: 11/12/2010
Publicado online: 00/11/2010
Resumen
Se presenta una lista de cigarritas registradas para Cusco, conteniendo 111 gneros y 203 especies. Esta lista
incluye especies citadas en la literatura y tambin de material depositado en la coleccin de la Universidad
Nacional de San Antonio Abad del Cusco. Las cigarritas identifcadas por los autores fueron colectadas de 8
provincias de Cusco: Anta, Calca, Canchis, Cusco, La Convencin, Paucartambo, Quispicanchi y Urubamba.
Palabras clave: Biodiversidad, Insecta, Hemiptera, Cusco, Per.
Abstract
We present a list of leafhoppers recorded for Cusco, containing 111 genera and 203 species. This list includes
species cited in taxonomic literature and also from material housed in the collections of the Universidad Nacional
de San Antonio Abad del Cusco. The leafhoppers identifed by the authors were collected from 8 provinces of
Cusco: Anta, Calca, Canchis, Cusco, La Convencin, Paucartambo, Quispicanchi and Urubamba.
Keywords: Biodiversity, Insecta, Hemiptera, Cusco, Peru.
Introduccin
En el Per, los estudios sobre los cicadlidos (cigarritas) se han
desarrollado de manera puntual e incluyendo insectos plagas
principalmente (Langlitz 1964, Ojeda et al. 1971, Santa Mara et
al. 2001, Valdiviezo & Villarreal 2002, Rasmussen et al. 2003).
Los estudios de Lozada (1992a, 1992b, 1997) presentan listas
de cicadlidos de Per y de grupos especfcos (Lozada & Len
1996, Lozada 2001).
En Cusco, pocos son los estudios realizados sobre Cicadellidae
en reas cultivadas o silvestres (Carrasco 1968, Venero-Gonzales
1991, Ormachea & Vidal 1994, Ybar et al. 2002, Costa &
Lozada 2004, Lozada et al. 2009).
El listado que se presenta sigue el ordenamiento taxonmico
de Dietrich y Rakitov (2002), Dietrich y Dmitriev (2003) y
Dietrich (2005, 2006).
Nota:
Las localidades y/o especies marcadas con (*) son citadas en Lozada
(1992b).
Las localidades y/o especies marcadas con (**) son citadas en
Lozada (1997).
Subfamilia CiCadellinae
Tribu CiCadellini
Acrulogonia Young, 1977
**A. incompta Young, 1977. Hacienda Mara, Cusco; Mar-
capata, Cusco.
Amblyscarta Stl, 1869
A. modesta Young, 1977. Pilcopata-Atalaya (790m),
11.iii.2002, J. F. Costa col., trampa de luz. Paucartambo-
Pilcopata (950m), 12.iii.2002, J. F. Costa col, trampa de luz.
A. obscura Young, 1977. Pilcopata-Atalaya (790m),
11.iii.2002, J. F. Costa col., trampa de luz.
A. opulenta (Walker, 1851). Paucartambo-Pilcopata (950m),
12.iii.2002, J. F. Costa col., trampa de luz.
Apulia Distant, 1908
A. fora Distant, 1908. Paucartambo-Pilcopata (950m),
12.iii.2002, J. F. Costa col, trampa de luz.
A. hyala Distant, 1908. San Pedro, Kosipata (Paucartambo,
1400m), 10.xii.2007, J. F. Costa & J. C. Astete.
**A. resupinata Young, 1977. Santa Isabel, Cusco.
Begonalia Young, 1977
**B. hydra (Distant, 1908). Callanga.
Borogonalia Young, 1977
B. crinata Young, 1977. Saylla (Cusco), 30.viii.1973, C.
Martnez col.; Saqsayhuamn (Cusco, 3600m), 30.iii.2002,
J. F. Costa col., ex Baccharis polianta, ex poceas; Tancarpata
(Santiago, 3350m), 08.v.2002, J. F. Costa col., ex Baccharis sp;
Pumamarca (San Sebastin, 3450m), 19.ix.2002, J. F. Costa
col., ex varios; Tancarpata (Santiago, 3350m), 14.x.2002, J.
F. Costa col., ex varios; San Sebastin, 14.xi.2002, M. Olivera
col., ex Pyrus communis, Progreso (Wanchaq), 26.xi.2002, J. F.
Costa col., ex Baccharis sp; Progreso (Wanchaq), 22.xi.2004,
J. F. Costa col., ex Baccharis sp; Santa Mara (San Sebastin,
3450m), 08.iv.2006, M. Cardenas col., ex Escallonia resinosa,
ex Colletia spinosissima.
B. impressifrons (Signoret, 1854). Saqsayhuamn (Cusco,
3600m), 30.iii.2002, J. F. Costa col., ex Baccharis polianta,
ex poceas; Tancarpata (Santiago, 3350m), 08.v.2002, J. F.
Costa col., ex Baccharis sp; Pumamarca (San Sebastin, 3450m),
19.ix.2002, J. F. Costa col., ex varios; Tancarpata (Santiago,
3350m), 14.x.2002, J. F. Costa col., ex varios; San Sebastin,
14.xi.2002, M. Olivera col., ex Pyrus communis, Progreso
(Wanchaq), 26.xi.2002, J. F. Costa col., ex Baccharis sp; Progreso
(Wanchaq), 22.xi.2004, J. F. Costa col., ex Baccharis sp; Santa
Mara (San Sebastin, 3450m), 08.iv.2006, M. Cardenas col.,
ex Escallonia resinosa, ex Colletia spinosissima.
Caldwelliola Young, 1977
**C. selvola Young, 1977. Callanga.
304
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
Caragonalia Signoret, 1855
C. carminata Signoret, 1855. Machupicchu (Urubamba),
08.v.1965, O. Ochoa col.
Cephalogonalia Evans, 1947
C. fabellula (Jacobi, 1905). Pichari, La Convencin (1000m),
15.viii.2005, A. Bustamante col.
Cephalogonalia sp. Pichari, La Convencin (1000m),
15.viii.2005, A. Bustamante col.
Coronigoniella Young, 1977
**C. ostenta Young, 1977. Callanga.
Cyclogonia Melichar, 1926
C. scutellatula Osborn, 1851. Paucartambo-Pilcopata,
Kosipata (2400m), 08.iii.2002, J. F. Costa col, trampa de luz.
C. sumai Young, 1977. San Pedro, Kosipata (Paucart-
ambo, 1400m), 15.viii.2001, A. Bustamante col.; Pilcopata
(Paucartambo, 565m), 23.ii.2002, J. F. Costa col., trampa de
luz; Esperanza-Pillahuata, Kosipata (Paucartambo, 2900m),
27.vii.2003, J. F. Costa col., ex varios.
**C. praetextatula (Jacobi, 1905). Callanga.
Diedrocephala Spinola, 1850
**D. variegata (Fabricius, 1775). Callanga. Actualmente
presenta una nueva combinacin taxonmica: D. bimaculata
(Gmelin, 1789), de acuerdo a McKamey (2007).
Dilobopterus Signoret, 1850
**D. fenestratus Young, 1977. Callanga; Marcapata.
D. jemima Distant, 1908. Sahuayaco, Quillabamba (La Con-
vencin, 800m), 20.iii.1996, R. Casafranca col; Paucartambo-
Pilcopata (Kosipata, 2400m), 09.iii.2003, J. F. Costa col;
Mirafores, Lares (Calca, 1618m), 20.v.2003, A. Bustamante
col, ex Solanum tuberosum.
D. obliquatulus Jacobi, 1905. Pilcopata (Paucartambo,
565m), 21.iv.1964, O. Ochoa col. Callanga**.
Erythrogonia Melichar, 1926
E. amicula Jacobi, 1905. Sahuayaco, Quillabamba (La
Convencin, 800m), 20.iii.1996, R. Casafranca col. Vilcanota**;
Marcapata**.
**E. aurivagula (Jacobi, 1905). Marcapata.
**E. eburata Melichar, 1926. Vilcanota.
**E. imitatricula (Jacobi, 1905). Callanga; Santa Isabel, Cusco.
**E. kokomona Medler, 1963. Marcapata.
**E. sociales Melichar, 1926. Marcapata.
E. triplicula Jacobi, 1905. Pilcopata (Paucartambo, 565m),
21.iv.1964, O. Ochoa col; Machupicchu (Urubamba, 2800m),
07.v.1965, C. Martnez col; Machupicchu (Urubamba, 2800m),
26.xi.1965, C. Martnez col; Machupicchu (Urubamba,
2800m), 17.ix.1983, E. Madera col; Paco Pacuni (Limbani,
Puno, 898m), 15.xi.2006, J. F. Costa col. Marcapata**.
**E. warsula Medler, 1963. Marcapata.
Hortensia Metcalf & Bruner, 1936
H. similis (Walker, 1851). Sahuayaco, Quillabamba (La
Convencin, 800m), 15.iii.1996, R. Casafranca col; Sahuay-
aco, Quillabamba (La Convencin, 800m), 20.iii.1996, R.
Casafranca col; Pilcopata, Kosipata (Paucartambo, 565m),
08.xii.2001, Alfaro & Bustamante col, ex Ananas comosus (pia);
Pilcopata, Kosipata (Paucartambo, 565m), 23.ii.2002, J. F.
Costa col, trampa de luz.
Iragua Melichar, 1926
**I. montana Young, 1977. Vilcanota.
**I. perplexa Young, 1977. Marcapata.
Jozima Young, 1977
J. leucopa (Walker, 1858). segn Young (1977). Pilcopata-
Atalaya (Paucartambo, 790m), 11.iii.2002, J. F. Costa col,
trampa de luz. Marcapata**.
Juliaca Melichar, 1926
**J. bilineata (Melichar, 1951). Callanga.
**J. simoni Young, 1977. Santa Isabel, Cusco; Callanga.
Kogigonalia Young, 1977
**K. cajana Young, 1977. Callanga.
Lissoscarta Stl, 1869
**L. nipata Young, 1977. Hacienda Mara, Cusco.
Macugonalia Young, 1977
M. cavifrons (Stl, 1862). Pilcopata-Atalaya (Paucartambo,
790m), 11.iii.2002, J. F. Costa col, trampa de luz.
M. leucomelas Walker, 1851. Pilcopata (Paucartambo, 565m),
23.ii.2002, J. F. Costa col, trampa de luz.
Mesogonia Melichar, 1926
M. callangana Young, 1977. Pilcopata-Atalaya (Paucartambo,
790m), 11.iii.2002, J. F. Costa col, trampa de luz. Callanga**.
M. olivatula Osborn, 1926. Pilcopata-Atalaya (Paucartambo,
790m), 11.iii.2002, J. F. Costa col, trampa de luz.
**M. retrorsa Young, 1977. Callanga.
**M. suspecta Young, 1977. Paucartambo.
**M. tolosa (Distant, 1908). Cusco.
Mucrometopia Melichar, 1925
**M. caudata (Walker, 1851). Vilcanota.
Onega Distant, 1908
O. bracteata Young, 1977. Sahuayaco, Quillabamba (La
Convencin, 800m), 15.xi.1995, R. Casafranca col; Pilcopata
(Paucartambo, 565m), 02.ii.2002, A. Bustamante; Callanga**.
Onega sp. San Pedro, Kosipata (Paucartambo, 1400m),
15.viii.2001, A. Bustamante col; Paucartambo-Pilcopata
(2400m), 08.iii.2002, J. F. Costa col, trampa de luz.
Oragua Melichar, 1926
305

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
**O. nusinasa Young, 1977. Santa Isabel, Cusco; Marcapata.
O. partitula (Jacobi, 1905). Pilcopata (Paucartambo, 565m),
23.ii.2002, J. F. Costa col, trampa de luz.
Pachitea Melichar, 1926
**P. habernula (Jacobi, 1905). Callanga.
P. ryma Young, 1977. Paucartambo-Pilcopata (950m),
12.iii.2002, J. F. Costa col, trampa de luz; Paucartambo-
Pilcopata (1130m), 13.iii.2002, J. F. Costa col, trampa de luz;
Callanga**.
P. subfava Walker, 1851. Paucartambo-Pilcopata (950m),
12.iii.2002, J. F. Costa col, trampa de luz.
Pamplona Melichar, 1926
**P. spatulata Young, 1977. Callanga.
Paromenia Melichar, 1926
P. marginata Young, 1977. Paucartambo-Pilcopata (1130m),
10.iii.2002, J. F. Costa col, trampa de luz. Santa Isabel, Cusco**.
P. quimbayensis (Kulgatz & Melichar, 1902). Trocha Unin,
Acjanaco, Kosipata (Paucartambo, 2750m), 31.xii.2001, J. F.
Costa col, ex varios; Pilcopata (Paucartambo, 565m), 23.ii.2002,
J. F. Costa col; Trocha Unin, Acjanaco, Kosipata (Paucart-
ambo, 2750m), 27.ii.2002, J. F. Costa col, ex varios; Esperanza-
Pillahuata, Kosipata (Paucartambo, 2900m), 27.vii.2003, J.
F. Costa col, ex varios.
Pawiloma Young, 1977
P. fulpae Young, 1977. Machupicchu (Urubamba, 2800m),
17.ix.1983, E. Madera col; Ucchuhuerta, Choquequirao (Anta,
1600m), 16.v.2002, Cceres & Huerta col. Machupicchu**.
P. sirochia Young, 1977. Trocha Unin, Acjanaco, Kosipata
(Paucartambo, 2750m), 31.xii.2001, J. F. Costa col, ex varios.
Punahuana Young, 1977
P. dyscrita Young, 1977. Trocha Unin, Acjanaco, Kosipata
(Paucartambo, 2750m), 31.xii.2001, J. F. Costa col, ex varios;
Trocha Unin, Acjanaco, Kosipata (Paucartambo, 2750m),
27.ii.2002, J. F. Costa col, ex varios. Callanga**; Marcapata**.
Ramosulus Young, 1977
R. corrugipennis (Osborn, 1926). Pilcopata (Paucartambo,
565m), 23.ii.2002, J. F. Costa col., trampa de luz.
**R. fulgidus (Melichar, 1932). Callanga.
R. phaedrus Young, 1977. Trocha Unin, Acjanaco,
Kosipata (Paucartambo, 2750m), 31.xii.2001, J. F. Costa col.,
ex varios; Trocha Unin, Acjanaco, Kosipata (Paucartambo,
2750m), 27.ii.2002, J. F. Costa col., ex varios.
Schildola Young, 1977
**S. ductilis Young, 1977. Santa Isabel, Cusco.
Sibovia China, 1927
S. aprica Melichar, 1926. Mirafores, Lares (Calca, 1618m),
25.v.2003, A. Bustamante.
**S. picchitula Young, 1977. Machupicchu.
**S. praevia (Melichar, 1926). Cusco.
Soosiulus Young, 1977
**S. fanmidulus (Jacobi, 1905). Marcapata.
**S. seimunculus (Melichar, 1932). Marcapata.
Stehlikiana Young, 1977
S. halticula (Jacobi, 1905). Machupicchu (Urubamba,
2800m), 03.ii.1964, C. Martnez col; Machupicchu (Urubamba,
2800m), 26.xi.1965, C. Martnez col; Pilcopata (Paucartambo,
565m), 16.xi.1968, O. Ochoa col; Paucartambo-Pilcopata,
Kosipata (2400m), 08.iii.2002, J. F. Costa col, trampa de
luz. Marcapata**.
**S. obscura (Jacobi, 1905). Marcapata.
**S. recurva (Jacobi, 1905). Callanga; Vilcanota.
Tipuana Melichar, 1926
**T. expallida Young, 1977. Hacienda Mara, Cusco.
Tortigonalia Young, 1977
**T. torta Young, 1977. Callanga.
T. treva Young, 1977. Pilcopata (565m), 23.ii.2002, J. F.
Costa col, ex gramneas. Callanga**.
Trichogonia Breddin, 1901
T. costata (Signoret, 1853). Ttio (Wanchaq, 3330m),
23.vii.1963, O. Ochoa col, Huancaro (Santiago), 20.v.1973,
C. Martnez col; Saqsayhuamn (Cusco, 3600m), 24.ii.1983,
E. Madera col; Ticatica, 20.vii.1983, E. Madera col, Los Incas
(Cusco), 02.xi.1995, J. lvarez col; Pillao Matao (San Sebas-
tin, 3350m), 13.iv.2002; Saqsayhuamn (Cusco, 3600m),
30.iii.2003, J. F. Costa col, ex Daucus carota, ex Brassica oleracea,
ex B. campestris; Pampallaqta, Pisaq (Calca, 3340m), 25.iv.2002,
Alfaro & Bustamante col, ex Solanum tuberosum, ex Buddleia
coriacea; Salineras (San Sebastin, 3380m), 14.iv.2002, J. F.
Costa, ex asterceas.
Zaruma Melichar, 1926
**Z. decolorata Young, 1977. Callanga.
Tribu ProConiini
Abana Distant, 1908
**A. horvathi Jacobi, 1905. Cusco.
Acrogonia Stl, 1869
**A. stylata Young, 1968. Hacienda Mara, Cusco; Callanga.
Anacuerna Young, 1968
A. centrolinea (Melichar, 1925). Tipn, 22.viii.1973, C.
Martnez col; Saylla, 30.viii.1973, C. Martnez col; Perayoc
(Cusco, 3370m), 22.ix.1973, C. Martnez col; Ticatica (San-
tiago), 20.vii.1983, E. Madera col; Pumamarca (San Sebastin,
3450m), 14.ix.2002, J. F. Costa col, ex Daucus carota; Pillao
Matao (San Sebastin, 3350m), 25.vi.2004, J. F. Costa col,
ex Daucus carota, ex Trifolium repens; Kayra (San Jernimo,
306
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
3210m), 14.ix.2004, K. Gonzles col, ex Medicago sativa; Saylla,
22.X.2004, J. F. Costa col, ex grass.
Deselvana Young, 1968
D. longipennis (Melichar, 1925). Pilcopata (Paucartambo,
565m), 23.ii.2002, J. F. Costa col., trampa de luz.
Dichrophleps Stl, 1869
D. truncata (Young, 1968). Pilcopata-Atalaya (Paucartambo,
790m), 11.iii.2002, J. F. Costa col., trampa de luz. Hacienda
Mara, Cusco**. Ro Kosipata**.
Diestostemma Amyot & Serville, 1843
**D. blantoni Young, 1968. Callanga.
**D. dolosum (Melichar, 1924). Cusco.
**D. reticulatum (Melichar, 1924). Cusco.
Egidemia China, 1927
**E. obtusata (Melichar, 1925). Marcapata.
Homoscarta Melichar, 1926
H. boliviana Schmidt, 1928. Pilcopata (Paucartambo, 565m),
23.ii.2002, J. F. Costa col., trampa de luz.
**H. superciliaris (Jacobi, 1905). Cusco.
Ichthyobelus Melichar, 1925
I. bellicosus Melichar, 1925. Sahuayaco (La Convencin,
800m), 15.iii.1996, R. Casafranca col.
Molomea Signoret, 1855
**M. consorta (Melichar, 1925). Vilcanota.
M. guttulata Melichar, 1925. Sahuayaco (La Convencin,
800m), 15.iii.1996, R. Casafranca col.
Oncometopia Stl, 1869
O. venata Schroeder, 1959. Shintuya, Salvacin (Madre de
Dios), 07.iii.1968, E. Gonzles col.; Pilcopata (Paucartambo,
565m), 16.xi.1968, O. Ochoa col.
Oncometopia sp. Pilcopata (Paucartambo, 565m),
04.x.1963, O. Ochoa col.; Sahuayaco (La Convencin, 800m),
18.iii.1996, R. Casafranca col.; Pilcopata (Paucartambo,
565m), 15.ii.2002, A. Bustamante col.; Pilcopata-Atalaya (Pau-
cartambo, 790m), 11.iii.2002, J. F. Costa col., trampa de luz;
Paucartambo-Pilcopata (950m), 12.iii.2002, J. F. Costa col.,
trampa de luz; Pilcopata (Paucartambo, 565m), 01.xi.2002,
A. Bustamante col.
Procandea Young, 1968
**P. andina Young, 1968. Marcapata.
**P. cordillerae Young, 1968. Cusco.
P. inca Young, 1968. Pilcopata (Paucartambo, 565m),
15.xi.1967, O. Ochoa col.
**P. monticola Young, 1968. Santa Isabel, Cusco; Callanga.
**P. quechua Young, 1968. Callanga, Cusco.
Proconia Le Peletier & Serville, 1825
P. marmorata Metcalf, 1965. Pilcopata (Paucartambo, 565m),
15.xi.1967, O. Ochoa col.
Proconopera Young, 1968
**P. pullula (Jacobi, 1905). Callanga.
Proconosama Young, 1968
P. haenschi (Melichar, 1926). Sahuayaco (La Convencin,
800m), 20.iii.1996, R. Casafranca col.; San Pedro, Kosipata
(Paucartambo, 1400m), 15.viii.2001, A. Bustamante col.
Pseudometopia Schmidt, 1928
P. irenae Young, 1968. San Pedro, Kosipata (Paucartambo,
Cusco, 1400m), 15.viii.2001, A. Bustamante col. Callanga**.
Santa Isabel, Cusco**.
Rhaphirrhinus Laporte, 1832
R. phosphoreus (Linneus, 1758). Salvacin (Madre de Dios),
17.xi.1968, O. Ochoa col.
Subfamilia delToCePhalinae
El concepto de esta Subfamilia fue recientemente ampliado
para incluir a las Subfamilias Eupelicinae, Koebeliinae,
Paraboloponinae, Penthimiinae y Selenocephalinae; en
Dietrich y Rakitov (2002) y Dietrich & Dmitriev (2003).
Tribu delToCePhalini
Amplicephalus DeLong, 1926
*A. auranticus Linnavuori & DeLong, 1979. Machupicchu.
*A. paradoxus Linnavuori & DeLong, 1976. Machupicchu.
Mattogrossus Linnavuori, 1959
*M. colonoides (Linnavuori, 1959). Quincemil, Cusco.
Picchuia Linnavuori & DeLong, 1979
*P. pungens Linnavuori & DeLong, 1979. Machupicchu.
Tribu doraTurini
Icaia Linnavuori, 1973
I. appendiculata Linnavuori & DeLong, 1976. Huatata,
Chinchero (Anta, 3800m), 15.viii.2004, J. F. Costa col., ex
Solanum tuberosum; Huatata, Chinchero (Anta, 3800m),
25.vi.2005, J. F. Costa col., ex Solanum tuberosum, ex Vicia
faba. Machupicchu*.
Tribu euSCelini
Andanus Linnavuori, 1959
*A. bimaculatus Linnavuori, 1959. Quincemil, Cusco.
Atanus Oman, 1936
*A. picchuanus Linnavuori & DeLong, 1976. Machupicchu.
Bandaromimus Linnavuori, 1959
B. fulvopictus Linnavuori, 1959. Pilcopata-Atalaya (Paucart-
ambo, 790m), 11.iii.2002, J. F. Costa col., trampa de luz.
307

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
Brazosa Oman, 1936
*B. picturella (Baker, 1923). Callanga (Paucartambo, Cusco).
Chlorotettix Van Duzze, 1892
Chlorotettix sp. Trocha Unin, Acjanaco, Kosipata (Pau-
cartambo, 2750m), 31.xii.2001, J. F. Costa col., ex varios;
Trocha Unin, Acjanaco, Kosipata (Paucartambo, 2750m),
27.ii.2002, J. F. Costa col., ex varios.
Exitianus Ball, 1929
*E. quadratulus (Osborn, 1923). Machupicchu.
Paratanus Young, 1957
P. exitiosus (Beamer, 1943). Pampallaqta, Lares (Calca,
3900m), 09.vii.2003, J. F. Costa col., ex gramneas; Chilca, Ol-
lantaytambo (Urubamba, 2600m), 12.v.2005, J. F. Costa col.,
ex Chenopodium quinoa, ex Zea mays; Cuncani, Lares (Calca,
3545m), 16.i.2004, J. F. Costa col, ex gramneas; Tambohuaylla,
Lares (Calca, 3510m), 17.i.2005, J. F. Costa col., ex Chenopo-
dium quinoa; Marangani, Sicuani (Canchis), 22.v.2005, J. F.
Costa col., ex Chenopodium quinoa, ex Zea mays.
P. yusti Young, 1957. Kayra (San Jernimo, 3219m),
26.i.2002, J. F. Costa, ex Zea mays, ex Solanum tuberosum; San
Jernimo (San Jernimo, 3400m), 13.iii.2002, J. F. Costa col.,
ex Zea mays, Phaseolus vulgaris; Saqsayhuamn (Cusco, 3600m),
28.vii.2002, J. F. Costa col., ex Baccharis polianta (chilca); Per-
ayoc (Cusco, 3360m), 04.viii.2002, J. F. Costa col.; Pumamarca
(San Sebastin, 3450m), 14.ix.2002, J. F. Costa col.; Tancarpata
(San Sebastin, 3350m), 14.x.2002, J. F. Costa col., ex Zea mays;
Amadeo Repeto (Santiago), 05.xi.2002, W. Cosio col.; Chilca,
Ollantaytambo (Urubamba, 2600m), 12.v.2005, J. F. Costa col.,
ex Chenopodium quinoa, ex Zea mays; Pampallaqta, Lares (Calca,
3900m), 09.vii.2003, J. F. Costa col., ex gramneas; Cuncani,
Lares (Calca, 3545m), 16.i.2004, J. F. Costa col., ex gramneas;
Tambohuaylla, Lares (Calca, 3510m), 17.i.2005, J. F. Costa col.,
ex Chenopodium quinoa; Pisaq (Calca), 01.iv.2005, J. F. Costa
col., ex Chenopodium quinoa; Marangani (Sicuani), 22.v.2005,
J. F. Costa col., ex Chenopodium quinoa, ex Zea mays.
Sinchonoa Linnavuori & DeLong, 1978
*S. machua DeLong, 1980. Machupicchu.
Yungasia Linnavuori, 1959
*Y. longipennis Linnavuori & DeLong, 1976. Machupicchu.
Tribu heCalini
Tenucephalus DeLong, 1944
*T. saggitarius Linnavuori & DeLong, 1976. Machupicchu.
Tribu maCroSTelini
Dalbulus DeLong, 1976
D. maidis (DeLong & Wolcott, 1923). Ollantaytambo
(Urubamba, 2600m), 12.v.2005, J. F. Costa col., ex Chenopo-
dium quinoa, ex Zea mays.
Picchusteles Linnavuori & DeLong, 1976
*P. inca Linnavuori & DeLong, 1976. Machupicchu.
Tribu SCaPhyToPiini
Scaphytopius Ball, 1931
*S. atrifrons DeLong & Linnavuori, 1978. Machupicchu.
Tribu inCierTa
Amblysellus Sleesman, 1929
Amblysellus sp. San Jernimo (San Jernimo, 3400m),
13.iv.2002, J. F. Costa col., ex Zea mays, ex Phaseolus vulgaris;
Perayoc (Cusco, 3360m), 04.viii.2002, J. F. Costa col., ex Escal-
lonia resinosa, ex gramneas; Tancarpata (San Sebastin, 3350m),
14.x.2002, J. F. Costa col., ex varios; Amadeo Repeto (Santiago),
05.xi.2002, W. Cosio col., ex varios; Pampallaqta, Lares (Calca,
3900m), 09.vii.2003, J. F. Costa col., ex gramneas; Esperanza-
Pillahuata, Kosipata (Paucartambo, 2900m), 15.xi.2003, J.
F. Costa col., ex gramneas; Cuncani, Lares (Calca, 3545m),
16.i.2004, J. F. Costa col., ex gramneas; Tambohuaylla, Lares
(Calca, 3510m), 17.i.2005, J. F. Costa col., ex Chenopodium
quinoa; Pumamarca (San Sebastin, 3350m), 16.vii.2005, J.
F. Costa col.
Bahita Osborn, 1923
B. infuscata Osborn, 1923. Pilcopata (Paucartambo, 565m),
23.ii.2002, J. F. Costa col., ex gramneas; Pilcopata-Atalaya
(Paucartambo, 790m), 11.iii.2002, J. F. costa col., trampa de
luz; Paucartambo-Pilcopata (Paucartambo, 1130m), 13.iii.2002,
J. F. Costa col., trampa de luz.
B. irrorata Osborn, 1923. Paucartambo-Pilcopata (Paucar-
tambo, 1130m), 13.iii.2002, J. F. Costa col., trampa de luz;
Paucartambo-Pilcopata (Paucartambo, 950m), 12.iii.2002, J.
F. Costa col., trampa de luz.
Bahita sp. Trocha Unin, Acjanaco, Kosipata (Paucar-
tambo, 2750m), 31.xii.2001, J. F. Costa col., ex Araceae, ex
Conmelina sp (Conmelinaceae).
Haldorus Oman, 1938
Haldorus sp. Trocha Unin, Acjanaco, Kosipata (Pau-
cartambo, 2750m), 31.xii.2001, J. F. Costa col., ex varios;
Trocha Unin, Acjanaco, Kosipata (Paucartambo, 2750m),
27.ii.2002, J. F. Costa col., ex varios.
Neomesus Linnavuori, 1959
Neomesus sp. Saqsayhuamn (Cusco, 3600m), 28.vii.2002,
J. F. Costa col., ex Baccharis polianta (chilca); Huatata, Chin-
chero (Anta, 3800m), 15.viii.2004, J. F. Costa col., ex Solanum
tuberosum; Huatata, Chinchero (Anta, 3800m), 25.vi.2005, J.
F. Costa col., ex Solanum tuberosum, ex Vicia faba.
Subfamilia iaSSinae
Tribu GyPonini
Anteriormente conocida como Subfamilia Gyponinae (=
Scarinae, proveniente del gnero tipo Scaris Le Peletier & Ser-
ville, 1825). Reducida a status de Tribu dentro de la Subfamilia
Iassinae en Dietrich (2005).
Acuera DeLong & Freytag, 1972
A. nana DeLong & Freytag, 1974. Trocha Unin, Acja-
308
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
naco, Kosipata (Paucartambo, 2750m), 31.xii.2001, J. F.
Costa col., ex varios; Pilcopata-Atalaya (Paucartambo, 790m),
11.iii.2002, J. F. Costa col., trampa de luz. Cusco, a lo largo del
ro Kosipata (Cosipata)**.
Acuera sp. Paucartambo-Pilcopata (Paucartambo, 1130m),
10.iii.2002, J. F. Costa col., ex varios; Pilcopata-Atalaya (Pau-
cartambo, 790m), 11.iii.2002, J. F. Costa col., trampa de luz;
Paucartambo-Pilcopata (Paucartambo, 950m), 12.iii.2002, J.
F. Costa col., trampa de luz.
Acuponana DeLong & Freytag, 1970
**A. enera DeLong & Freytag, 1970. Hacienda Mara, Cusco.
Barbatana Freytag, 1989
**B. narda (DeLong & Freytag, 1969). Hacienda Santa
Isabel, Cusco.
Chloronana DeLong & Freytag, 1964
**C. decolora DeLong & Freytag, 1964. Hacienda Mara, Cusco.
C. orbicula DeLong & Freytag, 1964. Pilcopata-Atalaya (Pau-
cartambo, 790m), 11.iii.2002, J. F. Costa col., trampa de luz.
**C. rotunda DeLong & Freytag, 1964. Callanga.
Costanana DeLong & Freytag, 1972
Costanana sp. 1. Perayoc (Cusco, 3350m), 28.ix.1973, C.
Martnez col.
Costanana sp. 2. Trocha Unin, Acjanaco, Kosipata
(Paucartambo, 2750m), 31.xii.2001, J. F. Costa col., ex varios;
Trocha Unin, Acjanaco, Kosipata (Paucartambo, 2750m),
27.ii.2002, J. F. Costa col., ex varios; Paucartambo-Pilcopata
(Paucartambo, 2400m), 08.iii.2002, J. F. Costa col., trampa de
luz; Paucartambo-Pilcopata (Paucartambo, 1130m), 13.iii.2002,
J. F. Costa col., trampa de luz; Paucartambo-Pilcopata (Pau-
cartambo, 950m), 12.iii.2002, J. F. Costa col., trampa de luz.
Culumana DeLong & Freytag, 1972
**C. bacula DeLong, 1979. Machupicchu.
**C. concava DeLong, 1979. Santa Isabel, Cusco.
**C. dualana DeLong, 1979. Santa Isabel, Cusco.
Curtara DeLong & Freytag, 1976
**C. picchua DeLong, 1979. Machupicchu.
**C. sufara DeLong, 1980. Callanga.
Folicana DeLong & Freytag, 1972
**F. nota DeLong & Freytag, 1972. Hacienda Mara, Cusco.
Fuminana Freytag, 1989
**F. astra (DeLong & Freytag, 1969). Callanga.
**F. lira (DeLong & Freytag, 1969). Hacienda Mara, Cusco.
Gypona Germar, 1821
**G. adita DeLong & Freytag, 1964. Santa Isabel, Cusco.
**G. fsura DeLong & Freytag, 1964. Hacienda Mara, Cusco;
Santa Isabel, Cusco.
G. glauca Fabricius, 1803. Trocha Unin, Acjanaco,
Kosipata (Paucartambo, 2750m), 31.xii.2001, J. F. Costa col.,
ex varios; Trocha Unin, Acjanaco, Kosipata (Paucartambo,
2750m), 27.ii.2002, J. F. Costa col., ex varios.
**G. nacula DeLong & Freytag, 1964. Santa Isabel, Cusco.
**G. nigrena DeLong & Freytag, 1975. Callanga.
G. quadrina DeLong & Linnavuori, 1977. Pilcopata (Pau-
cartambo, 565m), 23.ii.2002, J. F. Costa col., ex asterceas.
Machupicchu**.
**G. solata DeLong & Freytag, 1964. Callanga.
Gyponana Ball, 1920
G. apicata DeLong & Freytag, 1964. Pilcopata (Paucartambo,
565m), 23.ii.2002, J. F. Costa col., ex asterceas; Pilcopata-
Atalaya (Paucartambo, 790m), 11.iii.2002, J. F. Costa col.,
trampa de luz.
Hecalapona DeLong & Freytag, 1975
**H. apicella DeLong, 1981. Callanga.
**H. berna DeLong & Freytag, 1975. Callanga.
**H. crinata DeLong & Freytag, 1975. Callanga.
**H. eruva DeLong & Freytag, 1975. Quincemil, Cusco.
**H. forceps DeLong & Freytag, 1975. Callanga.
**H. huella DeLong & Freytag, 1975. Callanga.
**H. scella DeLong & Freytag, 1975. Callanga.
Nulana DeLong, 1976
**N. sinchona DeLong & Martinson, 1980. Santa Isabel,
Cusco.
**N. verdana DeLong & Martinson, 1980. Hacienda Mara,
Cusco.
Polana DeLong, 1942
**P. bulba DeLong & Freytag, 1972. Callanga.
**P. concinna (Stl, 1862). Callanga.
**P. falsa DeLong & Freytag, 1972. Hacienda Mara, Cusco.
**P. fetera DeLong & Freytag, 1972. Hacienda Mara, Cusco;
Santa Isabel, Cusco.
P. icara DeLong & Freytag, 1972. Paucartambo-Pilcopata
(Paucartambo, 1130m), 13.iii.2002, J. F. Costa col., trampa de
luz. Santa Isabel, Cusco**.
**P. inimicus DeLong, 1976. Callanga.
**P. lanara DeLong & Freytag, 1972. Hacienda Mara, Cusco;
Santa Isabel, Cusco.
**P. resupina DeLong & Freytag, 1972. Hacienda Mara,
Cusco.
**P. scruta DeLong & Freytag, 1972. Hacienda Mara, Cusco.
Polana sp. Paucartambo-Pilcopata (Paucartambo, 1130m),
13.iii.2002, J. F. Costa col., trampa de luz; Paucartambo-
Pilcopata (Paucartambo, 950m), 12.iii.2002, J. F. Costa col.,
309

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
trampa de luz; Esperanza-Pillahuata, Kosipata (Paucartambo,
2821m), 27.vii.2003, J. F. Costa col., ex gramneas.
Ponana DeLong & Freytag, 1967
**P. atea DeLong & Freytag, 1967. Santa Isabel, Cusco.
**P. avena DeLong & Freytag, 1967. Santa Isabel, Cusco.
**P. berta DeLong & Freytag, 1967. Santa Isabel, Cusco.
**P. cerosa DeLong & Freytag, 1967. Pillahuata (Paucartambo).
**P. hilara DeLong & Martinson, 1973. Santa Isabel, Cusco.
**P. perusana DeLong, 1980. Santa Isabel, Cusco.
Ponana sp. Trocha Unin, Acjanaco, Kosipata (Pau-
cartambo, 2750m), 31.xii.2001, J. F. Costa col., ex varios;
Paucartambo-Pilcopata (Paucartambo, 2400m), 09.iii.2003,
J. F. Costa col., trampa de luz; Paucartambo-Pilcopata (Pau-
cartambo, 1130m), 13.iii.2002, J. F. Costa col., trampa de luz;
Paucartambo-Pilcopata (Paucartambo, 950m), 12.iii.2002, J.
F. Costa col., trampa de luz.
Ponanella DeLong & Freytag, 1969
**P. rubravenosa DeLong & Freytag, 1969. Callanga.
Scaris Le Peletier & Serville, 1825
**S. amputa (DeLong & Freytag, 1969). Hacienda Mara,
Cusco.
**S. caballa (DeLong & Freytag, 1969). Hacienda Mara, Cusco.
**S. defecta (DeLong & Freytag, 1969). Ro Urubamba, Cusco.
**S. fmbriella (DeLong & Freytag, 1969). Hacienda Mara,
Cusco.
**S. maculosa (DeLong & Freytag, 1969). Santa Isabel, Cusco.
S. serosa DeLong & Freytag, 1967. Pilcopata-Atalaya (Pau-
cartambo, 790m), 11.iii.2002, J. F. Costa col., trampa de luz.
Scaris sp. Santa Cruz, Salvacin (Manu, Madre de Dios,
300m), 10.viii.2003, A. Bustamante col.
Tenuacia DeLong, 1977
**T. rubera DeLong, 1977. Santa Isabel, Cusco; Hacienda
Mara, Cusco.
Tuberana DeLong & Freytag, 1971
T. tubera DeLong & Freytag, 1971. Pilcopata (Paucartambo,
565m), 11.x.1968, I. Ceballos col.
Tribu inCierTa
Grunchia Kramer, 1963
**G. grossa (Linnavuori, 1957). Callanga.
Subfamilia ledrinae
Tribu XeroPhloeini
Xerophloea Germar, 1839
X. viridis (Fabricius, 1794) [Cercopis]. Limatambo (Anta),
23.i.1982, E. Madera col.
Subfamilia meGoPhThalminae
Tribu aGallini
Anteriormente conocida como Subfamilia Agallinae, reci-
entemente reducida a categora de Tribu dentro de la Subfamilia
Megophthalminae (Dietrich, 2005).
Agallia Curtis, 1883
Agallia sp. Sahuayaco (La Convencin, 800m), 20.iii.1996, R.
Casafranca col.; Paucartambo-Pilcopata (Paucartambo, 1130m),
13.iii.2002, J. F. Costa col., trampa de luz. Trocha Unin, Ac-
janaco, Kosipata (Paucartambo, 2750m), 31.xii.2001, J. F.
Costa col., ex varios; Pilcopata-Atalaya (Paucartambo, 790m),
11.iii.2002, J. F. Costa col., trampa de luz; Esperanza-Pillahuata,
Kosipata (Paucartambo, 2900m), 27.vii.2003, J. F. Costa
col., ex varios;
Agalliopsis Kirkaldy, 1907
*A. atahualpa Linnavouri & DeLong, 1979. Machupicchu.
*A. bicuspidata Linnavouri & DeLong, 1979. Machupicchu.
A. cervina Oman, 1933. Paucartambo-Pilcopata (Paucart-
ambo, 950m), 12.iii.2002, J. F. Costa col., trampa de luz.
*A. peruviana Oman, 1933. Callanga.
*A. spinosa Linnavouri & DeLong, 1979. Machupicchu.
*A. vittata Linnavouri & DeLong, 1979. Machupicchu.
Subfamilia TyPhloCybinae
Tribu emPoaSCini
Empoasca Walsh, 1862
E. kraemeri Ross & Moore, 1957. Cusco. Citada por Carrasco
(1968).
Empoasca sp. 1. San Jernimo (San Jernimo, 3400m),
13.iv.2002, J. F. Costa col., ex Zea mays, ex Phaseolus vulgaris;
Perayoc (Cusco, 3360m), 04.viii.2002, J. F. Costa col., ex Escal-
lonia resinosa, ex gramneas; Tancarpata (San Sebastin, 3350m),
14.x.2002, J. F. Costa col., ex varios; Amadeo Repeto (Santiago),
05.xi.2002, W. Cosio col., ex varios; Pampallaqta, Lares (Calca,
3900m), 09.vii.2003, J. F. Costa col., ex gramneas; Esperanza-
Pillahuata, Kosipata (Paucartambo, 2900m), 15.xi.2003, J.
F. Costa col., ex gramneas; Cuncani, Lares (Calca, 3545m),
16.i.2004, J. F. Costa col., ex gramneas; Tambohuaylla, Lares
(Calca, 3510m), 17.i.2005, J. F. Costa col., ex Chenopodium
quinoa; Pumamarca (San Sebastin, 3350m), 16.vii.2005, J.
F. Costa col.
Empoasca sp. 2. San Jernimo (San Jernimo, 3400m),
13.iv.2002, J. F. Costa col., ex Zea mays, ex Phaseolus vulgaris;
Perayoc (Cusco, 3360m), 04.viii.2002, J. F. Costa col., ex Escal-
lonia resinosa, ex gramneas; Tancarpata (San Sebastin, 3350m),
14.x.2002, J. F. Costa col., ex varios; Amadeo Repeto (Santiago),
05.xi.2002, W. Cosio col., ex varios; Pampallaqta, Lares (Calca,
3900m), 09.vii.2003, J. F. Costa col., ex gramneas; Esperanza-Pil-
lahuata, Kosipata (Paucartambo, 2900m), 15.xi.2003, J. F. Costa
col., ex gramneas; Cuncani, Lares (Calca, 3545m), 16.i.2004, J.
F. Costa col., ex gramneas; Tambohuaylla, Lares (Calca, 3510m),
17.i.2005, J. F. Costa col., ex Chenopodium quinoa; Pumamarca
(San Sebastin, 3350m), 16.vii.2005, J. F. Costa col.
310
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
Subfamilia XeSToCePhalinae
Tribu PorTanini
Portanus Ball, 1932
*P. boliviensis (Baker, 1923). Vilcanota.
Portanus sp. Saqsayhuamn (Cusco, 3600m), 30.iii.2002, J.
F. Costa col., ex Baccharis polianta, ex gramneas, ex asterceas.
Discusin
Las especies de cigarritas descritas en el mundo sobrepasan las
23 mil (Dietrich 2006) aunque las publicaciones con descripcio-
nes de nuevas especies est en aumento (por ejemplo: Argentina
(Szwedo 2002); Brasil (Zahniser & Webb 2004, Takiya & Cav-
ichioli 2004, Carvalho & Cavichioli 2005); Colombia (Takiya
& Cavichioli 2004, Vargas 2006), Per (Lozada 1992c, 1992d,
2001; Lozada & Len 1996, Zahniser & Webb, 2004)).
En la regin Neotropical se tienen registradas ms de 4839
especies (Freytag & Sharkey 2002). En Per, dos listados de
especies de cicadlidos dieron 634 especies contenidas en 114
gneros (Lozada 1992b, 1997) lo que representara aproximada-
mente 13% de las especies registradas en el Neotrpico aunque
este porcentaje ha aumentado debido a los nuevos registros de
las especies y descripciones de especies nuevas de cicadlidos y
especies que no fueron citadas por Lozada (1992b, 1997); por
ejemplo: 17 especies de Empoasca de la Subfamilia Typhlocy-
binae (Langlitz 1964) y especies asociadas a plantas cultivadas
y silvestres (Ojeda et al. 1971), 3 especies nuevas de la Subfa-
milia Cicadellinae: Ladofa aguilari, Tortigonalia longicaudata,
Cephalogonalia blancasi (Lozada 1992c, 1992d; Lozada & Len
1996), 8 especies de Amblysellus de la Subfamilia Deltocephalinae
(Lozada 2001). Teniendo en cuenta este hecho, para Colombia
se reportaron 679 especies (Freytag & Sharkey 2002), mayor al
nmero de especies reportadas para Per. A pesar de esto, Per
puede contener un mayor nmero de especies ya que no se han
realizado estudios completos sobre cicadlidos.
De las 634 especies reportadas para Per por Lozada (1992b,
1997), 72 gneros y 136 especies fueron citadas para diferentes
localidades de Cusco. El nmero de especies de Cusco represen-
tan 21,5% de las especies registradas para Per. Actualmente, con
el presente reporte se incrementa a 111 gneros y 203 especies
registradas para Cusco.
Agradecimientos
Al Dr. Erick Ybar por su apoyo en el Laboratorio de En-
tomologa. Idea Wild contribuy con equipo de campo y la
Asociacin Biodiversidad y Desarrollo (B & D) provey apoyo
logstico. A aquellos investigadores que se dedicaron a la colecta
y estudio de cicadlidos en la regin Cusco.
Literatura citada
CarrascoZ.,F.1968.ListaPreliminardeInsectosdelDepartamento
de Entomologa. Rev.Fac.Ciencias,2:177-191.Cusco.
Carvalho A. N. & R. R. Cavichioli. 2005. Portanus aliceae sp. nov.
do Brasil (Hemiptera: Cicadellidae, Xestocephalinae).
Neotropical Entomology, 34(2): 251-254.
Costa J. F. & P. W. Lozada. 2004. Cigarritas (Homoptera: Cicadel-
lidae) en el Valle del Cusco. XLVI Convencin Nacional
de Entomologa, N 08. Arequipa.
Dietrich C. H. 2005. Keys to the families of Cicadomorpha and
subfamilies and tribes of Cicadellidae (Hemiptera: Auche-
norrhyncha). Florida Entomol., 88: 502-517.
Dietrich C.H. 2006. Guide to Subfamilies of Leafhoppers (Cicadel-
lidae). Center for Biodiversity. Illinois Natural History
Survey-INHS. Illinois. Pp. 44.
Dietrich C.H. & D. A. Dmitriev. 2003. Reassessment of the leafhop- Reassessment of the leafhop-
per tribes Koebeliini and Grypotini Haupt (Hemiptera: Ci-
cadellidae).Ann.Entomol.Soc.America,96(6):766775.
Dietrich C.H. & R.A. Rakitov. 2002. Some remarkable new Delto-
cephalinae leafhoppers (Hemiptera: Cicadellidae: Delto-
cephalinae) from the amazonian rainforest canopy. J. New
YorkEntomol.Soc.110:1-48.
Freytag P.H. and M.J. Sharkey. 2002. A preliminary list of the leaf-
hoppers (Homoptera: Cicadellidae) of Colombia. Biota
Colombiana, 3 (2): 235-283.
Langlitz E.R. 1964. The Economic Species of Empoasca in the
CoastalandSierraRegionsofPer.Rev.Per.Ent.7:54-70.
LozadaP.W.1992a.NotassobreCicadellidae(Homoptera)enplantas
forrajerasdeLoreto,Per.Rev.Per.Ent.35:24-26.
LozadaP.W.1992b.Cicadellidae(Homoptera)registradosparael
Per. I: Xestocephalinae,Agalliinae y Deltocephalinae.
Rev. Per. Ent. 35: 27-30.
Lozada P.W. 1992c. Una nueva especie de LadoffaYoung, 1977
(Homoptera: Cicadellidae). Rev. Per. Ent. 34: 61-62.
LozadaP.W.1992d.UnanuevaespeciedeTortigonaliaYoung,1977
(Homoptera: Cicadellidae). Rev. Per. Ent. 34: 63-64.
Lozada P.W. 1997. Cicadellidae (Homoptera) registrados para el
Per. II: Iassinae, Gyponinae y Cicadellinae. Rev. Per.
Ent. 40: 27-36.
Lozada P.W. 2001. Las especies sudamericanas del Gnero Ambly-
sellus SLEESMAN (Homoptera: Cicadellidae). En XLIII
Convencin Nacional de Entomologa, N 14. Huancayo.
LozadaP.W.,J.F.Costa&E.Ybar.2009.EstudioPreliminarde
las Cigarritas (Hemiptera: Cicadellidae) del Cusco,
Per.LConvencinNacionaldeEntomologa.Sociedad
Entomolgica del Per (SEP) y Universidad Nacional
JorgeBasadreGrohman(UNJBG).08-12Feb.Tacna,Per.
LozadaP.W.&C.LenA.1996.ElGneroCephalogonaliaEvans,
1947(Homoptera:Cicadellidae)enelPer.Rev.Per.Ent.
39:11-12.
McKamey S.H. 2007. Taxonomic catalogue of the leafhoppers
(Membracoidea). Part 1. Cicadellinae. Memoirs of the
AmericanentomolgicalInstitute78:394pp.
OjedaP.,C.Ruz&M.Castro.1971.Insectosdeldepartamentode
La Libertad y sus plantas hospederas cultivadas y silves-
tres. Rev. Mus. Hist. Nat., Departamento de Entomologa.
UniversidadNacionaldeTrujillo.Trujillo.
OrmacheaE.&D.Vidal.1994.EvaluacindeDalbulusmaidiscomo
principal vector del puca-poncho en cultivos de maz en el
Valle Sagrado de los Incas. Universidad Nacional de San
Antonio Abad del Cusco. Cusco.
Rasmussen C.,A. Lagnaoui & P. Esbjerg. 2003. Advances in the
Knowledge of Quinoa Pests. Foods Review International
19(1&2):61-75.
SantaMaraK.,K.Ziga&E.Nez.2001.Controletolgicode
Empoascasp.(Homoptera:Cicadellidae)eidentifcacin
decicadlidosencultivosdefrjol(Phaseolusvulgaris).
XLIII Convencin Nacional de Entomologa, N 78.
Huancayo.
Szwedo J. 2002. Studies on Xerophloeini leafhoppers with descrip-
tion of Pariacaca icanoensis gen. and sp. nov. from Argen-
tina (Hemiptera: Cicadomorpha: Cicadellidae: Ledrinae).
Genus 13 (2): 153-163.
Takiya D. M. & R. R. Cavichioli. 2004. A review of the Neotropi-
calsharpshootergenusOnegaDistant,1908(Hemiptera:
Cicadellidae:Cicadellini).Zootaxa,718:1-19.
Valdiviezo L., G. & J. A. Villarreal. 2002. Insectos que infestan las
principales plantas ornamentales en la ciudad de Piura.
XLIVConvencinNacionaldeEntomologa,N59.Piura.
311

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
Vargas R.J.M. 2004. Reconocimiento taxonmico del gnero
Soosiulus (Hemiptera, Auchenorrhyncha, Cicadellidae)
en Colombia. Universidad Nacional de Colombia. 10 pg.
Venero-Gonzales J. (1991)Trichogonia costata (Homoptera: Cic-
adellidae) en Buddleia coriacea (Loganiaceae). Rev. Per.
Ent. 34: 65-67.
YbarE.,E.Echegaray&E.Gianoli.2002.Insectpestsandnatural
enemies in two varieties of quinoa (Chenopodium quinoa)
at Cusco, Peru. J. Appl. Ent., 126: 275-280.
Young D.A. 1977. Taxonomic study of the Cicadellinae, Part II.
NorthCarol.Agric.Exp.Stat.Tech.Bull.,239:1-1135.
Zahniser J. & M.D. Webb. 2004. Placement of the Faltala Oman Leaf-
hopper Group (Hemiptera: Cicadellidae: Deltocephalinae)
with Descriptions of Three New Species. Ann. Entomol.
Soc.Am.,97(4):667-674.
Subfamilia Tribu Especie Longitud Latitud Altitud Localidad
Cicadellinae Cicadellini Acrulogonia incompta* -71.390 -12.910 800 Hacienda Mara*
Cicadellinae Cicadellini Acrulogonia incompta* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Amblyscarta opulenta -71.430 -13.170 950 Paucart-Pilcopata
Cicadellinae Cicadellini Amblyscarta modesta -71.300 -12.940 790 Atalaya
Cicadellinae Cicadellini Amblyscarta modesta -71.430 -13.170 950 Paucart-Pilcopata
Cicadellinae Cicadellini Amblyscarta obscura -71.300 -12.940 790 Atalaya
Cicadellinae Cicadellini Apulia resupinata* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Cicadellini Apulia hyala -71.560 -13.100 1400 San Pedro
Cicadellinae Cicadellini Apulia fora -71.430 -13.170 950 Paucart-Pilcopata
Cicadellinae Cicadellini Begonalia hydra* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Borogonalia crinata -71.980 -13.500 3600 Saqsayhuaman
Cicadellinae Cicadellini Borogonalia crinata -71.940 -13.540 3350 Tancarpata
Cicadellinae Cicadellini Borogonalia crinata -71.920 -13.510 3580 Pumamarca
Cicadellinae Cicadellini Borogonalia crinata -71.930 -13.530 3290 San Sebastin
Cicadellinae Cicadellini Borogonalia crinata -71.960 -13.520 3320 Wanchaq
Cicadellinae Cicadellini Borogonalia crinata -71.890 -13.510 3450 Santa Mara
Cicadellinae Cicadellini Borogonalia crinata -71.820 -13.560 3150 Saylla
Cicadellinae Cicadellini Borogonalia impressifrons -71.980 -13.500 3600 Saqsayhuaman
Cicadellinae Cicadellini Borogonalia impressifrons -71.940 -13.540 3350 Tancarpata
Cicadellinae Cicadellini Borogonalia impressifrons -71.920 -13.510 3580 Pumamarca
Cicadellinae Cicadellini Borogonalia impressifrons -71.930 -13.530 3290 San Sebastin
Cicadellinae Cicadellini Borogonalia impressifrons -71.960 -13.520 3320 Wanchaq
Cicadellinae Cicadellini Borogonalia impressifrons -71.890 -13.510 3450 Santa Maria
Cicadellinae Cicadellini Caragonalia carminata -72.550 -13.170 2450 Machupicchu*
Cicadellinae Cicadellini Cephalogonalia fabellula* -72.703 -12.836 1060 Quillabamba*
Cicadellinae Cicadellini Cephalogonalia fabellula -73.830 -12.510 1000 Pichari
Cicadellinae Cicadellini Cephalogonalia sp -73.830 -12.510 1000 Pichari
Cicadellinae Cicadellini Coronigoniella ostenta* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Cyclogonia praetextatula* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Cyclogonia scutellatula -71.590 -13.140 2400 Paucart-Pilcopata
Cicadellinae Cicadellini Cyclogonia sumai -71.560 -13.100 1400 San Pedro
Cicadellinae Cicadellini Cyclogonia sumai -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Cyclogonia sumai -71.580 -13.150 2900 Esperanza
Cicadellinae Cicadellini Cyclogonia sumai -71.790 -13.120 2628 Pillahuata
Cicadellinae Cicadellini Diedrocephala variegata* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Dilobopterus jemima -72.510 -12.680 800 Sahuayaco
Cicadellinae Cicadellini Dilobopterus jemima -71.590 -13.140 2400 Paucart-Pilcopata
Cicadellinae Cicadellini Dilobopterus jemima -72.150 -12.810 1618 Mirafores
Cicadellinae Cicadellini Dilobopterus jemima -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Dilobopterus jemima* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Dilobopterus jemima* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Dilobopterus obliquatulus* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Dilobopterus obliquatulus -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Erythrogonia amicula* -71.033 -14.483 4240 Vilcanota*
Cicadellinae Cicadellini Erythrogonia amicula* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Erythrogonia amicula -72.510 -12.680 800 Sahuayaco
Cicadellinae Cicadellini Erythrogonia aurivagula* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Eryhrogonia eburata* -71.033 -14.483 4240 Vilcanota*
Cicadellinae Cicadellini Erythrogonia imitatricula* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Erythrogonia imitatricula* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Cicadellini Erythrogonia kokomona* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Erythrogonia socialis* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Erythrogonia triplicula* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Erythrogonia triplicula -71.430 -12.980 565 Pilcopata
Apndice 1. Lista de especies de Cicadellidae y localidades reportadas incluyendo coordenadas y altitud. Las especies marcadas con aste-
risco fueron citadas en Lozada (1992b, 1997).
(Contina...)
312
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
Cicadellinae Cicadellini Erythrogonia triplicula -72.550 -13.170 2450 Machupicchu*
Cicadellinae Cicadellini Erythrogonia warsula* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Hortensia similis -72.510 -12.680 800 Sahuayaco
Cicadellinae Cicadellini Hortensia similis -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Iragua montana* -71.033 -14.483 4240 Vilcanota*
Cicadellinae Cicadellini Iragua perplexa* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Jakrama eureta* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Jozima leucopa -71.300 -12.940 790 Atalaya
Cicadellinae Cicadellini Jozima leucopa* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Juliaca bilineata* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Juliaca simoni* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Cicadellini Juliaca simoni* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Korigonalia cajana* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Lissoscarta nipata* -71.390 -12.910 800 Hacienda Mara*
Cicadellinae Cicadellini Macugonalia cavifrons -71.300 -12.940 790 Atalaya
Cicadellinae Cicadellini Macugonalia leucomelas -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Mesogonia callangana* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Mesogonia callangana -71.300 -12.940 790 Atalaya
Cicadellinae Cicadellini Mesogonia olivatula -71.300 -12.940 790 Atalaya
Cicadellinae Cicadellini Mesogonia retrorsa* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Mesogonia suspecta* -71.597 -13.321 3000 Paucartambo*
Cicadellinae Cicadellini Mesogonia tolosa* -71.430 -12.980 565 Pilcopata*
Cicadellinae Cicadellini Mucrometopia caudata* -71.033 -14.483 4240 Vilcanota*
Cicadellinae Cicadellini Onega bracteata -72.510 -12.680 800 Sahuayaco
Cicadellinae Cicadellini Onega bracteata -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Onega bracteata* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Onega sp -71.560 -13.100 1400 San Pedro
Cicadellinae Cicadellini Onega sp -71.590 -13.140 2400 Paucart-Pilcopata
Cicadellinae Cicadellini Oragua nusinasa* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Cicadellini Oragua nusinasa* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Oragua nusinasa* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Oragua partitula -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Pachitea habernula* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Pachitea ryma -71.569 -13.105 1300 Paucart-Pilcopata
Cicadellinae Cicadellini Pachitea ryma -71.430 -13.170 950 Paucart-Pilcopata
Cicadellinae Cicadellini Pachitea ryma* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Pachitea subfava -71.430 -13.170 950 Paucart-Pilcopata
Cicadellinae Cicadellini Pamplona spatulata* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Parinaeota bakeri* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Paromenia marginata -71.500 -13.210 1130 Paucart-Pilcopata
Cicadellinae Cicadellini Paromenia marginata* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Cicadellini Paromenia quimbayensis -71.600 -13.120 2750 Trocha Unin
Cicadellinae Cicadellini Paromenia quimbayensis -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Paromenia quimbayensis -71.580 -13.150 2900 Esperanza
Cicadellinae Cicadellini Paromenia quimbayensis -71.790 -13.120 2628 Pillahuata
Cicadellinae Cicadellini Pawiloma fulpae -72.550 -13.170 2450 Machupicchu*
Cicadellinae Cicadellini Pawiloma fulpae -72.886 -13.409 1600 Ucchuhuerta
Cicadellinae Cicadellini Pawiloma sirochia -71.600 -13.120 2750 Trocha Unin
Cicadellinae Cicadellini Punahuana dyscrita -71.600 -13.120 2750 Trocha Unin
Cicadellinae Cicadellini Punahuana dyscrita* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Punahuana dyscrita* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Ramosulus corrugipennis -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Ramosulus phaedrus -71.600 -13.120 2750 Trocha Unin
Cicadellinae Cicadellini Schildola ductilis* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Cicadellini Sibovia picchitula* -72.550 -13.170 2450 Machupicchu*
Cicadellinae Cicadellini Sibovia praevia* -71.980 -13.510 3400 Cusco*
Cicadellinae Cicadellini Sibovia aprica -72.150 -12.810 1618 Mirafores
Cicadellinae Cicadellini Soosiulus fammidulus* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Soosiulus seimunculus* -70.894 -13.503 1880 Marcapata*
Cicadellinae Cicadellini Stehlikiana halticula -72.550 -13.170 2450 Machupicchu*
Cicadellinae Cicadellini Stehlikiana halticula -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Stehlikiana halticula -71.590 -13.160 2400 Paucart-Pilcopata
Cicadellinae Cicadellini Tipuana expallida* -71.390 -12.910 800 Hacienda Mara*
Cicadellinae Cicadellini Tortigonalia torta* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Tortigonalia treva -71.430 -12.980 565 Pilcopata
Cicadellinae Cicadellini Tortigonalia treva* -71.540 -12.820 1500 Callanga*
Cicadellinae Cicadellini Trichogonia costata -71.960 -13.520 3320 Ttio
Subfamilia Tribu Especie Longitud Latitud Altitud Localidad
Apndice 1. Continuacin.
(Contina...)
313

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
Cicadellinae Cicadellini Trichogonia costata -71.580 -13.530 3380 Huancaro
Cicadellinae Cicadellini Trichogonia costata -71.980 -13.500 3600 Saqsayhuaman
Cicadellinae Cicadellini Trichogonia costata -71.990 -13.510 3520 Ticatica
Cicadellinae Cicadellini Trichogonia costata -71.940 -13.510 3340 Salineras
Cicadellinae Cicadellini Trichogonia costata -71.890 -13.560 3270 Pillao Matao
Cicadellinae Cicadellini Trichogonia costata -71.980 -13.510 3400 Cusco
Cicadellinae Cicadellini Trichogonia costata -71.840 -13.040 3340 Pampallaqta
Cicadellinae Cicadellini Trichogonia costata -71.650 -13.620 3600 Churubamba
Cicadellinae Cicadellini Zaruma decolorata* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini Abana horvathi* -71.980 -13.510 3400 Cusco*
Cicadellinae Proconiini Acrogonia stylata* -71.390 -12.910 800 Hacienda Mara*
Cicadellinae Proconiini Acrogonia stylata* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini Anacuerna centrolinea -71.940 -13.560 3100 Tipn
Cicadellinae Proconiini Anacuerna centrolinea -71.820 -13.560 3150 Saylla
Cicadellinae Proconiini Anacuerna centrolinea -71.959 -13.522 3340 Perayoc
Cicadellinae Proconiini Anacuerna centrolinea -71.990 -13.510 3520 Ticatica
Cicadellinae Proconiini Anacuerna centrolinea -71.920 -13.510 3580 Pumamarca
Cicadellinae Proconiini Anacuerna centrolinea -71.890 -13.560 3280 Pillao Matao
Cicadellinae Proconiini Anacuerna centrolinea -71.870 -13.540 3210 Kayra
Cicadellinae Proconiini Deselvana longipennis -71.430 -12.980 565 Pilcopata
Cicadellinae Proconiini Dicrophleps truncata -71.300 -12.940 790 Atalaya
Cicadellinae Proconiini Dicrophleps truncata* -71.390 -12.910 800 Hacienda Mara*
Cicadellinae Proconiini Dicrophleps truncata* -71.360 -13.000 540 Ro Kosipata*
Cicadellinae Proconiini Diestostemma blantoni* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini Diestostemma dolosum* -71.980 -13.510 3400 Cusco*
Cicadellinae Proconiini Diestostemma reticulatum* -71.980 -13.510 3400 Cusco*
Cicadellinae Proconiini Egidemia obtusata* -70.894 -13.503 1880 Marcapata*
Cicadellinae Proconiini Homoscarta boliviana -71.430 -12.980 565 Pilcopata
Cicadellinae Proconiini Homoscarta superciliaris* -71.980 -13.510 3400 Cusco*
Cicadellinae Proconiini Ichthyobelus bellicosus -72.510 -12.680 800 Sahuayaco
Cicadellinae Proconiini Molomea consorta* -71.020 -14.480 4240 Vilcanota*
Cicadellinae Proconiini Molomea guttulata -72.510 -12.680 800 Sahuayaco
Cicadellinae Proconiini Oncometopia venata -71.430 -12.980 565 Pilcopata
Cicadellinae Proconiini Oncometopia venata* -71.249 -12.684 441 Shintuya*
Cicadellinae Proconiini Oncometopia sp -71.430 -12.980 565 Pilcopata
Cicadellinae Proconiini Oncometopia sp -72.510 -12.680 800 Sahuayaco
Cicadellinae Proconiini Oncometopia sp -71.300 -12.940 790 Atalaya
Cicadellinae Proconiini Oncometopia sp -71.430 -13.170 950 Paucart-Pilcopata
Cicadellinae Proconiini Procandea andina* -70.894 -13.503 1880 Marcapata*
Cicadellinae Proconiini Procandea cordillerae* -71.980 -13.510 3400 Cusco*
Cicadellinae Proconiini Procandea inca -71.430 -12.980 565 Pilcopata
Cicadellinae Proconiini Procandea monticola* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Proconiini Procandea monticola* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini Procandea quechua* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini Procandea quechua* -71.980 -13.510 3400 Cusco*
Cicadellinae Proconiini Proconopera pullula* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini Proconosama haenschi -72.510 -12.680 800 Sahuayaco
Cicadellinae Proconiini Proconosama haenschi -71.560 -13.100 1400 San Pedro
Cicadellinae Proconiini Proconia marmorata -71.430 -12.980 565 Pilcopata
Cicadellinae Proconiini Pseudometopia irenae -71.560 -13.100 1400 San Pedro
Cicadellinae Proconiini Pseudometopia irenae* -71.550 -13.060 1590 Santa Isabel*
Cicadellinae Proconiini Pseudometopia irenae* -71.540 -12.820 1500 Callanga*
Cicadellinae Proconiini
Rhaphirrhinus
phosphoreus
-71.430 -12.980 565 Pilcopata
Deltocephalinae Deltocephalini Amplicephalus auranticus* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Deltocephalini Amplicephalus paradoxus* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Deltocephalini Mattogrossus colonoides* -70.740 -13.220 690 Quince Mil*
Deltocephalinae Deltocephalini Picchuia pungens* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Doraturini Icaia appendiculata -72.050 -13.390 3720 Huatata
Deltocephalinae Doraturini Icaia appendiculata* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Euscelini Andanus bimaculatus* -70.740 -13.210 690 Quince Mil*
Deltocephalinae Euscelini Atanus picchuanus* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Euscelini Bandaromimus fulvopictus -71.300 -12.940 790 Atalaya
Deltocephalinae Euscelini Chlorotettix sp -71.600 -13.120 2750 Trocha Unin
Deltocephalinae Euscelini Exitianus quadratulus* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Euscelini Paratanus exitiosus -72.260 -13.250 2842 Ollantaytambo
Deltocephalinae Euscelini Paratanus exitiosus -72.280 -13.250 2800 Chilca
Deltocephalinae Euscelini Paratanus exitiosus -72.080 -13.090 3545 Cuncani
Subfamilia Tribu Especie Longitud Latitud Altitud Localidad
Apndice 1. Continuacin.
(Contina...)
314
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
Deltocephalinae Euscelini Paratanus exitiosus -72.070 -13.110 3510 Tambohuaylla
Deltocephalinae Euscelini Paratanus exitiosus -71.230 -14.250 3600 Marangani
Deltocephalinae Euscelini Paratanus exitiosus -71.380 -14.166 3500 Sicuani
Deltocephalinae Euscelini Paratanus exitiosus -71.870 -13.540 3210 Kayra
Deltocephalinae Euscelini Paratanus exitiosus -71.140 -14.380 3600 Mamuera
Deltocephalinae Euscelini Paratanus exitiosus -72.110 -13.370 3600 Cruzpata
Deltocephalinae Euscelini Paratanus yusti -71.980 -13.500 3600 Saqsayhuaman
Deltocephalinae Euscelini Paratanus yusti -71.940 -13.540 3350 Tancarpata
Deltocephalinae Euscelini Paratanus yusti -71.880 -13.540 3240 San Jernimo
Deltocephalinae Euscelini Paratanus yusti -71.950 -13.520 3340 Perayoc
Deltocephalinae Euscelini Paratanus yusti -71.980 -13.520 3430 Santiago
Deltocephalinae Euscelini Paratanus yusti -71.920 -13.510 3580 Pumamarca
Deltocephalinae Euscelini Paratanus yusti -71.930 -13.530 3290 San Sebastin
Deltocephalinae Euscelini Paratanus yusti -71.870 -13.540 3210 Kayra
Deltocephalinae Euscelini Paratanus yusti -72.440 -13.470 2530 Limatambo
Deltocephalinae Euscelini Paratanus yusti -71.960 -13.520 3320 Wanchaq
Deltocephalinae Euscelini Paratanus yusti -71.890 -13.510 3450 Santa Maria
Deltocephalinae Euscelini Paratanus yusti -72.260 -13.250 2842 Ollantaytambo
Deltocephalinae Euscelini Paratanus yusti -72.280 -13.250 2800 Chilca
Deltocephalinae Euscelini Paratanus yusti -72.120 -13.300 2925 Urubamba
Deltocephalinae Euscelini Paratanus yusti -71.140 -14.380 3600 Mamuera
Deltocephalinae Euscelini Sinchonoa machua* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Euscelini Yungasia longipennis* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Hecalini Tenucephalus saggitarius* -72.550 -13.170 2450 Machupicchu*
Deltocephalinae Macrostelini Dalbulus maidis -72.260 -13.250 2842 Ollantaytambo
Deltocephalinae Macrostelini Picchusteles inca* -72.550 -13.170 2450 Machu Pichu*
Deltocephalinae Scaphytopiini Scaphytopius atrifrons* -72.550 -13.170 2450 Machu Pichu*
Deltocephalinae Tribu Incierta Amblysellus sp -71.880 -13.540 3240 San Jernimo
Deltocephalinae Tribu Incierta Amblysellus sp -71.950 -13.520 3340 Perayoc
Deltocephalinae Tribu Incierta Amblysellus sp -71.940 -13.540 3350 Tancarpata
Deltocephalinae Tribu Incierta Amblysellus sp -71.980 -13.520 3430 Santiago
Deltocephalinae Tribu Incierta Amblysellus sp -72.000 -13.150 3730 Pampacorral
Deltocephalinae Tribu Incierta Amblysellus sp -71.580 -13.150 2900 Esperanza
Deltocephalinae Tribu Incierta Amblysellus sp -72.080 -13.090 3545 Cuncani
Deltocephalinae Tribu Incierta Amblysellus sp -72.070 -13.110 3510 Tambohuaylla
Deltocephalinae Tribu Incierta Amblysellus sp -72.450 -13.480 2530 Limatambo
Deltocephalinae Tribu Incierta Bahita infuscata -71.430 -12.980 565 Pilcopata
Deltocephalinae Tribu Incierta Bahita infuscata -71.500 -13.210 1130 Paucart-Pilcopata
Deltocephalinae Tribu Incierta Bahita infuscata -71.300 -12.940 790 Atalaya
Deltocephalinae Tribu Incierta Bahita irrorata -71.500 -13.210 1130 Paucart-Pilcopata
Deltocephalinae Tribu Incierta Bahita irrorata -71.430 -13.170 950 Paucart-Pilcopata
Deltocephalinae Tribu Incierta Bahita sp -71.600 -13.120 2750 Trocha Unin
Deltocephalinae Tribu Incierta Haldorus sp -71.600 -13.120 2750 Trocha Unin
Deltocephalinae Tribu Incierta Neomesus sp -71.980 -13.500 3600 Saqsayhuaman
Deltocephalinae Tribu Incierta Neomesus sp -72.050 -13.390 3720 Huatata
Iassinae Gyponini Acuera nana -71.600 -13.120 2750 Trocha Unin
Iassinae Gyponini Acuera nana -71.300 -12.940 790 Atalaya
Iassinae Gyponini Acuera nana* -71.360 -13.000 540 Ro Kosipata*
Iassinae Gyponini Acuera sp -71.430 -13.170 950 Paucart-Pilcopata
Iassinae Gyponini Acuera sp -71.300 -12.940 790 Atalaya
Iassinae Gyponini Acuera sp -71.500 -13.210 1130 Paucart-Pilcopata
Iassinae Gyponini Acuponana enera* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Barbatana narda* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Chloronana decolora* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Chloronana orbicula -71.300 -12.940 790 Atalaya
Iassinae Gyponini Chloronana rotunda* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Costanana sp 1 -71.950 -13.520 3340 Perayoc
Iassinae Gyponini Costanana sp 2 -71.600 -13.120 2750 Trocha Unin
Iassinae Gyponini Costanana sp 2 -71.500 -13.210 1130 Paucart-Pilcopata
Iassinae Gyponini Costanana sp 2 -71.430 -13.170 950 Paucart-Pilcopata
Iassinae Gyponini Costanana sp 2 -71.590 -13.140 2400 Paucart-Pilcopata
Iassinae Gyponini Culumana bacula* -72.550 -13.170 2450 Machupicchu*
Iassinae Gyponini Culumana concava* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Culumana dualana* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Curtara picchua* -72.550 -13.170 2450 Machupicchu*
Iassinae Gyponini Curtara suffara* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Folicana nota* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Folicana nota* -71.540 -12.820 1500 Callanga*
Subfamilia Tribu Especie Longitud Latitud Altitud Localidad
Apndice 1. Continuacin.
(Contina...)
315

Cicadellidae de Cusco
Rev. peru. biol. 17(3): 303 - 316 (December 2010)
Iassinae Gyponini Fuminana astra* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Fuminana lira* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Gypona adita* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Gypona fsura* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Gypona glauca -71.600 -13.120 2750 Trocha Unin
Iassinae Gyponini Gypona nacula* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Gypona nigrena* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Gypona quadrina* -72.550 -13.170 2450 Machupicchu*
Iassinae Gyponini Gypona quadrina -71.430 -12.980 565 Pilcopata
Iassinae Gyponini Gypona solata* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Gyponana alicata -71.430 -12.980 565 Pilcopata
Iassinae Gyponini Gyponana alicata -71.300 -12.940 790 Atalaya
Iassinae Gyponini Hecalapona apicella* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Hecalapona berna* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Hecalapona crinata* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Hecalapona eruva* -70.740 -13.220 690 Quince Mil*
Iassinae Gyponini Hecalapona forceps* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Hecalapona huella* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Hecalapona scella* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Nullana sinchona* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Nullana verdana* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Polana bulba* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Polana concinna* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Polana falsa* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Polana fetera* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Polana fetera* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Polana icara -71.500 -13.210 1130 Paucart-Pilcopata
Iassinae Gyponini Polana icara* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Polana inimicus* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Polana lanara* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Polana lanara* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Polana resupina* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Polana scruta* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Polana sp -71.500 -13.210 1130 Paucart-Pilcopata
Iassinae Gyponini Polana sp -71.430 -13.170 950 Paucart-Pilcopata
Iassinae Gyponini Polana sp -71.580 -13.150 2900 Esperanza
Iassinae Gyponini Polana sp -71.790 -13.120 2628 Pillahuata
Iassinae Gyponini Ponana atea* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Ponana avena* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Ponana berta* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Ponana cerosa* -71.790 -13.120 2628 Pillahuata*
Iassinae Gyponini Ponana cerosa* -71.597 -13.320 2977 Paucartambo*
Iassinae Gyponini Ponana hilara* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Ponana perusana* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Ponana sp -71.600 -13.120 2750 Trocha Unin
Iassinae Gyponini Ponana sp -71.590 -13.160 2400 Paucart-Pilcopata
Iassinae Gyponini Ponana sp -71.500 -13.210 1130 Paucart-Pilcopata
Iassinae Gyponini Ponana sp -71.430 -13.170 950 Paucart-Pilcopata
Iassinae Gyponini Ponanella rubravenosa* -71.540 -12.820 1500 Callanga*
Iassinae Gyponini Scaris amputa* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Scaris caballa* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Scaris defecta* -72.139 -13.301 2900 Ro Urubamba*
Iassinae Gyponini Scaris fmbriella* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Scaris maculosa* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Scaris serosa -71.300 -12.940 790 Atalaya
Iassinae Gyponini Scaris serosa -71.350 -12.850 300 Santa Cruz
Iassinae Gyponini Tenuacia rubera* -71.550 -13.060 1590 Santa Isabel*
Iassinae Gyponini Tenuacia rubera* -71.390 -12.910 800 Hacienda Mara*
Iassinae Gyponini Tuberana tubera -71.430 -12.980 565 Pilcopata
Iassinae Iassini Grunchia grossa* -71.540 -12.820 1500 Callanga*
Ledrinae Xerophloeini Xerophloea viridis -72.440 -13.470 2530 Limatambo
Megophthalminae Agalliini Agallia sp -72.510 -12.680 800 Sahuayaco
Megophthalminae Agalliini Agallia sp -71.500 -13.210 1130 Paucart-Pilcopata
Megophthalminae Agalliini Agallia sp -71.300 -12.940 790 Atalaya
Megophthalminae Agalliini Agallia sp -71.600 -13.120 2750 Trocha Unin
Megophthalminae Agalliini Agallia sp -71.580 -13.150 2900 Esperanza
Megophthalminae Agalliini Agallia sp -71.790 -13.120 2628 Pillahuata
Megophthalminae Agalliini Agalliopsis atahualpa* -72.550 -13.170 2450 Machupicchu*
Subfamilia Tribu Especie Longitud Latitud Altitud Localidad
Apndice 1. Continuacin.
(Contina...)
316
Costa & Lozada
Rev. peru. biol. 17(3): 303 - 316 (Diciembre 2010)
Megophthalminae Agalliini Agalliopsis bicuspidata* -72.550 -13.170 2450 Machupicchu*
Megophthalminae Agalliini Agalliopsis cervina -71.430 -13.170 950 Paucart-Pilcopata
Megophthalminae Agalliini Agalliopsis peruviana* -71.540 -12.820 1500 Callanga*
Megophthalminae Agalliini Agalliopsis spinosa* -72.550 -13.170 2450 Machupicchu*
Megophthalminae Agalliini Agalliopsis vittata* -72.550 -13.170 2450 Machupicchu*
Typhlocybinae Empoascini Empoasca sp -71.980 -13.500 3600 Saqsayhuaman
Typhlocybinae Empoascini Empoasca sp -71.940 -13.540 3350 Tancarpata
Typhlocybinae Empoascini Empoasca sp -71.920 -13.510 3580 Pumamarca
Typhlocybinae Empoascini Empoasca sp -71.930 -13.530 3290 San Sebastin
Typhlocybinae Empoascini Empoasca sp -71.960 -13.520 3320 Wanchaq
Typhlocybinae Empoascini Empoasca sp -71.890 -13.510 3450 Santa Maria
Typhlocybinae Empoascini Empoasca sp -71.820 -13.560 3150 Saylla
Typhlocybinae Empoascini Empoasca sp -71.430 -12.980 565 Pilcopata
Typhlocybinae Empoascini Empoasca sp -71.580 -13.150 2900 Esperanza
Typhlocybinae Empoascini Empoasca sp -71.790 -13.120 2628 Pillahuata
Typhlocybinae Empoascini Empoasca sp -71.960 -13.520 3320 Ttio
Typhlocybinae Empoascini Empoasca sp -71.580 -13.530 3380 Huancaro
Typhlocybinae Empoascini Empoasca sp -71.990 -13.510 3520 Ticatica
Typhlocybinae Empoascini Empoasca sp -71.940 -13.510 3340 Salineras
Typhlocybinae Empoascini Empoasca sp -71.890 -13.560 3270 Pillao Matao
Typhlocybinae Empoascini Empoasca sp -71.980 -13.510 3400 Cusco
Typhlocybinae Empoascini Empoasca sp -71.840 -13.040 3340 Pampallaqta
Typhlocybinae Empoascini Empoasca sp -71.940 -13.560 3100 Tipn
Typhlocybinae Empoascini Empoasca sp -71.959 -13.522 3340 Perayoc
Typhlocybinae Empoascini Empoasca sp -71.870 -13.540 3210 Kayra
Typhlocybinae Empoascini Empoasca sp -72.050 -13.390 3720 Huatata
Typhlocybinae Empoascini Empoasca sp -72.260 -13.250 2842 Ollantaytambo
Typhlocybinae Empoascini Empoasca sp -72.280 -13.250 2800 Chilca
Typhlocybinae Empoascini Empoasca sp -72.080 -13.090 3545 Cuncani
Typhlocybinae Empoascini Empoasca sp -72.070 -13.110 3510 Tambohuaylla
Typhlocybinae Empoascini Empoasca sp -71.230 -14.250 3600 Marangani
Typhlocybinae Empoascini Empoasca sp -71.380 -14.166 3500 Sicuani
Typhlocybinae Empoascini Empoasca sp -72.440 -13.470 2530 Limatambo
Typhlocybinae Empoascini Empoasca sp -72.120 -13.300 2925 Urubamba
Typhlocybinae Empoascini Empoasca sp -72.000 -13.150 3730 Pampacorral
Typhlocybinae Empoascini Empoasca sp -72.140 -13.460 3680 Izcuchaca
Typhlocybinae Empoascini Empoasca sp -71.540 -13.820 3220 Quiquijana
Typhlocybinae Empoascini Empoasca sp -72.040 -13.010 3500 Ccachin
Typhlocybinae Empoascini Empoasca sp -72.020 -13.050 3300 Choquecancha
Typhlocybinae Empoascini Empoasca sp -72.250 -13.450 3300 Zurite
Typhlocybinae Empoascini Empoasca sp -72.250 -13.480 3400 Yanama
Typhlocybinae Empoascini Empoasca sp -71.980 -13.550 3450 Ccachona
Typhlocybinae Empoascini Empoasca sp -71.970 -13.550 3450 Chocco
Typhlocybinae Empoascini Empoasca sp -71.140 -14.380 3600 Mamuera
Typhlocybinae Empoascini Empoasca sp -71.880 -13.540 3240 San Jernimo
Xestocephalinae Portanini Portanus boliviensis* -71.020 -14.480 4240 Vilcanota*
Xestocephalinae Portanini Portanus sp -71.980 -13.500 3600 Saqsayhuaman
Subfamilia Tribu Especie Longitud Latitud Altitud Localidad
Apndice 1. Continuacin.
317

Especies de Prosopis de las costas de Per y Ecuador
Rev. peru. biol. 17(3): 317 - 323 (December 2010)
Rev. peru. biol. 17(3): 317 - 323 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Anlisis numrico de las especies de Prosopis L. (Fabaceae) de
las costas de Per y Ecuador
Alicia D. Burghardt
1,2
, M. Magdalena Brizuela
1,2
, M. Pa Mom
1
, Luis Albn
3
y
Ramn A. Palacios
1,2
Numerical analysis of Prosopis L. (Fabaceae) species from the coasts of
Peru and Ecuador
1 Departamento de Biodiversidad
y Biologa Experimental, Facultad
de Ciencias Exactas y Naturales,
Universidad de Buenos Aires. Pa-
belln 2 - 4 piso - Laboratorio 11
Int. Giraldes y Costanera Norte.
Ciudad Universitaria 1428, Buenos
Aires. Repblica Argentina.
2 Consejo Nacional de Investi-
gaciones Cientficas y Tcnicas
(CONICET) Repblica Argentina
3 Naturaleza y Cultura Internacio-
nal - Per.
Email Alicia Burghardt: alibu@
bg.fcen.uba.ar
Email Mara Magdalena Brizuela:
brizuela@bg.fcen.uba.ar
Email Ramn Palacios: palacios@
bg.fcen.uba.ar
Presentado: 22/03/2010
Aceptado: 24/09/2010
Publicado online: 00/11/2010
Introduccin
Los algarrobos, Prosopis L. (Fabaceae), de la costa peruano-
ecuatoriana han tenido varias revisiones, siendo las ms recientes
las de Burkart (1976), Ferreyra (1987), Daz Celis (1995) y
Pasiecznick et al. (2001); estos autores concuerdan que P. julifora
(SW) DC, y P. pallida (Humb. et Bonpl. ex Willd.) Kunth son las
especies comunes en la zona. Ferreyra (1987), incluy adems a P.
afnis Sprengel, aunque la presencia de esta ltima especie en la
zona de estudio planteaba ciertas dudas, ya que su distribucin,
en la Cuenca del Plata (Uruguay, Argentina, Paraguay y Brasil),
est asociada a un clima mucho ms hmedo, por lo que Daz
Celis (1995) y Pasiecznick et al. (2001) la consideraron como
una identifcacin incorrecta.
Mom et al. (2002) sealaron la presencia de P. pallida y P. li-
mensis Bentham en la Regin Grau. Prosopis limensis fue incluida
como sinonimia de P. pallida por Burkart (1976), sin embargo
Mom et al. (2002) indican que existen las dos entidades y que
se corresponden con los tipos de las especies antes citadas.
El presente trabajo es continuacin del realizado por Mom
et al. (2002); y realiza un anlisis de las especies de algarrobos
desde Tacna a Zarumilla en Per, y en Ecuador desde Huasqui-
llas a Manta; con la fnalidad de estudiar la posible presencia
de P. afnis y de P. julifora en reas en las cuales se sealaba su
presencia. Se utilizan caracteres cuantitativos foliares, los que
son considerados importantes y efcaces para distinguir las es-
pecies de Prosopis (Daz Celis 1995, Harris et al. 2003); adems
los caracteres foliares pueden proporcionar una valiosa gua de
campo para identifcacin de especies (Pasiecznick et al. 2001)
Material y mtodos
Material estudiado.- Se realiz un viaje de coleccin desde
Tacna (Per) a Manta (Ecuador) en febrero de 2001, con el fn
de obtener muestras de Prosopis (ejemplares de herbario). En la
Tabla 1 se indican la informacin de las muestras utilizadas y los
herbarios donde estn depositadas: Herbario del Departamento
de Ciencias Biolgicas de la Facultad de Ciencias Exactas y Na-
turales de la Universidad de Buenos Aires (BAFC) y Herbarium
Truxillense de la Universidad Nacional de Trujillo (HUT).
Adems se examin material de varios herbarios, que no
fueron incluidos en el anlisis numrico:
Prosopis pallida
Per:
Tipo: Amrica Meridional. Per Humboldt & Bonpland s/n (Foto Her-
bario Willdenow 19131, Museo Botanicum Berolinense B).
Dpto. Amazonas. Prov. Bagua, P. Hutchinson 1501 (F); Casero
Shuape. Ferr. Holle, Viceland, Chicoana 20581. 16/X, 1986 (USM).
Dpto. Piura, Prov. Paita. 3 a 4 km E of Talara. 20 msn. O. Horton 11587.
4/IV/1939 (F); Prov. Piura, Talara. J. Campos s/n, 1/X/1981 (USM);
Santa Clara, Sechura, Plaza de Armas. R. Ferreyra J. Vilela
20041, 20042 (USM); Prov. Sullana, Sullana, campo reforestacin
El Algarrobo. R. Ferreyra, Aguilar 19319 (USM); Savana. R.
Ferreyra 19143 A (USM); El Algarrobo, S. Valdivia A. Montesi-
nos 6. 19/I/1979 (USM); El Algarrobo, R. Ferreyra 19125 (USM).
Dpto. Lima, Parque Montero, F. Encarnacin 163 (USM).
Dpto. Lambayeque, Prov. Lambayeque. Distrito Olmos, Racal. V.
Chavez s/n (USM). A.Weberbauer 6172 (F). Negritos. Oscar
Haught 1928 (F).
Dpto. Tumbes, cerca de Bocapn. R. Ferreyra, E. Cerrate, O. Tovar
10555. 24/IV/1955 (MO); Prov. Tumbes R. Lao s/n (F).
Resumen
Diferentes revisiones coinciden en sealar 2 o 3 especies de Prosopis para el sur de Ecuador y norte de Per:
P. julifora (SW) DC, P. pallida (Humb. et Bonpl. ex Willd.) Kunth y P. affnis Sprengel. En el presente trabajo
se informa del anlisis cuantitativo de caracteres foliares de especmenes del genero Prosopis, recolectados
a lo largo de la costa desde Arequipa (Per) a Manta (Ecuador). Los resultados sealan tres grupos bien
defnidos. Del anlisis comparativo de los tipos y ejemplares de herbario de todas las especies y sinnimos
citados para la zona de estudio surge que los taxones existentes son: P. pallida, P. limensis Bentham, ambos
de amplia distribucin, y P. chilensis (Molina) Stuntz emend Burkart restringido al valle del ro Caman. Estos
tres taxones se corresponden con los tres grupos obtenidos del anlisis numrico. Debe sealarse la exclusin
del rea de P. julifora y P. affnis. Se sugiere no utilizar las numerosas variedades sealadas para P. pallida.
Palabras claves: Caracteres foliares, anlisis numrico, Prosopis, algarrobos, Algarobia, Fabaceae.
Abstract
To the south of Ecuador and northern Peru is indicated the presence of 2 or 3 species of Prosopis: P. julifora
(SW) DC, P. pallida (Humb. et Bonpl. ex Willd.) Kunth and P. affnis Sprengel. In this paper we report the results
of quantitative analysis of leaf characters of specimens of the genus Prosopis, collected along the coast from
Arequipa (Peru) to Manta (Ecuador). The results point out three well defned groups. When we compare all
the species and synonymous mentioned for the study zone with our results, conclude that are: P. pallida, P.
limensis Bentham (both with a wide distribution) and P. chilensis (Molina) Stuntz emend Burkart restricted to
the Camana river valley. It is pointed out the exclusion from the area of P. julifora and P. affnis. We suggested
that the several varieties mentioned for P. pallida should not be used for the moment.
Keywords: Foliar characters, numerical analysis, Prosopis, algarrobos, Algarobia, Fabaceae.
318
Burghardt et al.
Rev. peru. biol. 17(3): 317 - 323 (Diciembre 2010)
Tabla 1. Informacin de las muestras utilizadas en el anlisis de taxonoma numrica de las especies de Prosopis L. (Fabaceae) de las costas
de Per y Ecuador, se indican los herbarios donde estn depositadas.
Pais Localidad Lugar Coordenadas Fecha Nmero de muestra (Herbario)
E
c
u
a
d
o
r
Guayas Colonche 16/02/2002 3306 (BAFC,HUT)
Manab Ro Chico a Rocafuerte 15/02/2002 3302 (BAFC,HUT)
Manab Rocafuerte a Manta 15/02/2002 3303, 3304 (BAFC,HUT)
Manab Machalilla 16/02/2002 3305 (BAFC,HUT)
Loja Casanga empalme 19/02/2002 3311 (BAFC,HUT)
Loja Sabanilla a Zapatillo 20/02/2002 3312 (BAFC, HUT)
Loja Sabanilla a La Ceiba 20/02/2002 3313, 3314 (BAFC, HUT)
Loja La Ceiba 20/02/2002 3315, 3316 (BAFC, HUT)
DelOro Huaquilla, Santa Rosa. 13/02/2002 3293, 3294 (BAFC, HUT)
Guayas Puerto Inca, Guayaquil. 13/02/2002 3295, 3296 (BAFC, HUT)
Guayas Guayaquil-Santa Elena. 14/02/2002 3297, 3298 (BAFC, HUT)
Manabi Pto. Cayo-Jipijapa. 15/02/2002 3299 (BAFC, HUT)
Manabi Ro Chico-Rocafuerte. 15/02/2002 3300, 3301 (BAFC, HUT)
Loja Catamayo, La Toma. 19/02/2002 3307 (BAFC, HUT)
Loja Casanga, cruzando el ro Playas. 19/02/2002 3308, 3309, 3310 (BAFC, HUT)
P
e
r

Tumbes Alrededores de Puerto Pizarro. 33049S 802306W 21/02/2010 3110 (BAFC)


Piura
A 15 km del casero Santa Ana, carretera a Piura, margen
izquierda del ro Piura.
45642S 802210W 21/02/2010 3101 (BAFC)
Piura Tambo Grande, camino al casero Locuto, Vega de la Ardilla 45737S 802347W 21/02/2010 3098 (BAFC)
Piura
Tambo Grande, camino al casero El Carmen, comunidad
campesina San Juan Bautista de Locuto, km 21 de antigua
carretera Panamericana.
45937S 802347W 23/02/2010 3097 (BAFC)
Piura Coln, Iglesia de Coln. 50013S 810318W 18/02/2010 3065 (BAFC)
Piura Paita, Centro Recreativo del Club de Leones. 50540S 810439W 19/02/2010 3064 (BAFC)
Piura Casero Santa Rosa del 32. 50813S 802105W 21/02/2010 3095 (BAFC)
Piura Castilla, antigua panamericana Chiclayo Piura Km 235. 50920S 802209W 21/02/2010 3096 (BAFC)
Piura Antigua Panamericana Chiclayo Piura. Km 202. 51000S 800855W 21/02/2010 3094 (BAFC)
Piura Cruce El Trbol, carretera Piura-Paita-Sullana. 51003S 804118W 18/02/2010 3073 (BAFC)
Piura Cruce El Trbol, carretera Piura-Paita-Sullana. 51003S 804118W 18/02/2010 3072 (BAFC)
Piura Piura, campus de la Universidad de Piura. 51016S 803806W 17/02/2010 3059, 3062 (BAFC)
Piura Piura, campus de la Universidad de Piura. 51016S 803806W 17/02/2010 3058, 3060, 3061 (BAFC)
Piura Chulucanas, camino a Casero Alto el Gallo 51105S 801108W 21/02/2010 3092 (BAFC)
Piura
Morropn, La Matanza, antigua Panamericana carretera
Chiclayo Piura km 188.
51616S 800553W 20/02/2010 3089 (BAFC)
Piura Sechura, carretera a manglar de San Pedro. 52009S 805112W 19/02/2010 3075 (BAFC)
Piura Dist. Vice, Manglar de San Pedro. 53058S 805321W 19/02/2010 3074 (BAFC)
Piura Dist. Sechura, Plaza de Armas, cerca del local parroquial. 53315S 804915W 19/02/2010 3076 (BAFC)
Piura Inmediaciones de la ciudad de Sechura. 53318S 804902W 19/02/2010 3077, 3078 (BAFC)
Piura Casero Belisario. 55036S 802650W 20/02/2010 3083, 3084 (BAFC)
Piura Carretera Chiclayo Bayovar. 55055S 805855W 19/02/2010 3079 (BAFC)
Piura Carretera Sechura Bayovar Km 33. 55105S 805331W 19/02/2010 3080, 3081, 3082 (BAFC)
Piura
Olmos, casero Ancol Chico, margen derecha del ro Cascajal,
camino a Olmos.
55435S 800023W 20/02/2010 3086, 3087 (BAFC)
Piura
Casero Cerro de Arena, margen derecha del ro Cascajal,
camino a Olmos.
55517S 801210W 20/02/2010 3085 (BAFC)
Piura Piura. Sullana km 1007. 12/02/2002 3287 (BAFC, HUT)
Piura Ruta a Sullana Paita km 16. 18/02/2001 3068 (BAFC, HUT)
Piura Las Lomas km. 1026 . 12/02/2002 3289, 3290, 3292 (BAFC, HUT)
Piura La Tina. 21/02/2002 3317 (BAFC, HUT)
Piura Piura Sullana km 1007. 12/02/2002 3288. (BAFC, HUT)
Piura Las Lomas km 1026. 12/02/2002 3291. (BAFC, HUT)
Ancash Entrada a Huarmey. 08/02/2002 3284. 3285 (BAFC, HUT)
Ancash Entrada a Huarmey II/2002. 08/02/2002 3283 (BAFC, HUT)
Ancash Casma, puente Carrizal. 08/02/2002 3286 (BAFC, HUT)
Ica Valle ro Poroma, ruta 5 km 467, sur de Nazca. 07/02/2002 3280 (BAFC, HUT)
Ica Valle ro Poroma, ruta 5 km 466, sur de Nazca. 08/02/2002 3281 (BAFC, HUT)
Ica Valle ro Poroma, ruta 5 km 458, sur de Nazca. 08/02/2002 3282. (BAFC, HUT)
Arequipa Prov. Castilla, Punta Colorada, Ro Majes. 07/02/2002 3274, 3275, 3276 (BAFC, HUT)
Arequipa 10 km al norte de Caman, Paso Hawai. 07/02/2002 3277,3278(BAFC,HUT)
319

Especies de Prosopis de las costas de Per y Ecuador
Rev. peru. biol. 17(3): 317 - 323 (December 2010)
Ecuador:
Prov. Loja, on the Catacocha-Macar, C. 7 km N of the cross-road
to Celica, 600 msn. G. Harling, L. Anderson 18199, 12/IV/1980
(MO); Macar, J. Hart 1099 (MO); La Toma, Anne Macey 118,
VII/1975 (LOJA); La Toma, 1400 msm, R. Espinosa 491, 5/VI/1946
(LOJA); 8 km. de Zapotillo 418S y 8014W, A. Zamaniego y F.
Vivar 30 (LOJA); Gonzanam, Nambacola, El Hmedo 4247S
y 793048W, 4/II/1980, F. Vivar 1119 (LOJA); Macar- Zapotillo,
Km. 13, 700-750 msm 41993S y 795989W, G. Lewis, P. Lo-
zano 3048 III/1997, (LOJA); Celica, Quebrada Yaraco, 4835S y
795020W, L. Emperaire 1224 (LOJA).
Prov. Guayas, Ancn, G. Harling, G. Storm & B. Strn 8818, 29-30/
IV/1968 (MO); Santa Elena 18/11/1974, Al Gentry 10017 (MO, NY).
Prov. Manab, Baha de Carquez, G. Harling, G. Storm & B. Strm
9453 (MO).
Prov. Oro, Machala, Playa Los Cocos, Luz F. Vivar 716 (LOJA).
Prosopis limensis
Per:
Tipo: Per, Lima et Per septentrionalis. Cuming 974 (K) (foto US
ex K).
Ro Apurimac, A. Weberbauer 5366 (F), 5907 (F).
Yautan, Mac Bride y Featherstone 2563 (F).
Dpto. Ica, Prov. Nazca, bosque de Jumana. J. Aguilar Gallardo s/n
(USM); Prov. Ica, Pampas de Ocucaje, R. Ferreyra 1382 (USM).
Dpto. Piura Prov. Sullana, El Algarrobo, S. Valdivia A. Montesinos
1,3 (USM); R. Ferreyra 19122 (USM).
Dpto. Arequipa, Prov. Islay, Loma de Mollendo, R. Ferreyra 12072
(USM).
Dpto. Tumbes, Prov. Tumbes, Punta Mal Pazo, R. Ferreyra 18966
(USM); Prov. Zarumillo, entre Zarumillo y El Salto, R. Ferreyra
10749, 29/IV/1955 (MO).
Prosopis chilensis
Per:
Dpto Cuzco, Prov. Anta Sisal Cumyacc, C. Vargas 007410 (USM);
Prov. La Convencin, valley of Ro Vilcanota near Quillabamba,
1010 msn. Y. Mescia 8026. 9/05/1938 (F).
Dpto. Arequipa, Prov. Castilla. Isla el rescate, antes de Aplao, Aguilar
Gallardo s/n (USM); Aplao, cultivado, Jaime Aguilar Gallardo s/n
11/XII/1982. (USM); Aplao, Lomas cerca de las chacras de arroz,
Jos Aguilar Gallardo s/n 11/XII/1982 (USM).
Aplao B. Simpson 8575 A. (USM); Castilla, 10 Km. N Aplao, B. Simp-
son 86753 17/I/1977 (USM)
Hda. Potrero, C. Vargas 2041, 8/VIII/1940 (USM); A. Weberbauer
5919 (F).
Mtodos
Los ejemplares colectados fueron analizados registrando los
siguientes caracteres foliares: longitud total de la hoja (cm);
longitud del pecolo (cm); nmero de pares de pinas primarias;
longitud de la pina primaria (cm); ancho de la pina (cm), nmero
de pares de fololos de la pina; distancia entre fololos (mm);
largo del fololo (mm) y ancho del fololo (mm).
Se realizaron 10 mediciones en cada individuo y con estos
datos se calcul la media por individuo para cada uno de los
caracteres. Con ella, se construy una matriz bsica de datos
de individuos por caracteres. Sobre la base de esta ltima se
construy una matriz de distancias (Cuadrado de las Distancias
Euclideas) y se aplic el mtodo de agrupamiento de medias no
ponderadas (UPGMA). Los anlisis numricos fueron realizados
utilizando el paquete estadstico STATISTICA.
Resultados
Las medias por individuo se consignan en el Apndice 1. La
Figura 1 muestra el fenograma obtenido mediante el UPGMA.
Se observan claramente 3 grupos: A, B y C. El B1, se une al A-B
y corresponde a materiales colectados en regiones del norte de
Ecuador con mayores precipitaciones.
Los clusters A y B corresponden respectivamente a P. limensis
y P. pallida. El cluster C agrupa a un nmero de individuos
identifcables como P. chilensis.
Esta informacin permite establecer una clave dicotmica
para separar los taxones:
3058
3285LI
3079
3097
3084
3065
3087
3282LI
3286LI
3060
3280LI
3072
3064
3081
3098
3082
3083
3085
3086
3096
3061
3288-59P
3075
3080
3077
3284PA
3078
3281LI
3291-62
3059
3071
3089
3110
3062
3095
3283PA
3299-70P
3073
3074
3068
3302-73P
3094
3076
3101
3092
3287-58P
3306-77P
3316-87?
3297-68P
3290-61P
3305-76P
3292-63
3303-74P
3289-60P
3298-69P
3294-65P
3301-72P
3295-66P
3300-71
3296-67
3304-75P
3307-78P
3309-80?
3311-82?
3293-64P
3312-83?
3317-88?
3313-84?
3308-79?
3310-81?
3314-85?
3277CH
3278CH
3315-86
3276CH
3275CH
3274CH
Distancia de ligamiento
10
20 30
40 50
0
B1
C
B
A
Figura 1. Fenograma construido con los caracteres foliares de Pro-
sopis recolectados en la costa del norte de Per y sur de Ecuador.
Cuadrado de las Distancias Euclideanas, mtodo de agrupamiento
UPGMA.
320
Burghardt et al.
Rev. peru. biol. 17(3): 317 - 323 (Diciembre 2010)
Figura 2. Prosopis chilensis A: aspecto general, x = 1 cm.; B fruto,
x= 1cm
A.- Fololos en general menores de 12 mm de longitud, pubrulos, distancia
entre fololos 1,04,4 mm.
B.- rbol con ramas principales algo fastigiadas (45 o menos), ramas terminales
casi rectas, horizontales; braquiblastos poco desarrollados, con pocas hojas (13);
hojas en general mayores de 6 cm long; fololos en general mayores de 7 mm
long (710 mm). 1. P. pallida
B.- rbol con ramas principales a 45 o ms, ramas terminales fexuosas, algo
pndulas, braquiblastos muy desarrollados, con muchas hojas (310); hojas en
general menores de 6 cm long.; fololos en general menores de 7 mm long.
2. P. limensis
A.- Fololos en general mayores de 12 mm de longitud, glabros, distancia entre
fololos 3,46,8 mm. 3. P. chilensis
Prosopis pallida (Humb. et Bonpl. ex Willd.) Kunth. 1823.
Nov. Gen. sp. Pl. 6: 306.
Iconografa: Mom et al. 2002.
Nombre comn: Algarrobo cholo. No existe informacin
que introduzca cambios en la descripcin publicada por Mom
et al. (2002)
Prosopis limensis Bentham 1842. Hookers Jour. Bot. 4: 350
Iconografa: Mom et al. 2002.
Nombre comn: Algarrobo zambo. Al igual que la especie
anterior no existe informacin adicional sobre la descripcin.
Existe la posibilidad que puedan aparecer individuos hbridos
entre P. pallida y P. limensis, tal como lo indica la posicin del
ejemplar 3291 de la Figura 1.
Prosopis chilensis (Molina) Stunz emend. Burkart 1940,
Darwiniana 4: 105.
Nombre comn: Algarrobo. El aspecto general y de fruto
pueden observarse en la Figura 2. Descripcin: rbol de hasta
10 metros de altura. Sin espinas en ramas viejas. Hojas 12 yu-
gadas, pinnas 10,9413,25 cm long. y 2,945,34 cm lat, pinnas
generalmente uniyugadas, fololos 2,87 a 5,45 cm long. y 1,54
a 2,2 mm lat. Inforescencia en racimo espiciforme. Legumbre
falcada a semianular con los mrgenes paralelos o bien algo
ondulados, color pajizo a veces con manchas violceas de 16,2
a 25 cm x 1,24 a 1,75 cm, mesocarpo dulce, palatable.
Distribucin geogrfca: En Per, se encuentra adems en el
rea de Cuzco; en Bolivia en la regin oriental de la Precordillera
Andina; en Argentina en el centro oeste y en Chile en el Valle
del Elqui y en las inmediaciones de Santiago.
Discusin
Los ejemplares estudiados se renen en tres grupos defnidos,
los cuales pueden ser asignados a P. limensis (A), P. pallida (B)
y P. chilensis (C) (Fig. 1). Los ejemplares 3308, 3310, 3314 y
3315 (de Ecuador, Prov. Loja), fueron colectados en la fraccin
del Bosque seco con predominio de Ceiba (en general por enci-
ma de los 500 m de altitud). En esta regin las lluvias son algo
superiores al bosque seco denominado Sapotal-Algarrobal y esto
infuira en el mayor tamao de los fololos.
Daz Celis (1995) present una clave para diferenciar los
algarrobos del norte peruano. Segn nuestro criterio lo atribui-
do por Daz Celis (1995) a P. pallida debe ser designado como
P. limensis y lo denominado P. julifora, como P. pallida. Debe
sealarse que este autor no indica los ejemplares estudiados. Por
el momento y hasta disponer de pruebas experimentales, sobre
la herencia de los caracteres que las determinan, sera mejor no
utilizar las variedades propuestas por Daz Celis (1995).
Prosopis julifora no fue encontrada en el desierto costero
y no hay ejemplares en los herbarios que avalen su presencia.
Ferreyra (1987) seala que P. julifora no existira en Per y que
su binomio no corresponde a alguna de las especies del norte
peruano; sin embargo la incluye con la variedad horrida. Estos
materiales deben referirse a P. pallida.
El ejemplar 3291, morfolgicamente afn a P. pallida, se
separa del grupo B (P. pallida). La observacin detallada de los
materiales, sugiere que podra haberse originado de la hibrida-
cin de P. pallida x P. limensis (el orden es arbitrario).
La distribucin de P. limensis es amplia en la zona costera
peruana y de acuerdo a lo observado durante los viajes de reco-
leccin, esta especie sera la ms resistente a la sequa.
Las colecciones realizadas para el presente trabajo y las revi-
siones de los herbarios no avalan la presencia de P. afnis en el
desierto costero. Los materiales que Ferreyra (1987) cita como
P. afnis tienen como caracterstica comn el color del fruto
violceo hasta morado, ste es un atributo que presenta tanto
P. pallida como P. limensis.
Segn nuestro criterio, los materiales citados como P. afnis
por Ferreyra (1987) deben ser considerados como se indica a
continuacin:
Prosopis pallida:
Tumbes: Contralmirante Villar, cerca Bocapn, Ferreyra, Cerrate & To-
var 10555 (USM); Zarumilla, Puerto Pizarro, Cerrate 4962 (USM).
Piura: Paita entre El Alto y Talara, Ferreyra 10757 (USM). Sullana
El Algarrobo, cerca Sullana, Ferreyra & Aguilar 19119 (USM),
19121 (USM), 19134 (USM), 19137 (USM), 19139 (USM), 19317
(USM), Valdivia & Montesinos 04 (USM); Marcavelica a 2 km. G.
Domnguez 09 (USM).
A
B
1 cm
321

Especies de Prosopis de las costas de Per y Ecuador
Rev. peru. biol. 17(3): 317 - 323 (December 2010)
Figura 3. Mapa sealando la distribucin de las especies de algarrobo
en la zona costera peruano-ecuatoriana.
N
Longitud
total de la
hoja (cm)
Longitud
del peciolo
(cm)
N pares
de pinnas
primarias
Longitud
de la 1
pinna (cm)
Ancho de
la 1 pinna
(cm)
N pares
de foliolos
1 pinna
Dist entre
foliolos
(mm) 1
pinna
Largo de
foliolo
(mm) 1
pinna
Ancho de
foliolo 1 pinna
(mm)
3058 3,65 0,90 2,00 1,90 0,70 8,75 1,65 4,50 1,60
3059 8,00 1,78 2,50 3,81 1,45 10,13 3,39 7,31 2,44
3060 5,10 1,00 3,00 3,00 0,95 10,75 2,00 5,60 1,66
3061 4,90 1,70 2,50 1,40 0,80 10,50 3,12 5,60 1,75
3062 5,60 1,30 2,00 4,40 1,50 10,00 3,25 7,25 2,00
3064 5,10 1,18 2,00 2,78 1,14 10,38 3,13 5,58 1,36
3065 5,00 0,60 1,75 2,06 0,83 10,25 2,00 4,25 2,13
3068 6,98 1,76 2,25 3,94 1,49 11,75 3,25 7,50 2,20
3071 7,30 2,28 2,00 4,45 1,29 10,00 4,18 7,31 2,44
3072 4,15 1,00 2,00 2,85 1,01 10,63 2,35 5,68 1,69
Apndice 1. Matriz de datos. Promedios de los caracteres por individuo.
(Contina....)
Prosopis limensis:
Tumbes: entre Zarumilla y El Salto, Ferreyra, Cerrate & Tovar 10749
(USM); Tumbes Manglar Cherre, Ferreyra, Macedo & Revilla
18966 (USM)
Ica: Ica, alrededores de la Laguna de La Huega, Ferreyra 8206 (USM),
Laguna San Pedro, A. Luna s/n (USM), Laguna Huacachina, J.
Revilla s/n (USM), Laguna Orovilca, A. Luna s/n (USM), Pampa
de Ocucaje, Ferreyra 1382 (USM).
Prosopis pallida
Prosopis limensis
Prosopis chilensis
Ecuador
Per
Se sugiere no seguir utilizando la denominacin de las va-
riedades de P. pallida (Ferreyra 1987) hasta la comprobacin
experimental de que los caracteres que las delimitan son el pro-
ducto de variabilidad genotpica y no la respuesta a variaciones
ambientales.
En el desierto costero, P. chilensis slo fue coleccionada en las
proximidades de Aplao y en la desembocadura del Ro Caman.
Es posible que esta especie haya llegado a la regin como una
planta cultivada, en pocas previas a la colonizacin europea.
El presente trabajo concluye que:
a. No existen evidencias que avalen la presencia de Prosopis
julifora ni la de Prosopis afnis.
b. Los taxones existentes en la regin costera peruano-
ecuatoriana son: Prosopis pallida (Humb. et Bonpl. ex Willd.)
Kunth, Prosopis limensis Bentham, ambos de amplia distribucin,
y Prosopis chilensis (Molina) Stuntz emend Burkart restringido
al valle del ro Caman. Estos tres taxones se corresponden con
los tres grupos obtenidos del anlisis numrico. La distribucin
de los algarrobos en la zona estudiada se muestra en la Figura 3.
Literatura citada
BurkartA.1976.AmonographofthegenusProsopis(Leguminosae
Subfam Mimosoideae). Journal of the Arnold Arboretum
57:219-249;450-525
Daz-Celis A. 1995. Los algarrobos. CONCYTEC. Lima, Per.
217 pgs.
FerreyraR.1987.Estudiossistemticosdelosalgarrobosdelacosta
nortedePer.DireccindeInvestigacinForestalyFauna.
MinisteriodeAgricultura,Lima,Per.31pgs.
Harris P.J.C., N.M. Pasiecznik, S.J. Smith, J.M. Billington, & L.
Ramrez.2003.DifferentiationofProsopisjulifora(Sw.)
DC. and P. pallida (H. & B. ex. Willd.) H.B.K. using foliar
characters and ploidy. Forest Ecology and Management
180(1): 153-164.
Mom M.P., A.D. Burghardt, R.A. Palacios & L. Alban. 2002. Los
algarrobos peruanos: Prosopis pallida y su delimitacin.
Arnaldoa9(1):39-48
Pasiecznick N.M., P. Felker, P.J.C. Harris, , Harsh, L. N., Cruz, G.,
Tewari, J. C., Cadoret, K. & Maldonado, L.J. 2001. The
Prosopisjulifora-ProsopispallidaComplex.Amonogra-
ph. HDRA Coventry, UK pp. 162.
322
Burghardt et al.
Rev. peru. biol. 17(3): 317 - 323 (Diciembre 2010)
3073 6,80 1,25 2,75 3,18 1,13 9,67 3,44 6,42 1,59
3074 7,30 1,05 2,75 3,82 1,44 10,29 4,05 7,13 1,66
3075 4,60 0,80 2,00 3,03 1,19 9,13 3,67 6,56 2,10
3076 6,25 1,00 2,25 3,71 1,38 11,42 3,25 7,48 2,40
3077 4,38 0,73 2,00 2,96 1,40 10,00 3,15 6,96 1,93
3078 5,53 1,13 2,00 3,19 1,31 8,63 3,88 7,44 2,46
3079 3,90 0,71 2,00 2,29 1,03 9,50 2,50 5,08 1,36
3080 4,80 0,88 2,00 2,95 1,60 8,75 3,63 6,41 1,61
3081 5,53 1,18 2,00 3,20 1,03 10,13 3,06 5,19 1,68
3082 4,63 0,73 2,50 2,81 1,15 9,92 3,06 5,66 1,61
3083 5,13 1,10 2,75 2,87 1,05 10,08 2,79 5,35 1,55
3084 4,10 0,63 3,00 2,23 0,85 8,83 2,63 4,51 1,16
3085 4,60 0,80 2,50 2,75 1,08 10,92 2,67 5,30 1,38
3086 5,75 0,88 2,75 2,93 1,05 10,79 3,00 5,84 1,43
3087 4,35 0,95 2,25 2,47 0,87 11,21 2,33 4,72 1,16
3089 6,50 1,48 2,00 4,15 1,54 10,63 4,10 7,88 3,00
3092 5,88 1,13 2,25 3,29 1,29 11,75 2,98 6,63 1,81
3094 7,68 1,40 2,25 4,37 1,40 12,75 3,70 7,06 2,23
3095 6,33 1,03 2,00 3,78 1,44 9,88 4,08 7,31 1,93
3096 6,00 0,48 3,00 3,25 1,07 10,65 3,50 5,41 1,55
3097 4,43 0,83 2,00 2,36 1,00 9,88 2,75 5,44 1,43
3098 5,35 1,05 2,25 3,00 1,25 10,46 3,50 6,27 1,50
3101 6,43 0,85 2,50 3,89 1,41 11,46 3,98 7,17 2,27
3110 7,13 1,90 2,00 4,13 1,61 10,13 4,46 8,46 2,66
3287-58pa 9,36 2,08 3,00 3,36 1,36 10,60 2,60 7,60 2,00
3288-59pax 6,86 0,90 3,00 3,02 1,08 10,00 2,00 5,40 1,80
3289-60pa 9,38 2,00 2,40 4,80 1,42 10,40 3,40 9,20 3,20
3290-61pa 8,96 1,52 2,80 3,46 1,48 8,60 3,60 7,80 2,40
3291-62 6,94 1,46 2,60 2,60 1,02 7,00 3,40 4,80 1,40
3292-63 8,02 1,36 2,60 4,02 1,76 9,80 2,40 8,00 3,00
3293-64pa 10,34 2,72 2,60 4,18 1,42 11,40 3,20 7,80 2,80
3294-65pa 10,44 2,22 2,40 5,44 1,96 11,80 3,60 9,80 3,00
3295-66pa 8,22 1,90 2,60 4,50 1,74 12,20 2,80 9,80 2,60
3296-67 8,26 2,18 2,00 4,66 1,68 11,40 4,00 8,80 2,20
3297-68pa 8,82 2,76 2,80 3,48 1,84 10,00 2,40 9,20 2,00
3298-69pa 9,42 2,28 2,20 4,24 1,98 10,80 2,60 10,00 3,20
3299-70pa 6,94 1,18 2,20 3,46 1,52 10,20 3,00 7,80 2,20
3300-71 8,04 2,28 2,40 5,22 2,12 12,40 3,60 9,80 2,80
3301-72pa 10,02 2,16 2,80 5,20 1,88 11,80 3,80 9,40 2,60
3302-73pa 8,00 1,38 2,20 4,06 1,42 11,60 3,00 7,20 2,00
3303-74pa 8,20 2,24 2,20 3,72 1,50 13,00 2,20 7,20 2,00
3304-75pa 9,66 1,94 3,00 4,22 1,82 13,80 2,40 9,60 2,60
3305-76pa 7,68 1,43 2,50 3,05 1,33 8,75 3,00 7,50 2,25
3306-77pa 9,20 2,16 2,80 3,54 1,48 9,80 2,60 7,20 2,20
3307-78pa 9,06 1,68 2,60 4,88 1,86 13,20 3,00 9,20 3,00
3308-79?? 11,80 1,96 2,40 6,16 2,32 12,20 4,40 11,40 3,40
3309-80?? 9,98 1,74 2,80 3,88 1,70 11,80 2,80 8,80 2,60
3310-81?? 11,04 3,12 2,40 5,70 2,24 11,80 4,00 10,80 3,60
3311-82?? 9,28 1,62 2,40 4,28 1,58 12,20 2,40 8,20 3,00
3312-83?? 11,48 2,18 2,60 4,46 1,58 10,60 3,00 7,80 2,60
3313-84?? 10,30 2,48 2,00 4,62 1,80 10,80 3,60 8,80 2,80
3314-85?? 13,62 3,20 2,00 6,78 2,02 13,00 4,00 10,00 3,80
3315-86 13,86 2,06 2,80 6,54 2,02 12,40 4,40 10,60 2,60
3316-87?? 9,86 1,88 3,00 4,36 1,62 10,20 3,00 7,40 2,20
3317-88?? 11,20 2,56 2,80 4,64 1,62 11,20 3,00 8,20 2,80
3277ch 13,81 2,87 1,13 10,94 2,94 21,86 4,60 14,70 1,54
3276ch 18,70 5,45 1,00 13,25 5,34 18,00 5,44 26,70 2,20
N
Longitud
total de la
hoja (cm)
Longitud
del peciolo
(cm)
N pares
de pinnas
primarias
Longitud
de la 1
pinna (cm)
Ancho de
la 1 pinna
(cm)
N pares
de foliolos
1 pinna
Dist entre
foliolos
(mm) 1
pinna
Largo de
foliolo
(mm) 1
pinna
Ancho de
foliolo 1 pinna
(mm)
Apndice 1. Continuacin.
(Contina....)
323

Especies de Prosopis de las costas de Per y Ecuador
Rev. peru. biol. 17(3): 317 - 323 (December 2010)
3275ch 15,75 2,92 1,00 12,83 4,20 17,75 6,86 21,00 2,00
3274ch 17,01 5,35 1,00 11,66 4,02 21,00 6,18 20,10 1,95
3278ch 16,04 3,36 1,00 12,68 2,96 22,80 3,40 14,80 1,73
3283pa 6,33 1,86 2,00 3,52 1,50 10,12 3,37 7,50 1,93
3284pa 4,74 0,98 2,00 2,28 1,44 9,33 2,66 7,20 2,00
3286li 2,87 1,00 2,80 2,50 1,04 11,13 1,07 5,22 1,11
3282li 4,40 0,87 2,57 2,17 0,86 10,33 1,00 4,30 1,00
3285li 2,57 0,65 2,14 1,87 1,00 8,55 1,93 5,00 1,86
3281li 5,10 0,78 3,10 2,72 1,28 12,71 1,72 6,40 1,46
3280li 4,30 0,77 3,00 2,24 1,15 10,80 1,72 5,77 1,70
N
Longitud
total de la
hoja (cm)
Longitud
del peciolo
(cm)
N pares
de pinnas
primarias
Longitud
de la 1
pinna (cm)
Ancho de
la 1 pinna
(cm)
N pares
de foliolos
1 pinna
Dist entre
foliolos
(mm) 1
pinna
Largo de
foliolo
(mm) 1
pinna
Ancho de
foliolo 1 pinna
(mm)
Apndice 1. Continuacin.
324
Burghardt et al.
Rev. peru. biol. 17(3): 317 - 323 (Diciembre 2010)
325

Diferenciacin morfolgica y molecular de cinco taxa de PlukEnEtia
Rev. peru. biol. 17(3): 325 - 330 (December 2010)
Rev. peru. biol. 17(3): 325 - 330 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Diferenciacin morfolgica y por ISSR (Inter simple sequence
repeats) de especies del gnero Plukenetia (Euphorbiaceae) de la
Amazona peruana: propuesta de una nueva especie
ngel Rodrguez
1
*, Mike Corazon-Guivin
1
, Danter Cachique
1
, Kember Meja
1
,
Dennis Del Castillo
1
, Jean-Franois Renno
2
, Carmen Garca-Dvila
1
Differentiation morphological and by Inter simple sequence repeats
(ISSR) of species of genus Plukenetia (Euphorbiaceae) from Peruvian
Amazon: suggestion for a new species
*corresponding author
1 Instituto de Investigaciones de
la Amazona Peruana, IIAP- La-
boratorio de Biologa y Gentica
Molecular LBGM. Av. Jos A.
Quiones km. 2.5 - Apartado Postal
784, Iquitos, Per.
Email ngel Rodrguez:
angelmartinrdc@gmail.com
Email Carmen Garca-Dvila:
cdavila19@yahoo.com
3 Institut de Recherche pour le
Dveloppement IRD-. Montpellier,
France.
Presentado: 02/10/2010
Aceptado: 28/11/2010
Publicado online: 00/11/2010
Introduccin
La diversidad de pisos ecolgicos presentes en la Amazona
peruana, ha permitido a travs de los siglos, la domesticacin de
numerosas especies de plantas nativas con una alta variabilidad
gentica (Zapata 2003). La impresionante diversidad biolgica
hace que muchas de estas especies no hayan sido estudiadas
en profundidad, desconociendo an muchas caractersticas
biolgicas, genticas y ftoqumicas. Plukenetia volubilis L.,
sacha inchi es una planta nativa de la Amazona peruana, cuyas
semillas presentan altos contenidos de protenas, cidos grasos
(esenciales: omegas 3, 6; omega 9) y vitamina E (tocoferoles y
tocotrienoles) en cantidades signifcativamente mayores que
otras semillas de oleaginosas como el man, palma, soya, maz,
colza y girasol (Hamaker 1992).
El valor del sacha inchi radica no slo en los aspectos alimen-
ticios, culturales e histricos, sino tambin en su rentabilidad
econmica. Siendo un cultivo con potencial rendimiento
econmico y grandes posibilidades de industrializacin (Arvalo
1995), viene siendo intensamente cultivado; sin embargo, se ob-
serva una alta variabilidad gentica, morfolgica y ftoqumica,
lo que ha generado que en el proceso de expansin del cultivo
se hayan llegado a confundir especies del gnero Plukenetia.
Hasta el ao 2008 fueron descritas para la Amazona peruana,
cuatro especies en base a caracteres morfolgicos: P. volubilis
L., P. brachybotrya Mll. Arg., P. loretensis Ule, y P. polyadenia
Mll. Arg. Recientemente fue descrita, para la regin Ama-
zonas, P. huayllabambana Bussmann, C. Tllez & A. Glenn.
Nuestras observaciones en la morfologa de algunas colecciones
biolgicas del Herbarium Amazonense (AMAZ) indican cierta
sobreposicin en algunos de los caracteres de estas especies, lo
que podra difcultar su correcta determinacin.
Los marcadores moleculares constituyen poderosas herra-
mientas para esclarecer cuestiones no resueltas mediante la tax-
onoma morfolgica y para determinar los lmites taxonmicos.
As, el ADN han sido utilizado para comprobar la sistemtica
morfolgica o para cuestionarla (Judd et al. 1999). La litera-
Resumen
En el presente trabajo se estudian cinco especies del gnero Plukenetia de la Amazona peruana: P. brachy-
botrya, P. loretensis, P. polyadenia, P. huayllabambana, P. volubilis (procedencia San Martn); y de un supuesto
morfotipo (P. volubilis, procedencia Cusco). Los 126 especmenes estudiados fueron identifcados mediante
claves de caracteres morfolgicos (formas de hojas, tallos y semilla; posicin de glndulas basilaminares)
y posteriormente mediante marcadores moleculares ISSR (CAA, CAG, GACA). Los anlisis morfolgicos
permitieron separar las cinco especies descritas: P. brachybotrya, P. loretensis, P. polyadenia, P. volubilis y
P. huayllabambana. Los dos supuestos morfotipos de P. volubilis fueron discriminados por la posicin de las
glndulas, tamao de semillas y forma del tallo. Los resultados proporcionados por el Anlisis Factorial de
Correspondencia (AFC) y corroborados por el ndice de fjacin (F
ST
), distancia gentica y el dendograma
estimado por el mtodo UPGMA, evidencian una fuerte diferenciacin entre los seis taxa, corroborando la
identidad taxonmica molecular de las cinco especies ya descritas morfolgicamente. Adems, los resultados
(Fst y la distancia gentica) indicarian que P. volubilis (del Cusco) podra ser una nueva especie de Sacha
Inchi, an no descrita para la ciencia.
Palabras clave: Sacha inchi, ISSR, Plukenetia, Biodiversidad, Amazona.
Abstract
In this work, fve taxa of the genus Plukenetia from Peruvian Amazon: P. brachybotrya, P. loretensis, P. poly-
adenia, P. huayllabambana, P. volubilis (from San Martin) and one morphotype (P. volubilis, from Cusco) were
studied. The 126 specimens used were identifed by morphological keys (shapes of leaves, stems and seed;
basilaminar glands position) and by ISSR molecular markers (CAA, CAG, GACA). The morphological analysis
of the different taxa studied allowed us to clearly identify fve described species: P. brachybotrya, P. loretensis,
P. polyadenia, P. volubilis (from San Martin) and Plukenetia huayllabambana. Both morphotypes of P. volubilis
(San Martin and Cusco) were distinguished for the position of the glands, seed size and shape of the stem.
The results provided by Correspondence Factorial Analysis (AFC) and supported by the fxation index (Fst),
genetic distance and the dendogram estimated by the UPGMA method, show a strong differentiation among
the six taxa, corroborating the molecular taxonomic identity of the fve species morphologically described. Also,
results (Fst and Genetic distance) suggest that P. volubilis (from Cusco) could be a new Sacha Inchi species,
not yet described to science.
Keywords: Sacha inchi, ISSR, Plukenetia, Biodiversity, Amazon.
326
Rodrguez et al.
Rev. peru. biol. 17(3): 325 - 330 (Diciembre 2010)
tura registra la utilizacin de marcadores ISSR en estudios de
validacin de la informacin proporcionada por la taxonoma
morfolgica. Por ejemplo, Chennaoui-Kourda et al. (2007) uti-
lizando marcadores ISSR en el anlisis de la relacin entre Sulla
spinosissima y S. capitata, mostraron la existencia de una gran
diferenciacin gentica entre estas dos especies; mientras que Shi
et al. (2006) en el anlisis molecular de 20 especies de Lycoris,
reconocieron cuatro grandes grupos de especies, lo que result
congruente con sus observaciones morfolgicas y citolgicas.
Resultados similares acerca de marcadores ISSR fueron encontra-
dos en trigo, cebada, algodn y otras plantas (Chen et al. 2007,
Yockteng et al. 2003, Xu & Sun 2001, Raina et al. 2001, Hang
et al. 2003, Liu 1999). As mismo Angiosperm Phylogeny Group
(APG 2003), viene apoyando desde la dcada de los noventa
el uso de marcadores moleculares en estudios flogenticos de
plantas, principalmente con la fnalidad de proporcionar una
nueva visin flogentica en la sistemtica de plantas con fores.
En este sentido, el presente estudio tuvo como objetivo contri-
buir a la delimitacin taxonmica de seis taxa del gnero Plukenetia
identifcadas con claves morfolgicas y mediante anlisis de su
polimorfsmo gentico, empleando la tcnica molecular ISSR.
La informacin producida en el presente trabajo servir de base
a planes de manejo y mejoramiento gentico.
Material y mtodos
Muestras biologicas
Se colectaron muestras biolgicas de 126 individuos pertene-
cientes a cinco especies: Plukenetia huayllabambana (Chirimoto,
Regin Amazonas; 18M 0229606, UTM 9279162), P. polyade-
nia (Pevas, Regin Loreto; 19M 0174043, UTM 9631195), P.
loretensis y P. brachybotrya (Puerto Almendras, Regin Loreto;
18M 0680833, UTM 9576661), Plukenetia volubilis (Shica,
Regin San Martn; 18M 0315372, UTM 9301077) y un
ltimo morfotipo conocido por los agricultores tambin como
Plukenetia volubilis y que proviene de la localidad de Echarati en
la Regin de Cusco (18M 0765342, UTM 8583639).
Las muestras botnicas colectadas (hojas, fores y frutos) de
cada taxn, fueron utilizadas para el montaje de exsicatas y la
determinacin mediante claves taxonmicas. Las muestras bo-
tnicas fueron depositadas como referencia de este estudio en el
Herbarium Amazonense (AMAZ), de la Universidad Nacional
de la Amazona peruana UNAP.
Extraccin y amplifcacin de ADN
La extraccin fue realizada a partir de tejido foliar (conser-
vados con Sulfato de Calcio Anhidro), mediante el mtodo de
extraccin CTAB (Doyle & Doyle 1987). La amplifcacin del
ADN se realiz con los primers CAA (CAACAACAACAACAA),
CAG (CAGCAGCAGCAGCAG) y GACA (GACAGACA-
GACAGACA), diseados por Bornet y Branchard (2001);
de acuerdo a la tcnica Inter Simple Sequence Repeat-ISSR
(Zietkiewicz et al. 1994). Las amplifcaciones fueron realizadas
en volmenes fnales de 25L conteniendo: 100ng/L de ADN
molde, 5 U/L de Taq polimerasa, 5X Bufer, 25mM MgCl
2
,
10mM dNTPs, 10M de primer y agua ultrapura. Las condi-
ciones de temperatura fueron: una desnaturalizacin inicial a
95 C x 1 min., seguida de 27 ciclos consistentes en: desnatu-
ralizacin (94 C x 1 min.), hibridacin (37-60 C, adecuada a
cada primer x 1 min.), elongacin (72 C x 4 min.), seguido de
una extensin fnal a 72 C x 7 min. La verifcacin preliminar
de la amplifcacin fue realizada en geles de agarosa 2% teidos
con bromuro de etidio (10mg/mL). Posteriormente se verifc
el polimorfsmo (diferenciacin) entre las muestras en geles de
poliacrilamida al 6%, teidos mediante tincin argntica de
acuerdo al mtodo Rabat.
Interpretacin y tratamiento de datos
Se realiz una matriz binaria en base a la presencia (1) y
ausencia (0) de las bandas observadas (polimrfcas) entre los
individuos. La diversidad gentica entre los diferentes taxa (es-
pecies morfolgicas y morfotipo) de Plukenetia fue visualizada
mediante el Anlisis Factorial de Correspondencia (AFC), la
diferenciacin entre ellas fue estimada en base al ndice de
fjacin (F
ST
) propuesto por Weir y Cockerham (1984). Estos
anlisis fueron realizados con la ayuda del software GENETIX
versin 4.05 (Belkhir et al. 2004). Las relaciones entre las
agrupaciones fueron establecidas en base a un dendrograma
(mtodo UPGMA), elaborado a partir de la distancia gentica
(D) obtenida segn Reynolds et al. (1983), as como los valores
de Bootstrap (calculados en base a 1000 repeticiones) fueron
obtenidos con la ayuda de PHYLIP versin 3.5 (Felsenstein
1993). Los rboles fueron visualizados con ayuda del software
TREVIEW (Page 1996).
Resultados
Caracterizacin morfolgica y tratamiento taxonmico
En base a las claves taxonmicas de Gillespie (1993) se logr
determinar cuatro especies morfolgicas entre los taxa estudia-
dos: P. loretensis, P. brachrybotrya, P. polyadenia, y P. volubilis
(procedencia San Martn); y P. huayllabambana en base a las
descripciones de Bussmann et al. (2009). Observndose qu
P. volubilis (procedencia Cusco) presenta algunas diferencias
morfolgicas (hojas, fruto y semillas) con relacin a las especies
antes mencionadas (Tabla 1).
Las caractersticas morfolgicas diferenciales ms saltantes
la encontramos en la forma de las semillas de los diferentes
grupos de Plukenetia (Fig. 1), que van desde redondeadas hasta
ligeramente lenticuladas; y diferencias en la testa de las semillas,
de aspecto liso en cuatro de los seis taxa [P. loretensis, P. brachy-
botrya, P. volubilis (procedencia San Martn) y P. polyadenia], y
rugosa en P. huayllabambana y P. volubilis (procedencia Cusco).
Asimismo se observ una considerable variacin en el tamao
de las semillas.
Caracterizacin molecular
El resultado del Anlisis Factorial de Correspondencia (AFC)
muestra los seis taxa estudiados claramente diferenciados a nivel
gentico sin sobreposicin alguna entre ellos (Fig. 2: A, B, C).
El anlisis del F
ST
entre pares de taxa (Tabla 2) mostr un alto
grado de diferenciacin entre todos los taxa analizados (elevada
signifcancia, p= 0). P. brachybotrya y P. volubilis (procedencia
Cusco) tienen el F
ST
ms elevado (F
ST
= 0,98491; p= 0). Mien-
tras que P. huayllabambana y P. volubilis (procedente de de San
Martn) se mostraron como los taxa ms cercanos (F
ST
= 0,89562,
p= 0). Los F
ST
por pares fueron estadsticamente signifcativos.
Las distancias genticas (Tabla 2) estimadas segn Reynolds
et al. (1983) muestran diferencias marcadas entre cada par de
agrupaciones. Siendo que P. volubilis (procedencia San Martn)
y P. huayllabambana presentaron la menor distancia encontra-
da (D= 2,25973). En cuanto que P. brachybotrya y P. volubilis
327

Diferenciacin morfolgica y molecular de cinco taxa de PlukEnEtia
Rev. peru. biol. 17(3): 325 - 330 (December 2010)
Figura 1. Semillas de de las seis agrupaciones del gnero Plukenetia estudiados en la Amazona peruana: A = P. brachybotrya; B = P. lore-
tensis; C = P. volubilis (procedencia San Martn); D = P. volubilis (procedencia Cusco); E = P. huallaybambana; F = P. polyadenia.
(A)
(B)
(C)
(D)
(E)
(F)
Caracteres
observados
Agrupaciones Plukenetia estudiadas
P. loretensis P. brachybotrya P. polyadenia
P. volubilis
(procedencia
San Martn)
P. volubilis
(procedencia
Cusco)
P. huayllabambana
Glndulas
foliares
basilaminares
Glndulas
basilaminares
en uno o ms
pares prximas al
pecolo
Glndulas
basilaminares
numerosas
prximas al
pecolo.
Un nico
promontorio
glandular
Par de glndulas
basilaminares
prximas al
pecolo.
Par de glndulas
basilaminares
relativamente
distantes del
pecolo.
Par de glndulas
basilaminares
relativamente
distantes del
pecolo.
Borde y base
de la hoja
Borde crenado y
base caudada.
Borde liso y base
caudada.
Borde liso
y base
acuminada.
Borde crenado y
base caudada.
Borde aserrado y
base caudada.
Borde crenado y
base caudada.
Base del tallo Redondeado Redondeado Aplanado Redondeado Redondeado Hexagonal
Fruto
(cpsula)
Cada carpelo con
cornculo agudo
Cada carpelo
con un tubrculo
redondeado
Cuadrangular
con ngulos
quillados
Cuadrangular
con ngulos
quillados
Cuadrangular con
ngulos quillados
Cuadrangular con
ngulos quillados
Tamao de la
cpsula
Dimetro aprox.
1,15 cm.
Dimetro aprox.
1,15 cm.
Dimetro aprox.
de 6-11 cm.
Dimetro aprox.
de 5 a 6 cm.
Dimetro aprox. 5
a 6 cm.
Dimetro aprox. 6
a 8 cm.
Superfcie de
la semilla
Lisa Lisa Lisa Lisa Rugosa Rugosa
Forma de la
semilla
Redondeada Redondeada Redondeada Aplanada
Ligeramente
aplanada
Ligeramente
aplanada
Tamao
semilla
Media = 0,51 x
0,42 cm
Media = 0,41 x
0,39 cm
Media = 2,89 x
2,6 cm
Media = 2,01x
0,85 cm
Media = 2,01 x
1,36 cm
Media = 2,38 x 1,66
cm
Tabla 1. Principales diferencias morfolgicas de los seis taxa del gnero Plukenetia estudiados en la Amazona peruana.
328
Rodrguez et al.
Rev. peru. biol. 17(3): 325 - 330 (Diciembre 2010)
(procedencia Cusco) presentaron la mayor distancia gentica
(D= 4,19378).
El dendograma obtenido mediante el mtodo UPGMA (Fig.
3) muestra dos principales agrupaciones: la primera conformado
por P. volubilis (procedencia San Martn), P. volubilis (proceden-
cia Cusco) y P. huayllabambana (bootstrap= 100), dentro del
cual se observa una sub-agrupacin constituida por P. volubilis
(procedencia San Martn) y P. huayllabambana (bootstrap= 68);
el segundo grupo lo conforman P. polyadenia, P. loretensis y P.
brachybotrya (bootstrap= 100); P. brachybotrya y P. loretensis son
las ms cercanamente relacionadas (bootstrap= 96).
Discusin
En la revisin de Plukenetia de Gillespie (1993) existen 11
especies neotropicales, las cuales pueden ser divididas en dos
grupos informales de acuerdo a la forma del estilo, morfologa
del androceo, estructura de la exina del polen, tamao del fruto
y forma de la hoja. El primer grupo Cylindrophora, conformado
por P. volubilis, P. lehmaniana, P. polyadenia y P. stipellata; y el
segundo grupo, Euplukenetia con P. brachybotrya, P. loretensis
y P. verrucosa. El gnero Plukenetia puede ser reconocido por
la presencia de glndulas basilaminares en el lado adaxial de la
lmina foliar, el fruto generalmente 4-lobado y el hbito fre-
cuentemente trepador y algunas veces rastrero.
Un anlisis primario de los datos morfolgicos nos permiti
ubicar los taxa de Plukenetia en estudio, en cinco especies:
Plukenetia volubilis (procedencia San Martn), P. polyadenia, P.
huyllabambana, P. loretensis y P. brachybotrya.
Plukenetia loretensis y P. brachybotrya fueron separadas de
las dems con claridad por la presencia de un par a numerosas
glndulas basilaminares cerca al pecolo.
Tambin se pudo observar un carcter diferencial en la base
del tallo entre P. huayllabambana (forma hexagonal) y P. polya-
denia (forma aplanada).
Las diferencias a nivel de fruto y semilla fueron las ms
notorias. El tamao de la cpsula y las semillas, separan clara-
mente los taxa: P. brachybotrya y P. loretensis tienen las menores
dimensiones comparadas con los otros taxa, la superfcie de sus
semillas son lisas y el aspecto es redondeado para ambas especies;
Figura 2. Proyeccin grfca de los resultados del AFC: (A) ejes 1
y 2, (B) ejes 1 y 3, (C) ejes 1 y 4 para los individuos de de las seis
agrupaciones de Plukenetia estudiados en la Amazona peruana.
P. huayllabambana = , P. polyadenia =*, P. loretensis =, P. bra-
chybotrya = , P volubilis (procedencia San Martn) =, P. volubilis
(procedencia Cusco) =. Algunos puntos en los grfcos representan
la sobreposicin de ms de un individuo.
Pares de taxa F
ST
D
P. volubilis (procedencia San Martn) - P. volubilis (procedencia Cusco) 0,92804*** 2,63171
P. volubilis (procedencia San Martn) - P. huayllabambana 0,89562*** 2,25973
P. volubilis (procedencia San Martn) - P. polyadenia 0,95347*** 3,06761
P. volubilis (procedencia San Martn) - P. brachybotrya 0,97088*** 3,53633
P. volubilis (procedencia San Martn) - P. loretensis 0,96092*** 3,24215
P. volubilis (procedencia Cusco) - P. huayllabambana 0,91025*** 2,41075
P. volubilis (procedencia Cusco) - P. polyadenia 0,96939*** 3,48649
P. volubilis (procedencia Cusco) - P. brachybotrya 0,98491*** 4,19378
P. volubilis (procedencia Cusco) - P. loretensis 0,97678*** 3,76277
P. huayllabambana - P. polyadenia 0,95738*** 3,15540
P. huayllabambana - P. brachybotrya 0,97519*** 3,69661
P. huayllabambana - P. loretensis 0,96564*** 3,37093
P. polyadenia - P. brachybotrya 0,97223*** 3,58366
P. polyadenia - P. loretensis 0,96298*** 3,29635
P. brachybotrya - P. loretensis 0,95991*** 3,21657
Tabla 2. Estimacin de ndices de Fijacin (F
st
) y Distancias genticas (D) segn Reynolds et al. (1983) para los seis taxa de
Plukenetia estudiadas en la Amazona peruana.
329

Diferenciacin morfolgica y molecular de cinco taxa de PlukEnEtia
Rev. peru. biol. 17(3): 325 - 330 (December 2010)
el carcter diagnstico entre estas dos especies es la forma de la
cpsula: en P. loretensis cada carpelo tiene un cornculo agudo,
y en P. brachybotrya cada carpelo se muestra como un tubrculo
redondeado.
Por otro lado, P. polyadenia es la especie que present el mayor
tamao de frutos (de 6 a 11 cm) y semillas, estas semillas tienen
forma redondeada, y la cpsula es de forma cuadrangular con
ngulos quillados.
Las semillas de P. volubilis (procedencia San Martn) son
de menor tamao que las de P. huayllabambana y P. volubilis
(procedencia Cusco), mientras que las de P. huayllabambana son
considerablemente mayores que las de P. volubilis (procedencia
San Martn y procedencia Cusco).
La variabilidad en los caracteres morfolgicos en P. volubilis
fueron observados por Manco (2006), quien report la existencia
de 47 ecotipos y Arvalo (1995) que menciona ecotipos con
diferencias considerables en cuanto al rea de follaje, tamao
y forma de sus hojas y semillas. Estas variaciones observadas
en los diferentes caracteres morfolgicos imposibilitan muchas
veces una determinacin taxonmica segura, siendo necesaria
la utilizacin de otras herramientas como por ejemplo los mar-
cadores moleculares, para verifcar si las diferencias observadas
entre los taxa, representan variabilidad del carcter (plasticidad)
o diferencias entre especies prximas.
Los resultados moleculares hicieron posible la distincin
clara de seis taxa genticos bien diferenciados y fuertemente
estructurados (ilustrado con el anlisis AFC). Confrmando
la identidad gentica de las cinco especies: P. brachybotrya, P.
loretensis, P. polyadenia, P. volubilis (procedencia San Martn)
y P. huayllabambana. El AFC adems mostr que P. volubilis
(procedencia San Martn), P. huayllabambana y P. volubilis
(procedencia Cusco), son entidades genticas diferentes entre
s, estos resultados fueron corroborados con los resultados de
F
ST
y distancia gentica (Tabla 3) donde se observa que los
valores encontrados entre estos tres grupos son similares a las
encontradas entre las otras especies. Evidenciando la identidad
gentica de las seis agrupaciones estudiadas.
El dendograma obtenido a partir de las distancias genticas
para las especies amaznicas del gnero Plukenetia muestra la
formacin de dos agrupaciones principales: la primera confor-
mada por P. volubilis (procedencia San Martn), P. huayllabam-
bana y P. volubilis (procedencia Cusco), siendo que P. volubilis
(procedencia San Martn) y P. huayllabambana se encuentran
ms cercanamente relacionados (distancia gentica = 2,26). La
segunda agrupacin engloba a P. polyadenia, P. loretensis y P.
brachybotrya, siendo que estas dos ltimas se encuentran ms
relacionadas en la topologa (distancias genticas: P. brachybotrya
y P. loretensis = 3,22).
Estas agrupaciones genticas encontradas parecen presentar
afnidad en cuanto la forma de la semilla, en el caso de la pri-
mera agrupacin es relativamente aplanada, en cuanto que la
segunda agrupacin presenta semillas redondeada en las tres
especies. Al contrario de la clasifcacin informal de las Pluke-
netia neotropicales (basado entre otros caracteres en el tamao
del fruto) mencionada por Gillespie (1993), donde P. polyadenia
se encuentra junto a P. volubilis en el grupo Cylindrhophora.
Las relaciones obtenidas en este trabajo muestran que Pluke-
netia polyadenia se encuentra ms cercana de P. brachybotrya y
P. loretensis que son especies que presentan semillas pequeas
(media: P. loretensis = 0,51 x 0,42 cm; P. brachybotrya = 0,41 x
0,39 cm), demostrando que el tamao de los frutos no puede
ser considerado como carcter diagnostico (diferencial) para
agrupar las especies estudiadas.
P. huayllabambana
P. volubilis
procedencia Cusco
P. volubilis
procedencia San Martn
P. loretensis P. brachybotr ya
P. polyadenia
100
100
96
68
10
Figura 3. Dendograma de las seis agrupaciones del gnero Plukenetia estudiados en la Amazona peruana. Elaborado mediante el mtodo
UPGMA a partir de los datos de distancia gentica de Reynolds et al. (1983). Los nmeros en las ramas representan los valores de bootstrap
para 1000 repeticiones.
330
Rodrguez et al.
Rev. peru. biol. 17(3): 325 - 330 (Diciembre 2010)
Conclusiones
Los resultados moleculares obtenidos muestran un alto nivel
de diferenciacin entre los seis taxa de Plukenetia estudiados,
corroborando la identidad taxonmica de las cinco especies
de Plukenetia descritos hasta el momento para la Amazona
peruana: P. brachybotrya, P. loretensis, P. polyadenia P. volubilis y
P. huayllabambana.
As mismo, la divergencia gentica encontrada entre las es-
pecies taxonmicamente descritas es igual a la encontrada entre
los dos supuestos ecotipos de P. volubilis procedentes de San
Martn y Cusco, sugiriendo que estas agrupaciones representan
entidades genticas separadas y no diferentes morfotipos dentro
de P. volubilis, como se supuso al inicio de este estudio. Por lo
tanto si consideramos las diferencias genticas entre las especies
ya descritas, y aceptamos el enlace entre nivel taxonmico y
distancia gentica, entonces este trabajo permitira evidenciar
una nueva especie de Sacha Inchi en la regin de Cusco.
Agradecimientos
Al proyecto Innovacin y Competitividad para el Agro
Peruano - INCAGRO por el fnanciamiento otorgado para la
realizacin de la presente investigacin.
Literatura citada
APG, Angiosperm Phylogeny Group. 2003. An update of the An- An update of the An-
giospermPhylogenyGroupclassifcationfortheordersand
familiesoffoweringplants:APGII.BotanicalJournalof
theLinneanSociety141:399436.
Arvalo G. 1995. El cultivo del sacha inchi (Plukenetia volubilis
l.) en la Amazona. Programa Nacional de Investigacin
en Recursos Genticos y Biotecnologa - PRONARGEB,
EstacinExperimentalElPorvenirTarapoto,Per.21pp.
Belkhir K., P. Borsa, I. Chichi, et al. 2004. Genetix 4.05.2, logiciel
sous windowns TM pour la gentique des populations. La-
boratoire gnome, populations, interactions, CNRS UMR
5000, Universit de Montpellier II, Montpellier, France.
Bornet B. & M. Branchard. 2001. Non anchored Inter Simple Se-
quenceRepeat(ISSR)Markers:ReproducibleandSpecifc
ToolsforGenomeFingerprinting;PlantMolecularBiology
Reporter19:209215.
BussmannR.W.,C.Tllez&A.Glenn.2009.Plukenetiahuaylla-
bambana sp. nov. (Euphorbiaceae) from the upper Amazon
of Peru. Nordic Journal of Botany 27: 313-315.
Chen J., W.R. Gituru & Q. Wang. 2007. A comparison of the extent of
genetic variation in the endangered Sagittaria natans and its
widespread congener S. trifolia. Aquatic Botany 87: 16.
Chennaoui-KourdaH.,S.Marghali,M.Marrakchi&N.Trif-Farah.
2007. Genetic diversity of Sulla genus (Hedysarea) and
related species using Inter-simple Sequence Repeat
(ISSR) markers. Biochemical Systematics and Ecology
35: 682-688.
Doyle J.J. & J.L. Doyle. 1987.A rapid DNA isolation procedure
for small quantities of fresh leaf tissue. Phytochem. Bull.
19:11-15.
FelsensteinJ.1993.PHYLIP(PhylogenyInferencePackage),version
3.5 c. Seattle: University of Washington.
GillespieL.J.1993.AsynopsisofNeotropicalPlukenetia(Euphor-
biaceae) including two new species. Systematic Botany
18(4):575592.
HamakerB.R.,C.Valles,R.Gilman,etal.1992. Amino Acid and
FattyAcidProflesoftheIncaPeanut(Plukenetiavolubilis
L.),CerealChem.69:461463.
Hang A., C.S. Burton & D.L. Hoffman. 2003. Use of intersimple
sequence repeat (ISSR) polymorphisms to study genetic
relationships in closely related North American malting
barleycultivars.J.Genet.Breed.91:1621.
JuddW.,C.Campbell,E.Kellog,P.Stevens.1999.PlantSystemat-
ics: A Phylogenetic Approach. Sinauer Associates, Inc.
Sunderland, MA, USA. 464 pp.
LiuS.1999.CottongeneticmappingandQTLanalysisusingsimple
sequence repeat markers and the identifcation of their
chromosome location. [MS Thesis]. New Mexico State
University, Las Cruces, NM.
Manco E. 2006. Cultivo de sacha inchi. INIEA SUDIRGEB Es- Cultivo de sacha inchi. INIEA SUDIRGEB Es-
tacin Experimental Agraria EL PORVENIR, Tarapoto,
SanMartnPer,8pp.
Page R.D.M. 1996. TreeView, Tree drawing software forApple
Macintosh and Microsoft Windows. Division of Environ-
mental and Evolutionary Biology, Instituteof Biomedical
and Life Sciences, University of Glasgow. Glasgow,
Scotland, UK.
Raina S.N., V. Raini, T. Kojima, et al. 2001. RAPD and ISSR
fngerprints as useful genetic markers for analysis of
geneticdiversity,varietalidentifcation,andphylogenetic
relationships in peanut (Arachis hypogaea) cultivars and
wild species. Genome 44: 763772.
Reynolds J.S., B.S. Weir & C.C. Cockerham. 1983. Estimation
of coancestry coeffcient: basis for a short-term genetic
distance.Genetics105:767-779.
ShiS,Y.Qiu,L.Wu&C.Fu.2006.Interspecifcrelationshipsof
Lycoris (Amaryllidaceae) inferred from inter-simple se-
quencerepeatdata.ScientiaHorticulturae110:285291.
WeirB.S.&C.C.Cockerham.1984.EstimatingF-statisticsforthe
analysis of population structure. Evolution 38: 1358-1370.
Xu F. & M. Sun. 2001. Comparative Analysis of Phylogenetic Re-
lationships of Grain Amaranths and Their Wild Relatives
(Amaranthus;Amaranthaceae)UsingInternalTranscribed
Spacer,AmplifedFragmentLengthPolymorphism,and
Double-Primer Fluorescent Intersimple Sequence Repeat
Markers. Molecular Phylogenetics and Evolution 21(3),
372387.
YocktengR,H.E.Ballard,G.Mansion,etal.2003.Relationships
among pansies (Viola section Melanium) investigated us-
ing ITS and ISSR markers. Plant Syst. Evol. 241: 153170.
Zapata S. 2003. Posibilidades y potencialidad de la agroindustria
enelPerenbasealabiodiversidadylosbionegocios.
ComitBiocomercioPer.LimaPer.70pp.
ZietkiewiczE.,A.Rafalski&D.Labuda.1994.Genomefngerprint-
ing by simple sequence repeat (SSR)-anchored polymerase
chainreactionamplifcation.Genomics20:176-183.
331

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Medicinal plants used in Peru for the treatment of respiratory disorders
Rainer W. Bussmann* and Ashley Glenn
Plantas medicinales utilizadas en Per para el tratamiento de enfermedades
respiratorias
William L. Brown Center, Missouri
Botanical Garden, P.O. Box 299,
St. Louis, MO 63166-0299, USA,
Office phone: +1-314-577-9503,
Fax: +1-314-577-0800.
Email Rainer Bussmann: rainer.
bussmann@mobot.org,
*corresponding author
Presentado: 01/06/2010
Aceptado: 22/11/2010
Publicado online: 00/11/2010
Abstract
Respiratory tract infections continue to be a major health challenge worldwide especially due to the increas-
ingly fast development of resistance to the drugs currently in use. Many plant species are traditionally used for
respiratory illness treatment, and some have been investigated for their effcacy with positive results. A total
of 91 plant species belonging to 82 genera and 48 families were documented and identifed as respiratory
system herbal remedies in Northern Peru. Most species used were Asteraceae (15 species, 16.67%), followed
by Lamiaceae and Fabaceae (8.89% and 5.56%). The majority of respiratory disorder herbal preparations were
prepared from the leaves of plants (27.69%), while the whole plant (18.46%), fowers (13.85%) and stems
(17.69%) were used less frequently. In almost 55% of the cases fresh plant material was used to prepare rem-
edies. About 86% of the remedies were applied orally, while the remaining ones were applied topically. Over
half of all remedies were prepared as mixtures of multiple ingredients. Almost 50% of the plants found in the
respiratory pharmacopoeia of Northern Peru, or their congeners have been studied for their medicinal proper-
ties. The results of this study show that both indigenous and introduced species are used for the treatment of
respiratory system disorders. The information gained on frequently used traditional remedies might give some
leads for future targets for further analysis in order to develop new drugs.
Keywords: Ethnobotany, tradicional medicine, Peru, bronchitis, pneumonia, cold, cough, tuberculosis.
Resumen
Las infecciones del sistema respiratorio continan siendo un desaf en sistemas de salud, en particular porque
ellas desarrollan resistencia a los antibiticos ms usados. Varias plantas medicinales son utilizadas en sistemas
tradicionales de salud para el tratamiento de enfermedades respiratorias, incluso algunas de ellas han sido
investigadas para verifcar su efcacia. En este estudio registramos 91 especies de plantas de 82 gneros y
48 familias, utilizadas como medicina para el sistema respiratorio. Las especies ms usadas pertenecieron
a la familia Asteraceae (15 species, 16,67%), seguido por Lamiaceae y Fabaceae (8,89% y 5,56%). En los
preparados para problemas respiratorios se utilizaron con ms frecuencia hojas de plantas (27,69%), seguido
de la planta entera (18,46%), fores (13,85%) y tallos (17,69%). En el 55% de los preparados se utiliz material
fresco, y el 86% de los preparados se administraron por va oral, y ms de la mitad fueron preparados como
mixturas de diferentes especies. Casi el 50% de las plantas que se encuentran en la farmacopea respiratoria del
norte del Per, o de sus congneres, ya han sido estudiados por sus propiedades medicinales. Los resultados
de este estudio muestran que se usan especies introducidas y nativas, y que la informacin obtenida de los
remedios tradicionales utilizados puede contribuir al desarrollo de medicamentos nuevos.
Palabras claves: Etnobotanica, medicina tradicional, Per, bronquitis, neumona, resfri, tos, tuberculosis.
Introduction
Te WHO reports that respiratory illnesses are of high im-
portance as a cause of death and morbidity at a global scale in
Peru respiratory problems are a major cause for infant deaths
(WHO 2006).
Traditional Medicine is used globally and is rapidly growing
in economic importance. In developing countries, Traditional
Medicine is often the only accessible and afordable treatment
available. Te WHO reports that Traditional Medicine is the
primary health care system for important percentage of the
population in developing countries. In Latin America, the WHO
Regional Ofce for the Americas (AMRO/PAHO) reports that
71% of the population in Chile and 40% of the population in
Colombia has used Traditional Medicine. In many Asian coun-
tries Traditional Medicine is widely used, even though Western
medicine is often readily available. In Japan, 60 70% of allo-
pathic doctors prescribe traditional medicines for their patients.
Complementary Alternative Medicine is also becoming more
and more popular in many developed countries. Forty-two
percent of the population in the US have used Complementary
Alternative Medicine at least once (WHO 1998), and a national
survey reported the use of at least one of 16 alternative therapies
increased from 34% in 1990 to 42% in 1997 (UNCCD 2000).
Te number of visits to providers of Complementary Alternative
Medicine (CAM) now exceeds by far the number of visits to
all primary care physicians in the US (WHO 1999a, 2002b).
Te expenses for the use of Traditional and Complementary
Alternative Medicine are exponentially growing in many parts
of the world. Te 1997 out-of-pocket Complementary Alterna-
tive Medicine expenditure was estimated at US$ 2,700 million
in the USA. Te world market for herbal medicines based on
traditional knowledge is now estimated at US$ 60,000 million
(Breevort 1998).
Northern Peru is believed to be the center of the Central
Andean Health Axis (Camino 1992), and traditional medicinal
practices in this region are still an important component of
everyday life (Bussmann & Sharon 2006, Bussmann 2006, De
Feo 1992, Joralemon & Sharon 1993, Polia 1988, Sharon 1978,
1980, 1994, 2000, Sharon & Bussmann 2006). Traditional
Medicine is also gaining more and more respect by national
governments and health providers. Perus National Program
in Complementary Medicine and the Pan American Health
Organization recently compared Complementary Medicine to
allopathic medicine in clinics and hospitals operating within
the Peruvian Social Security System (EsSalud/ Organizacin
Panamericana de Salud 2000). According to WHO (2002b),
the sustainable cultivation and harvesting of medicinal species
332
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
is one of the most important challenges for the next few years.
Te present study attempts to give an overview on medicinal
plant species employed in traditional therapies in Northern
Peru to treat respiratory problems, and compare this use to the
western scientifc evidence regarding their efcacy.
Materials and methods
Plant collections
Plants in Peru were collected in the feld, in markets, and at
the homes of traditional healers (curanderos) in Northern Peru
(Fig. 1) in August-September 2001, July-August 2002, July-
August 2003, June-August 2004, July-August 2005, July-August
2006, June-August 2007, June-August 2008, March-April 2009
and June-August 2009. A total of 116 informants (healers and
market venders) in the Trujillo and Chiclayo area were inter-
viewed using structured questionnaires. Te informants were
always provided with fresh plant material, either collected with
them, by them, or available at their market stands. Te ques-
tionnaires did not include any reference as to disease concepts,
plant parts or preparations. In contrast, the participants were
only asked simple questions along the lines What is this plant
used for, which part, which quantity, how is it prepared, are any
other plants added to the mixture. All questions were asked in
the same order. All informants were of Mestizo origin, and spoke
only Spanish as their native language. Te study covered the four
existing medicinal plant markets of the region, and included all
venders present. All interviews were conducted with the same
set of participants. Te specimens are registered under the col-
lection series RBU/PL, ISA, GER, JULS, EHCHL,
VFCHL, TRUBH, and TRUVANERICA, depending
on the year of feldwork and collection location. Surveys were
conducted in Spanish by fuent speakers. Surveyors would ap-
Ecuador
Peru
Lima
Trujillo
Chiclayo
Quito
Colombia
Cuzco
Bolivia
Chile
Research area
Peru
Figure 1. Location of the study area of the medicinal plants used in
Peru for the treatment of respiratory disorders.
Family Genera Species %
Asteraceae 13 15 16.50
Lamiaceae 6 8 8.80
Fabaceae 5 5 5.50
Verbenaceae 4 4 4.40
Poaceae 3 3 3.30
Liliaceae 2 3 3.30
Solanaceae 2 3 3.30
Anacardiaceae 2 2 2.20
Boraginaceae 2 2 2.20
Brassicaceae 2 2 2.20
Malvaceae 2 2 2.20
Scrophularaceae 2 2 2.20
Ericaceae 1 2 2.20
Piperaceae 1 2 2.20
Plantaginaceae 1 2 2.20
Acanthaceae 1 1 1.10
Amaranthaceae 1 1 1.10
Apiaceae 1 1 1.10
Asphodelaceae 1 1 1.10
Betulaceae 1 1 1.10
Bignoniaceae 1 1 1.10
Burseraceae 1 1 1.10
Capparidaceae 1 1 1.10
Caprifoliaceae 1 1 1.10
Chenopodiaceae 1 1 1.10
Chloranthaceae 1 1 1.10
Convolvulaceae 1 1 1.10
Cyperaceae 1 1 1.10
Dipsacaceae 1 1 1.10
Erythroxylaceae 1 1 1.10
Geraniaceae 1 1 1.10
Juglandaceae 1 1 1.10
Lauraceae 1 1 1.10
Malesherbiaceae 1 1 1.10
Moraceae 1 1 1.10
Myristicaceae 1 1 1.10
Myrtaceae 1 1 1.10
Olacaceae 1 1 1.10
Onagraceae 1 1 1.10
Phytolaccaceae 1 1 1.10
Ranunculaceae 1 1 1.10
Rosaceae 1 1 1.10
Rubiaceae 1 1 1.10
Salicaceae 1 1 1.10
Tiliaceae 1 1 1.10
Ulmaceae 1 1 1.10
Vitaceae 1 1 1.10
Zingiberaceae 1 1 1.10
Non Plant Material 1 1 1.10
TOTAL 82 91 100.10
Table 1. Plants used for respiratory health in Northern Peru
333

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
proach healers, collectors and market vendors and explain the
premise for the study, including the goal of conservation of
medicinal plants in the area.
Vouchers of all specimens were deposited at the Herbario
Truxillensis (HUT, Universidad Nacional de Trujillo), and
Herbario Antenor Orrego (HAO, Universidad Privada Antenor
Orrego Trujillo). In order to recognize Perus rights under the
Convention on Biological Diversity, most notably with regard
to the conservation of genetic resources in the framework of a
study treating medicinal plants, the identifcation of the plant
material was conducted entirely in Peru. No plant material was
exported in any form whatsoever.
Nomenclature
Te nomenclature of plant families, genera, and species fol-
lows the catalogue of Brako and Zarucchi (1993) and Jrgensen
and Len-Yanez (1999). Te nomenclature was compared to the
TROPICOS database. Species were identifed using the available
volumes of the Flora of Peru (McBride 1936-1981), as well as
Jrgensen & Ulloa Ulloa (1994), Pestalozzi (1998) and Ulloa
Ulloa & Jrgensen (1993), and the available volumes of the
Flora of Ecuador (Sparre & Harling 1978-2009), and reference
material in the herbaria HUT, HAO, QCA, LOJA and QCNE.
Results
A total of 91 plant species belonging to 82 genera and 48
families were documented and identifed as respiratory system
herbal remedies in Northern Peru. Most species used were As-
teraceae (15 species, 16.67%), followed by Lamiaceae and Faba-
ceae (8.89% and 5.56%). Most other families contributed only
one species each to the pharmacopoeia (Table 1). A complete
overview of all plants encountered, including data on use-recipes
and preparation, is given in Appendix 1. Te most important
families are clearly similarly well represented in comparison to
the overall medicinal fora, although some other medicinally
important families (e.g. Euphorbiaceae, Lycopodiaceae, Cucur-
bitaceae) are completely missing from the respiratory portfolio
(Table 2) (Bussmann & Sharon 2006).
Te majority of respiratory disorder herbal preparations were
prepared from the leaves of plants (27.69%), while the whole
plant (18.46%), fowers (13.85%) and stems (17.69%) were
used less frequently (Table 3, Bussmann & Sharon 2006). Tis
indicates that the local healers count on a very well developed
knowledge about the properties of diferent plant parts. In al-
most 55% of the cases fresh plant material was used to prepare
remedies, which difers little from the average herbal prepara-
tion mode in Northern Peru. About 86% of the remedies were
applied orally, while the remaining ones were applied topically.
Over half of all remedies were prepared as mixtures of multiple
ingredients by boiling plant material either in water or in sug-
arcane spirit.
Discussion
Respiratory disorders are so common globally, and over-the
counter remedies, both allopathic and complementary, so fre-
quently sold, that much efort has been put into the verifcation
of traditional remedies. Almost 50% of the plants found in the
respiratory pharmacopoeia of Northern Peru, or their congeners
have been studied for their medicinal properties. Te original
hypothesis that many species employed for respiratory illnesses
would be non-native, introduced to treat diseases that were
originally also introduced by colonialists, did not hold how-
ever. Quite contrarily, many remedies for respiratory ailments
are native to the study area (Bussmann & Sharon 2006). From
this perspective it is surprising to see how many species have
actually been studied at least preliminarily. Biella et al. (2008)
report on the activity in an extract of Alternanthera. Braga et
al. (2007) worked on Schinus molle. Other examples include
Apium graveolens (Atta & Alkofahni 1998), Acmella (Hoeltz et
al. 2002), Clibadium (Perez-Garcia et al. 2001), Eupatorium
(Jaric et al. 2007), Flaveria (Bardn et al. 2007), Perezia (En-
rquez et al. 1980), Senecio (Uzun et al. 2004), Tagetes (Caceres
et al. 1991), Alnus and Sambucus (Turner & Hebda 1990),
Jacaranda (Gachet & Schhly 2000), Raphanus (Ishtiaq et al.
2007), Cordia (Molina-Salinas 2007), Scabiosa (Abad et al.
1996), Bursera (Kumarasamy et al. 2002), Erythroxulum (Weiil
1978), Myroxylon (Linares & Bye 1987), Prosopis (Hebbar et al.
2004), Lanandula (Hajahashemi et al. 2003; Uzun et al. 2004),
Cinchona (Rojas et al. 2006), Juglans (Cruz-Vega et al. 2008),
Uncaria (Deharo et al. 2004; Heitzmann et al. 2005), Cymbo-
pogon and Cinnamomum (Giron et al. 1991; Wannissorn et al.
2005), Plantago and Eucalyptus (Andrade-Cetto 2008; Rakover
et al. 2008), Malva and Alcea (Carmona et al. 2005), Dracaena
(Mothana et al. 2006), Allium (Petkov 1986; Bielroy 2004; Al-
Momani et al. 2007), Rubus (Rvra & Obn 1995; Ritch-Krc
et al. 1996), Stachys (Duarte et al. 2005), Satureja (Caceres et
al. 1991; Redi 2007), Salvia (Ali-Shatayeh et al. 2000) and
Tymus (Jari et al. 2007).
Plant used in
respiratory treatments
Medicinal Flora of Northern Peru
Family % Family %
Asteraceae 16.67 Asteraceae 13.64
Fabaceae 5.56 Fabaceae 6.82
Lamiaceae 8.89 Lamiaceae 4.87
Solanaceae 3.33 Solanaceae 4.09
Euphorbiaceae 0 Euphorbiaceae 2.33
Poaceae 3.33 Poaceae 2.33
Apiaceae 1.11 Apiaceae 2.14
Lycopodiaceae 0 Lycopodiaceae 1.95
Cucurbitaceae 0 Cucurbitaceae 1.75
Rosaceae 1.11 Rosaceae 1.75
Table 2. Comparison of respiratory treatments to the ten most im-
portant plant families of the medicinal fora of Northern Peru (after
Bussmann & Sharon 2006)
Plant part % #
Leaves 27.69 36
Whole plant 18.46 24
Stems 17.69 23
Flowers 13.85 18
Seeds 6.15 8
Bark 5.38 7
Root 2.31 3
Fruit 2.31 3
Wood 1.54 2
Bulb 0.77 1
Table 3. Part of medicinal plant used in Peru for the treatment of
respiratory disorders.
334
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
Conclusions
Respiratory tract infections continue to be a major health
challenge worldwide especially due to the increasingly fast
development of resistance to the drugs currently in use. Many
plant species are traditionally used for respiratory illness treat-
ment, and some have been investigated for their efcacy with
positive results. An often-limiting factor to these investigations
is lack of comprehensive ethnobotanical data to help choose
plant candidates for potency/efcacy tests. Since the plant parts
utilized in preparation of remedies are reported in this survey, it
serves as an indication of species that may need further ecological
assessment on their regeneration status.
Te results of this study show that both indigenous and in-
troduced species are used for the treatment of respiratory system
disorders. Te information gained on frequently used traditional
remedies might give some leads for future targets for further
analysis in order to develop new drugs. However, more detailed
scientifc studies are desperately needed to evaluate the efcacy
and safety of the remedies employed traditionally.
Acknowledgements
Te presented study was fnanced through MIRT/MHIRT
(Minority Health Disparity International Research and Training)
a grant from the National Institutes of Health (Fund: 54112B
MHIRT Program, Grant: G0000613). Fieldwork for this
project was supported through the assistance of a large number
of MIRT/MHIRT students and volunteers. Tanks to all of
them. None of the work would have been possible without the
invaluable collaboration of Douglas Sharon and our Peruvian
colleagues, especially curanderas Julia Caldern, Isabel Chinguel,
and Olinda Pintado, curanderos Germn Santisteban and Le-
oncio Carrin, and herbalists Manuel Bejarano, Elmer Cruz,
and Ivn Cruz. Tanks also go to Eric Rodriguez (Herbarium
Truxillense, HUT) and Abundio Sagastegui, Segundo Leiva,
and Mario Zapata (Herbario Antenor Orrego, HAO) for the
use of their facilities and their assistance in plant identifcation.
Literature cited
AbadM.J.,P.Bermejo,E.Carretero,etal.1996.Antiinfammatory
activity of some medicinal plant extracts from Venezuela.
J. Ethnopharmacol. 55(1): 63-68.
Ali-Shatayeh M.S., Z.Yaniv & J Mahajna. 2000. Ethnobotanical
survey in the Palestinian area: a classifcation of the
healing potential of medicinal plants. J. Ethnopharmacol.
73(1-2): 221-232.
Al-Momani W., E. Abu-Bsaha, S. Janakat, R.A. Nicholas & R.D
Ayling. 2007. In vitro antimycoplasmal activity of six
Jordanian medicinal plants against three Mycoplasma
species.TropAnimHealthProd.39(7):515-519.
Andrade-Cetto A. 2008. Ethnobotanical study of the medicinal plants
from Tianchinol, Hidalgo, Mexico. J. Ethnopharmacol.
122(1): 163-71.
AttaA.H. &AAlkofahi. 1998.Anti-nociceptive and anti-infam-
matory effects of Jordanian medicinal plant extracts. J.
Ethnopharmacol. 60(2): 117-124.
BardnA.,S.Borkosky,M.I.Ybarra,S.Montanaro&ECartagena.
2007. Bioactive plants from Argentina and Bolivia. Fito-
terapia 78(3): 227-231.
Biella CdeA., M.J. Salvador, D.A. Dias, M. Dias-Baruff & L.S
Pereira-Crott. 2008. Evaluation of immunomodulatory and
anti-infammatory effects and phytochemical screening
of Alternanthera tenella Colla (Amaranthaceae) aqueous
extracts.Mem.Inst.OswaldoCruz103(6):569-577
Bielroy L. 2004. Complementary and alternative interventions in
asthma, allergy and immunology. Ann Allergy Asthma
Immunol.93(2Suppl1):45-54.
Braga F.G., M.L. Bouzada, R.L. Fabri, M. et al. 2007. Amteileish-
manial and antifungal activity of plants used in traditional
medicineinBrazil.J.Ethnopharmacol.111(2):396-402.
BrakoL.&J.L.Zarucchi(Eds,),1993.CatalogueoftheFlowering
Plants and Gymnosperms of Peru. Missouri Botanical
Garden, Saint Louis, MO.
Breevort P., 1998.The Booming U. S. Botanical Market:A New
Overview. HerbalGram 44: 33-46.
Bussmann R.W., 2006. Manteniendo el balance de naturaleza y
hombre,Ladiversidadforsticaandinaysuimportancia
porladiversidadculturalejemplosdelNortedePery
Sur de Ecuador. Arnaldoa13(2):382-397.
Bussmann R.W. & D. Sharon. 2006. Traditional plant use in North-
ern Peru, Tracking two thousand years of health culture.
Journal of Ethnobiology and Ethnomedicine 2,47.
CaceresA.,A.V.Alvarez,A.E. Ovando & B.E. Samayoa. 1991.
Plants used in Guatemala for the treatment of respiratory
diseases. 1. Screening of 68 plants against gram-positive
bacteria.J.Ethnopharmacol.31(2):193-208.
CaminoL.,1992.Cerros,plantasylagunaspoderosas,lamedicina
alnortedePer.Lima,LluviaEditores.
Carmona M.D., R. Llorach, C. Obon & D. Rivera. 2005. Zahraa,
a Unami multicomponent herbal tea widely consumed in
Syria: components of drug mixtures and alleged medicinal
properties. J. Ethnopharmacol. 102(3): 344-350.
Cruz-Vega D.E., M.J. Verde-Star, N. Salinas-Gonzlez, et al.2008.
Antimycobacterial activity of Juglans regia, Juglans mollis,
Carya illinoensis and Boconia frutescens. Phtother. Res.
22(4):557-559.
DeFeoV.,1992.MedicinalandmagicalplantsonnorthernPeruvian
Andes. Fitoterapia 63: 417440.
Deharo E., R. Baelmans, A. Gimenez, C. Quenevo & G. Bourdy.
2004. In vitro immunomodulary activity of plants used
by the Tacana ethnic group in Bolivia. Phytomedicine
11(6): 516-522.
Duarte M.C., G.M. Fugueira, A. Sartoratto, V.L. Rehder & C. Delar- te M.C., G.M. Fugueira, A. Sartoratto, V.L. Rehder & C. Delar-
melina. 2005. Anti- Candida activity of Brazilian medicinal
plants.J.Ethnopharmacol.97(2):305-311.
EnrquezR.,J.Ortega&X.Lozoya.1980.Activecomponentsof
Pereziaroots.J.Ethnopharmacol.2(4):389-393.
EsSalud/Organizacin Panamericana de Salud. 2000. Estudio
Costo-Efectividad: Programa Nacional de Medicina
Complementaria. Seguro Social de EsSalud (Study of
Cost- Effectiveness: National Program in Complementary
Medicine. Social Security of EsSalud). Lima, EsSalud/
Organizacin Panamericana de Salud (Pan American
Health Organization).
Gachet M.S. & W. Schhly. 2000. Jacaranda An ethnopharma-
cological and phytochemical review. J. Ethnopharmacol.
121(1): 14-27.
GirnL.M.,V.Freire,A.Alonzo&A.Cceres.1991.Ethnobotanical
surveyofthemedicinalforausedbytheCaribsinGuate-
mala. J. Ethnopharmacol. 34(2-3): 173- 187.
HajhashemiV.,A.Ghannadi&B.Sharif.2003.Anti-infammatory
and analgesic properties of the leaf extracts and essential
oils of Lavandula angustifolia Mill. J. Ethnopharma-
col.89(1):67-71
Hebbar S.S., V.H. Harsha, V. Shripathi & G.R. Hedge. 2004. Ethno-
medicine of Dharwad district in Karnataka, India plants
usd in oral health care. J. Ethnopharmacol. 94(2- 3):
261-266.
Heitzman M.E., C.C. Neto, E. Winiarz, A.J. Vasiberg& G.B. Ham-
mond. 2005. Ethnobotany, phytochemistry and pharmacol-
ogyofUncaria(Rubiaceae)Phytochemistry66(1):5-29.
335

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
Holetz F.B., G.L. Pessini, N.R. Sanches, D.A. Cortez, C.V. Nakamura
& B.P. Filho. 2002. Screening of some plants used in the
Brazilian folk medicine for the treatment of infectious
diseases.Mem.Inst.OswaldoCruz97(7):1027-1031.
Ishtiaq M., W. Hanif, M.A. Khan, A. Ashraf & A.M. Butt. 2007. An
ethnomedicinal survey and documentation of important
medicinal folklore food phytonims of fora of Samahni
valley, (Azad Kashmir) Pakistan. Pak. J. Biol. Sci. 10(13):
2241-2256.
JariS.,Z.Popovi,M.Macunkanovi-Jovi,etal.2007.Anethno-
botanical study on the usage of wild medicinal herbs from
Kapaonik Mountain (Central Serbia) J. Ethnopharmacol.
111(1): 160-175
JoralemonD.&D.Sharon.1993.SorceryandShamanism,Curan-
deros and Clients in Northern Peru. University of Utah
Press, Salt Lake City.
Jrgensen P.M. & S. Len-Yanez (Eds.), 1999. Catalogue of the
vascular plants of Ecuador. - Monographs in Systematic
Botany from the Missouri Botanical Garden 75.
Jrgensen P.M. & C. Ulloa Ulloa. 1994. Seed plants of the High
Andes of Ecuador - a Checklist. AAU Reports 34: 1-443.
KumarasamyY.,P.J.Cox,M.Jaspars,.L.Nahar&S.D.Sarker.2002.
Screening seeds of Scottish plants for antibacterial activity.
J. Ethnopharmacol. 83(1-2): 73-77.
Linares E. & R.A. Bye Jr. 1987.A study of four medicinal plant
complexesofMexicoandtheadjacentUnitedStates.J.
Ethnopharmacol.19(2):153-183.
McBride J.F. (Ed,), 1936-1981. Flora of Peru. Fieldiana, Botany.
Field Museum of Natural History, Chicago.
Molina-Salinas G.M., A. Prez-Lpez, P. Becerril-Montes, et al.
2007. Evaluation of the fora of northern Mexico for in
vitro antimicrobial and antituberculosis activity. J. Eth-
nopharmacol.109(3):435-441.
Mothana R.A., R. Metel, C. Reiss & U. Lindequist. 2006. Phyto- 2006. Phyto-
chemical screening and antiviral activity of some medicinal
plants from the island Socotra. Phytother. Res. 20(4):
298-302.
Prez-GarciaF.,E.Martin,T.Adzet&S.Caigueral.2001.Actic-
ity of plant extracts on the respiratory burst and the stress
protein synthesis. Phytomedicine 8(1): 31-38
PestalozziH.U.,1998.Florailustradaaltoandina.HerbarioNacional
de Bolivia and Herbario Forestal Nacional Martn Carde-
nas, Cochabamba.
PetkovV.1986.Bulgariantraditionalmedicine:asourceofideasfor
phytopharmacological investigations. J. Ethnopharmacol.
15(2): 121-132.
PoliaM.,1988.LasLagunasdelosEncantosMedicinaTradicional
Andina en el Peru septentrional. Lima, CePeSer.
RakoverY.,E.Ben-Ayre&L.H.Goldstein.2008.The treatment of
respiratory ailments with essential oils of some aromatic
medicinal plants. Harefuah 147(10): 783-788, 838.
Redzi S. 2007. The ecological aspects of ethnobotany and ethno-
pharmacology of population in Bosnia and Herzegovina.
Coll.Antropol.31(3):869-890.
Ritch-KrcE.M.,S.Thomas,N.J.Turner&G.H.Towers.1996.Car-
rier herbal medicine: traditional and contemporary plant
use.J.Ethnopharmacol.52(2):85-94.
RojasJ.J.,V.J.Ochoa,S.A.Ocampo&J.F.Muoz.2006.Screening
for antimicrobial activity of ten medicinal plants used in
Colombian folkloric medicine: a possible alternative in the
treatment of non-nosocomial infections. BMC Comple-
ment. Altern. Med. 6: 2.
Rvra D. & C. Obn. 1995. The ethnopharmacology of Madeira
and Porto Santo Islands, a review. J. Ethnopharmacol.
46(2):73-93.
SharonD.1978.WizardoftheFourWinds,AShaman'sStory.Free
Press,NewYork.
SharonD.1980.ElChamndelosCuatroVientos.Sigloveintiuno
editores, Mxico, D.F.
SharonD.1994.Tunoysuscolegas,notascomparativas.In;Millones
L.,LemlijM.(Eds.),EnelNombredelSeor,Shamanes,
demoniosycuranderosdelnortedelPer.AustralisS.A.,
Lima pp.128-147.
Sharon, D. 2000. Shamanismo y el Cacto Sagrado - Shamanism and
the Sacred Cactus. San Diego Museum Papers 37.
Sharon D. &, R.W. Bussmann. 2006. Plantas Medicinales en la
ObradelObispoDonBaltasarJaimeMartnezCompaon
(Siglo XVIII). In, Millones L. & T. Kato (Eds), Desde el
exterior,ElPerysusestudios.TercerCongresoInterna-
cional de Peruanistas, Nagoya,UNMSM, FEFCS, Lima,
pp. 147-165.
Sparre G. & B. Harling. 1978-2009. Flora of Ecuador (various
authors). Council for Nordic Publications in Botany. Bo-
tanical Museum, Copenhagen, Denmark.
Turner N.J. & R.J. Hebda. 1990. Contemporary uses of bark for
medicine by two Salishan native elders of southeast Van-
couberIsland,Canada.J.Ethnopharmacol.29(1):59-72.
UlloaUlloaC.&P.M.,Jrgensen.1993.rbolesyarbustosdelos
Andes del Ecuador. AAU Reports 30: 1-263.
UNCCD (United Nations Conference on Trade and Development).
2000. Systems and National Experiences for Protect-
ing Traditional Knowledge, Innovations and Practices.
Background Note by the UNCTAD Secretariat. Geneva,
United Nations Conference on Trade and Development,
(document reference TD/B/COM.1/EM.13/2).
Uzun E., G. Sariyar, A. Andersen, B. Karakoc, G. Otk, E. Oktayo-
glu & S. Pirildar. 2004. Traditional medicine in Sakarya
province (Turkey) and antimicrobial activities of selected
species.J.Ethnopharmacol.95(2-3):287-296.
Wannissorn B., S. Jarikasem, T. Siriwangchai & S. Thubthimthed.
2005. Antibacterial properties of essential oils from Thai
medicinal plants. Fitoterapia 76(2): 23-236.
WeilA.T.1978.Cocaleafastherapeuticagent.AmJDrugAlcohol
Abuse 5(1):75-86.
WHO(WorldHealthOrganization).1998.Report,TechnicalBriefng
on Traditional Medicine. Forty-ninth Regional Committee
Meeting,Manila,Philippines,18September1998.Manila,
WHORegionalOffcefortheWesternPacifc.
WHO(WorldHealthOrganization).1999a.ConsultationMeetingon
Traditional Medicine and Modern Medicine, Harmonizing
the Two Approaches. Geneva, World Health Organization,
(document reference (WP)TM/ICP/TM/001/RB/98
RS/99/GE/32(CHN)).
WHO(WorldHealthOrganization).1999b.Traditional,Complemen-
tary and Alternative Medicines and Therapies. Washington
DC,WHORegionalOffcefortheAmericas/PanAmerican
Health Organization (Working group OPS/OMS).
WHO (World Health Organization). 2002a. Implementation of the
WHO Strategy for Prevention and Control of Chronic
Respiratory Diseases. WHO/MNC/CRA/O2.2.
WHO (World Health Organization). 2002b. WHO Traditional
Medicine Strategy 20022005. World Health Organiza-
tion, Geneva.
WHO (World Health Organization). 2006. Mortality Country fact
sheet Peru 2006. World Health Statistics 2006
336
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
ACANTHACEAE
Aphelandra cirsioides Lindau Espina de hoja
Whole plant,
dried
Oral
2 Tbsp with 1 L boiled water, 3 cups
per day, 3-4 days.
Bronchitis ISA40
AMARANTHACEAE
Alternanthera brasiliana (L.)
Kuntze
Hierba del
oso, Veronica
(Hembra),
Moradilla de
cerro
Whole plant,
fresh or dried
Oral
5-10 g per 1 L water, mix with
Muyaca, Huamanrripa, Brochamelia.
4 cups per day, 1-2 weeks.
Bronchitis,
Asthma
RBU/PL275,
JULS11,
EHCHL78,
ISA83
ANACARDIACEAE
Mangifera indica L. Mango Leaves, dried Oral
Boil 5 Mango Leaves with 10 Moy
Leaves, 10 Eucalyptus Leaves, 5
Stems buds of Pajaro Bobo and 1
Limon (all dried Leaves) in 1l of
water for 30 minutes. Drink cold, 2
tablespoons 2 a day for 3 days.
Bronchitis,
Colds,
Infammation
(chest)
GER49
Schinus molle L. Molle, Moy
Flowers,
Leaves and
Stems, fresh
Topical
Macerate material in alcohol and
spray on patient at nighttime. Once
daily for fve days as poultice or rub
the patient's body with plant material
while bathing in the mixture. Advise
the patient to rest and to avoid going
outdoors.
Bronchitis,
Cough, Cold,
Chills
EHCHL123,
JULS196,
GER13
APIACEAE
Apium graveolens L.
Apio cimarron,
Apio
Whole plant,
fresh
Oral
Boil 1 L water, then add 10 g Apio
Cimarron. Combine with Manzanilla,
Mejorana, and Culantrillo. Drtink 4
cups per day for 1 week.
Bronchitis
JULS21,
ISA79, ISA116,
EHCHL106
ASPHODELACEAE
Aloe vera (L.) Burm f.
Sabila, Zabila,
Aloe, Hojas de
sabila, Aloe vera
Leaves, fresh Oral
1 kg of herb, 1/2 kg of Honey, and
three Tbsp of Pisco. Open the leaf
longitudinally and exctract the
iodine secretion and the internal gel
from the inside of the leaf. Consume
the iodine secretion and the gel. 1-2
cups per day for a week to a month.
Leaf can also be macerated in a bottle
of alcohol.
Cough,
Bronchitis,
Asthma
JULS274,
GER22,
EHCHL165,
VFCHL10
ASTERACEAE
Acmella cf. ciliata (H.B.K.) Cas. Ufa Root, dried Oral
Boil 100 g of Ufa root and 100 g of
Menta in 1 L of water for 10 minutes.
Patient should drink lukewarm
solution. 2 times a day for 3 days.
Cold with high
mucus
GER7
Ambrosia peruviana Willd.
Altamisa,
Marco,
Artamisa,
Manzanilla del
muerto, Ajenjo,
Llatama negra
malera, Llatama
roja malera
Leaves and
Stems, fresh
Oral
Boil 1 L water 2 min, then mix water
with a total of 10 g of Manzanilla,
Borraja, Madre Selva, Toronjil,
Hinojo and Chancas de Comida for
nerve disorders. Use Boldo, Malva,
and Linaza for liver ailments. Use
Matico, Borraja, Eucalipto, Vira vira,
and Brochamelia for Bronchitis.
Cover and let sit for 2-3 minutes.
Drink lukewarm, 3-4 cups a day for
a month. Colds: Boil 1/2 L of water
with 50 g of Altamiz and 10 g of
Sauce, Chicoria, and Pajaro Bobo for
10 minutes. 2 tablespoons every 8
hours for 8 days.
Bronchitis,
Colds womb
JULS108,
TRUBH18,
RBU/PL370,
TRUBH15,
JULS90, GER9,
GER110
Chuquiragua weberbaueri Tovar Amaro amaro
Whole plant,
fresh or dried
Oral
Boil 10g in 1 L of water for 3-4
minutes with Eucalyptus, Matico,
Mullaca, Mua, Flor de Overo. Take
one cup 3-4 times a day for a month.
Cough,
Bronchitis,
Asthma
JULS99,
EHCHL131
Clibadium cf. sylvestre (Aubl.)
Baill.
Flor de novia
Flowers,
Leaves and
Stems, fresh
or dried
Topical
1 bundle, 20 drops of perfume per 3
L boiling water. 3 baths per month.
Cold EHCHL80
Appendix 1. Species encountered and used in Northern Peru for resopiratory system disorders.
337

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
Cronquistianthus lavandulifolius
DC.
Clavelillo,
Espino de hoja,
Pulmonaria
Flowers,
Leaves and
Stems, fresh
or dried
Oral
Add 10 g of plant material, Matico,
Zarzamora, Nogal, Salvia, Borraja,
Llatama, Vira Vira. with 1 L of water.
Boil the mixture for 3-4 minutes.
Drink 1 L daily, 3 months.
Cough,
Bronchitis,
Cold, Asthma,
Pulmonary
disease
ISA5, JULS233,
GER163
Diplostephium gynoxyoides
Cuatr.
Parrano
Flowers,
fresh
Oral
Boil 10 Flowers of Parrano and 4
Leaves of Chicoria in 1/2 cup of
water for 2 minutes. Patient should
drink hot solution. 3 tablespoons 3
times a day for 5 days.
Cold,
Infammation
of the lungs
GER5
Eupatorium gayanum Wedd.
Asma Chilca,
Asma (Chica)
Leaves, fresh
1. Topcial
2. Oral
1. 200 g with Balsamo de Buddha.
Use as poultice, 2 times per month.
2. 5 g per 1 L mix with Tilo,
Huamanripa, Borraja, Nogal. 4 cups
per day, 10 days.
Cough,
Bronchitis,
Asthma
RBU/PL276,
EHCHL164
Flaveria bidentis (L.) Kuntze Mata Gusano
Flowers,
Leaves and
Stems, fresh
or dried
Oral
Boil 1 L water, then add 10 g Mata
Gusano. Drink 3-4 times per day for
1-2 weeks, or as needed.
Cough,
Bronchitis
JULS68
Oritrophium peruvianum (Lam.)
Cuatrec.
Huamanripa,
China linda,
Wia wia, Vira
vira, Hierba del
sol, Oronamo,
Maguanmarica,
Hierba del
lucero
Whole plant,
fresh or
dried
Oral
Add 10 g of plant material per 1 L,
boil 3 min. 3 cups per day, as needed.
Drink lukewarm.
Asthma,
Bronchitis,
Pneumonia
JULS58,
EHCHL126,
TRUBH29,
TRUBH26,
ISA96,
TRUVan/
Erica2,
GER166
Perezia multifora (H. & B.)
Lessing
Corzonera,
Escorcionera,
Escorzonera
Whole plant,
fresh or dried
Oral
Boil 1 L water, then add 10 g
Escorcionera. Combine with Matico,
Eucalyptus, Veronica, Vira vira,
Nogal, Huamanripa, Tilo and
Zarzamora. 3 cups per day for 15
days. Patient should drink cold
solution.
Cough,
Bronchitis,
Asthma
RBU/PL323,
JULS16,
EHCHL52,
GER160
Picrosia longifolia D. Don
Achicoria,
Chicoria
Whole plant,
fresh
Oral
Boil 10-50 g of Chicoria and
Verbena, Canchalagua, Chochocon
per 1l water, 1l daily, 15-30 days.
Alternatively chop and extract juice
of 200 g fresh material, drink 1
glass daily, no longer than a week.
Overdosing can harm vision.
Bronchitis,
Pneumonia
EHCHL116,
JULS6, GER21
Senecio canescens (H.B.K.)
Cuatrecasas
Vira Vira, Oreja
de conejo
Whole plant,
fresh
1. Oral
2. Topical
1. 10 g diced herb in boiling water,
combine with Borraja, Eucalyptus,
Corzonera, Borraja, Cerraja, Polen
de Hierbas, Manzanilla, Toronjil,
Congona, Poleo, Claveles, Juan
Alonso, Espina de hoja, and Alcanfor.
Drink 3 cups per day, 1 month.
2. Use same mixture for steam baths
and inhalation.
Bronchitis,
Asthma, Cough
TRUBH8,
JULS14,
RBU/PL322,
EHCHL104,
24, ISA108,
GER158,
TRUVan/
Erica12,
Senecio tephrosioides Turcz.
Huamanrripa,
Genciana
Whole plant,
fresh
Oral
Boil 1 cup of water, then add 10 g
of Huamanrripa, combined with
Veronica, Vira vira, Brochamelia,
and other herbs. Drink 3 cups per
day, 15 days.
Bronchitis,
Asthma,
Pneumonia
JULS12
Tagetes elliptica Sm.
Culantrillo
serrano
Whole plant,
fresh or dried
Oral
50 g of the plant and 1 cup of water
and boil for 5 minutes. Drink cold,
1/4 cup a day for 8 days.
Colds,
Bronchitis
GER184
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
338
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
Tagetes erecta L.
Flores del
muerto, Clavel
chino, Flor de
muerto
Flowers and
Leaves, fresh
Oral
Take 3 to 4 Flowers and boil in 1 L
of water along with 10 g of a mixture
of Toronjil, Pimpinela, Poleo,
Manzanilla. Drink 3 to 4 glasses a
day for 1 month.
Cough
EHCHL141,
JULS156,
GER112
BETULACEAE
Alnus acuminata H.B.K.
Aliso blanco
(Liso), Aliso
colorado
(Arrugado)
Bark, fresh Oral
Boil 10 minutes, 2 Tbsp per cup to
get the extract, Take 1 Tbsp every 4
hours.
Cold
ISA18, ISA17,
RBU/PL292
BIGNONIACEAE
Jacaranda acutifolia H. & B.
Arabisca,
Yarabisca
Leaves and
Stems, fresh
or dried
Oral
10 g per 1 L boiling water, boil 2-3
min. Drink 3 cups per day, as needed.
Cough,
Bronchitis,
Asthma,
Phlegm
RBU/PL326
BORAGINACEAE
Borrago offcinalis L. Borraja
Whole plant,
fresh or dried
Oral
10 g herb with 1 L boiling water,
boiled for 3-5 minutes, combined
with Vira Vira. Drink three times per
day or 1 L per day, as long as needed.
Bronchitis,
Lungs, Cough,
Cold
ISA112,
JULS24,
RBU/PL300,
EHCHL58
Cordia alliodora (R. & P.) Oken
Ajos giro, Ajos
quiro, Ajo sacha
Bark and
Stems, dried
Oral
Add 1 bottle of Abuelo wine with
10 g of plant material and 20 g of
Chuchuhasi, Cascarilla, Honey,
Pollen, Tutuma. Let the mixture
sit for 1 week. Drink the mixture.
Patient should not leave the house
while taking treatment. Adults take 1
small cup. Children take 1 teaspoon.
Patients take the medication 3-4
times a day until the bottle is
fnished.
Bronchitis
ISA74,
JULS281
BRASSICACEAE
Raphanus sativus L. Rabanito Tuber, fresh Oral
1/4 kg of sugar, add 1/2 kg of
Rabanito cut in pieces. Boil with a
scallion with no water. The syrup
becomes a drink for the patient.
1 Tablespoon evey 6 hours for 1
month.
Bronchitis
JULS238,
GER202
Rorippa nasturtium-aquaticum
(L.) Hayek
Berros
Whole plant
except root,
fresh or dried
Oral
Oral fresh as needed or crush and
drink juice with Alfalfa. Make a
soup with the nape of the neck of
the sheep and boil. Add potatoes
and veggies. Alternatively boil 1 L of
water with Berros, plus 10 g total of
Malva, Pie de Perro, Unquia, Amor
Seco, Chacur, Pajablanca, Flor de
Arena, Puren Rosa, and other herbs.
Boil for 3 to 4 minutes. Drink 3 to 4
times a day for 1 month.
Bronchitis
RBU/PL367,
EHCHL25,
JULS113
BURSERACEAE
Bursera graveolens (H.B.K.)
Triana & Planchon
Palo santo, Palo
de santo
Small Stems,
Bark and
Wood, dried
Oral
Boil 1l of water, then add 2 pieces of
about 5-10 g of the Palo Santo, boil
for 5 minutes. Cover and let it sit for
3 minutes. Drink hot, 1 little glass 3
times a day for 2 days only.
Cough, Flu,
Bronchitis, Cold
ISA143,
JULS210,
GER34
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
339

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
CAPPARIDACEAE
Capparis crotonoides H.B.K.
Simuro,
Bichayo, Simulo
1. Flowers,
fresh
2., 3. Leaves,
fresh
1. Oral
2., 3.
Topical
1. Boil 10 Flowers buds in 1/2 cup
of water for 2 minutes. Patient
should drink warm solution and
stay inside the house during
treatment. 1 cup a day for 8 days.
2. Crush 20 Leaves of Bichayo. Place
crushed Leaves on affected area
and masage the area with it. Patient
should not go out during treatment.
3. Add 20 g of plant material into
4-5 L of water. Boil the mixture for
5-6 minutes. Bathe with the tizana.
Do not ingest the mixture. Bath 2-3
times, as needed.
1. Bronchitis
2. Cold
3. Colds
GER4,
JULS250
CAPRIFOLIAEAE
Sambucus peruviana H.B.K.
Sauco,
Saucotillo
1. Leaves,
Flowers and
Stems, fresh
or dried
2. Flowers
and Leaves,
fresh
Oral
1. 5-20 g per 1 L, boil for 1 min,
as tea, combine with Llonque. 3
times per week, up to 1 L per day
if needed, or until fever passes.
Take while cold. Rub with Llonque.
2. Boil 1 L of water, then add 10 g
of Sauco. Add Manzanilla, Hinojo,
Coleo, Ajenjo, Toronjil, Pimpinela
and Claveles. Cover and let it sit for
2-3 minutes. Patient should drink
warm solution, 3-4 cups per day for
1 month.
1. Bronchitis, 2.
Fright / Susto,
Fever, Yellow
Fever
2. Cough, Cold
EHCHL140,
RBU/PL291,
VFCHL44,
ISA131, ISA87,
JULS246,
EHCHL110
CHENOPODIACEAE
Chenopodium ambrosioides L. Paico
Leaves and
Stems, fresh
Oral
Add 10 g of plant material with 1/2 L
of water. Drink hot, 1 cup, 2-3 times a
day for 1 week.
Cough
EHCHL112,
RBU/PL280,
EHCHL53,
JULS206
CHLORANTHACEAE
Hedyosmum racemosum (R. & P.)
G. Don.
Masamoche,
Asancito,
Asarcito,
Asarquiro,
Choleta
Bark, dried Oral
Use outside of Bark. 8-10 g per 2l
water, boil 20 min. drink as needed.
Alternatively 30 g per two bottles
of alcohol mixed with Chuchuwasi,
Cascarilla, 7 Raices, and Huayacanes
then allow to sit for 8 days. Drink as
needed, but do not drink before it
has sat 8 days.
Bronchitis,
Cold, Cough
EHCHL147,
RBU/PL377
CONVOLVULACEAE
Ipomoea paucifora M. Martens &
Galeotti
Huanarpo
Whole plant,
fresh
Oral
Put together in a bottle of caazo
(Yonque) 20 g of the plant material
plus 20 g of Cascarilla, Diego Lope,
Hualtaco. Let it sit for 8 days. Drink
temperate 1 small cup once a day or
as needed (max 2 days only).
Chills, Colds GER222
CYPERACEAE
Scirpus californicus (C.A. Meyer)
Steudel subsp. tatora (Kunth) T.
Koyama
Balsa, Totora
Whole plant,
dried
Oral
1/2 cup of water add 10 g of Totora,
10 g of Saze and boil for 3 minutes.
Drink cold, 1/2 cup a day for 8 days.
Colds
JULS111,
GER169
DIPSACACEAE
Scabiosa atropurpurea L.
Ambarina,
Ambarina
negra, Flor
de ambarina,
Ambarindas
Flowers,
fresh
Oral
Boil 1 L of water with 20 g of the plant
material and Estilo, Veronica, Hierba
del toro, Moradilla, Lancetilla,
Hierba de la rabia. Drink hot Drink
3 times a day as long as the disease
lasts.
Whooping
cough, Cold,
Cough,
Bronchitis,
Compulsive
cough
JULS100,
EHCHL111,
RBU/PL372,
ISA50
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
340
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
ERICACEAE
Gaultheria erecta Vent.
Mullaca
mistura,
Mullaca,
Mullaca real
Whole plant,
fresh or dried
Oral
1 L of water and add 10 g of Mullaca.
Include 10 g of each of the following:
Humanarripa, Escorceonera,
Eucalyptus, Matico, Veronica, and
others. Drink 1 cup 3 times a day for
1 month.
Bronchitis,
Asthma
JULS288,
JULS198
Gaultheria reticulata H.B.K.
Toromaique,
Toro maique,
Toromaike,
Maique, Maque
candela,
Toro maique
amarillo, Toro
maique verde,
Gavilan maique
amarillo,
Gavilan maique
verde
Whole plant,
fresh
Topical
20-30 minutes boil for 50 g per 7 L of
water and mix with other Maiques
(7 varieties), 10 g each of: Mishia
Blanca, Mishia colambo, Mishia
galga, Mishia morada, Mishia roja,
Mishia rosada and Toro maique.
Recite a prayer. Bath, 3 times per
week. Bathe the patient in the
mixture while rubbing him/her
with the herbs. Afterwards, rinse the
patient in water, and allow him/her
to air dry
Cold,
Bronchitics
EHCHL57,
JULS259,
RBU/PL293,
EHCHL171,
EHCHL51,
GER81,
GER241,
GER57
ERYTHROXYLACEAE
Erythroxylon coca Lam. Coca Leaves, dried Oral
Add 5 g of the leaf with 1 cup of
water. Boil the mixture for 3-4
minutes, then let it cool. Gargle 3
times a day for 2 days. Drink 1 cup
before bed for 2-3 days. Alternatively
wash and chew about 5 g of Leaves
at a time.
Cold, Cough,
Infammation
of the throat
JULS144,
GER201
FABACEAE
Dolichos lablab L. Frijol chileno Fruits, fresh Oral
Boil for 10 minutes 1/2 kg of the
plant material in 1l of water. Drink it
at room temperature. 1/2 cup 2 times
a day for 8 days.
Protects the
lungs
GER235
Medicago sativa L. Alfalfa
Flowers and
Leaves, fresh
Oral
Blend Leaves and Flowers with
water. Drain, and obtain extract.
Drink extract. Honey can be added,
if desired. Take 1 glass of extract,
twice a day.
Bronchitis
JULS96,
GER42
Melilotus alba Medikus Alfalflla Seeds, dried Oral
Boil for 10 minutes 100 g of the plant
material in 1/2 L of water. Drink
cold, 1/2 a cup. Once a day for 8
days.
Tuberculosis,
Colds,
Respiratory
infections
GER223
Myroxylon balsamum (L.)
Harms.
Quina quina,
Kina kina
Seeds, dried
1., 3. Oral
2. Topical
1. Grind 20 Seeds, mixed with Seeds
from a specifc seven other plants:
Ashango, Pucho, Amala, Ishpingo,
Mozcada, Cabalonga and put in a
bottle of wine and and amacerar for
8 days. Drink 3 small cups per day.
2. Boil 20 Seeds per 5 L water for
20-30 min with Ishpingo, Ashango,
Pucho, Amala, Raucho, Tokio, Nuez
Moscada, Pepa de Cedron (use only
the Seeds of these herbs) with 1 L of
90 proof alcohol and add 2 pieces of
tobacco, 2 pieces of Ajo Macho, 10 g
of Quina Quina, 2 Leaves of Pacra, 1
branch of both Eucalyptus and Maye.
Do not leave bath outside, take bath
every other day. 3 times per week.
3. 3 Seeds, toasted and crushed, per
1 cup of water. Drink 1/2 cup for
adults, 1 tsp for children.
1. Bronchitis
2. Bronchitis
3. Cough,
Bronchitis,
Asthma
JULS287,
RBU/PL382,
EHCHL151,
VFCHL46,
GER91
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
341

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
Prosopis pallida (H. & B. ex
Willd.) H.B.K.
Algarrobo Seeds, dried Oral
Boil 10 kg of Algarrobo Fruit and
Seeds for 3 hours in medium to high
heat until thickened. Turn off fre
and let sit until cool, then drain and
place syrup in bottle. Drink 2 Tbsp
per small cup, 3 times per day as
long as you wish.
1. Cough,
Bronchitis,
Nutritional
Supplement
JULS97, GER8
GERANIACEAE
Erodium cicutarium (L.) L'Herit.
Agujilla blanca,
Auguilla,
Augilla
Whole plant,
fresh
Oral
Boil 1 Tbsp Sap per 1 L of water,
mixed with Ambarindas, Hierba del
Toro and Sanguinaria. 1 L per day,
1-3 months.
Bronchitis
blood pressure
ISA110, ISA54
JUGLANDACEAE
Juglans neotropica Diels Nogal Leaves, fresh Oral
10 g per 1 L, boil water for 3-5 min.
For Bronchitis: mix with Matico,
Enredadera, Borraja. 3 glasses per
day, 1 L daily.
Cough,
Bronchitis,
Asthma
RBU/PL273,
ISA67,
EHCHL4,
ISA123
LAMIACEAE
Lavandula angustifolia Miller
Alucema,
Alhucema,
Labanda
Flowers,
Leaves,
Stems and
Seeds, dried
Oral
Do not use roots. Boil 1 L of water,
then add a total of 10 g of Labanda,
Romero, Claveles, Hinojo, Toronjil,
Anjenjo, Manzanilla, and Pinpinela
for 2 minutes. Patient should drink
lukewarm solution. 1 cup 3 to 4 times
a day for 1 month.
Cold
GER113,
JULS177
Lepechinia meyenii (Walpers)
Epling
Salvia, Salvia
real
Whole plant,
fresh or dried
Oral
Boil 30 g per 1 L water. Take with
meals, three times per day.
Bronchitis
RBU/PL303,
VFCHL17,
ISA91
Salvia discolor H.B.K.
Palmeras
(Chica), Llatama,
Yatama
Stems, fresh Oral
Three Leaves per cup. do not mix
with other herbs. One cup a day for
a week.
Cough
ISA93,
ISA151(93a),
ISA25
Salvia offcinalis L. Salvia
Whole plant,
fresh or dried
Oral
In 1 L of water boil 10 g of the plant
for 3-5 min. It can be mixed with
Matico, Nogal and Eucalyptus.
Drink hot, 1 cup 3 to 4 times a day as
needed. Up to one month.
Cough,
Bronchitis
JULS241
Salvia sagitatta R. & P. Salvia negra
Root and
Stems, fresh
or dried
Oral
10 g per 1 L water, drink 3 times per
day, as needed
Cough, Asthma RBU/PL318
Satureja pulchella (H.B.K.)
Briquet
Panizara,
Panisara
Leaves, fresh
or dried
Oral
Add 50 g of plant material with
Culein, Manzanilla, Chancas de
Comidas or Mua in 1/2 cup of
water. Boil the mixture for 3 minutes.
Drink the mixture cold. Take 1/8 cup
once a day, for 3 days.
Bronchitis,
Asthma
GER148,
JULS43
Stachys lanata Jacq.
Veronica
(Macho)
Whola plant,
dried
Oral
Boil 10 g Veronica Macho with 1 L
water. Combine with Salvia, Matico,
and Muyaca. Drink before or after
meals. 3 cups per day for 15 days.
Bronchitis,
Asthma
JULS13
Thymus vulgaris L. Tomillo
Leaves, Stems
and Flowers,
fresh or dried
Oral
Boil 5 g per 1 L water. Drink 3 times
per day.
Cough EHCHL169
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
342
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
LAURACEAE
Cinnamonum verum J. Presl. Canela Bark, dried Oral
1 L of water, 1 garlic clove, 10 g of
Matico, Veronica, Brochamelia, Vira
vira, 3 g of Cinnamon. Boil for 3 to
4 minutes. Drink warm, 3 to 4 times
a day as needed. After rituals drink
cold a day after rituals occurance.
Preferably in the morning during
breakfast. As much as the patient
feels is needed.
Bronchitis
JULS122,
GER101
LILIACEAE
Allium odorum L.
Cebolla china,
Cebolla
Whole plant,
fresh
Oral
Dice 15 onions in a bowl. Add a glass
of water and 1/4 kg of white sugar.
Add a piece of ginger (can also add
hen fat). Boil and stir until thick.
Drink syrup at all temeratures, 1
spoonful every 6 hours for 1 week.
Juice can also be drunk naturally.
Bronchitis,
Asthm
JULS129,
GER36
Allium sativum L. Ajo Clove, fresh Oral
Add 3 garlic cloves, 1 Chinese onion,
Matico, Corcionera, Eucalypto, Vira
Vira, white sugar and 1/2 L of water
or cow milk into a pot and boil for 3
minutes. Drink warm, 2 tablespoons
twice a day, for 1 week. Can also be
eaten raw.
Cough,
Bronchitis, Cold
JULS92,
GER37
Dracaena fragrans Ker Gawl. Flor dracena
Leaves and
Stems, fresh
or dried
Oral
10 g per 1 L water and boil. 3 cups
per day, according to treatment.
Cough,
Bronchitis,
Asthma
RBU/PL334
MALESHERBIACEAE
Malesherbia ardens Macbr. Veronica
Whole plant,
fresh or dried
Oral
Boil 5 g per 1 L, combine with
Contilo, Arabisca, and Huamanripa.
Drink Three times per day to total 1
L daily.
Cold, Cough,
Bronchitis,
Asthma
EHCHL139
MALVACEAE
Alcea rosea (L.) Cavanilles
Malva Blanca,
Malva Morada
Whole plant
except Stems,
fresh
Oral
10 g per 1 L water. Use Flowers for
cough and hemorrhages. Drink 3
times per day, as needed.
Cough
JULS78,
JULS79
Malva parvifora L.
Malva Rosa,
Malva Real
Leaves, fresh
1. Oral
2. Topical
1. Combine 1 L of water with 10 g of
Pie de Perro, Chacuro, Verbena, Cola
de Caballo, Amor Seco, and Unaza.
Also add 3-4 Leaves of Malva. Boil
the mixture for 3 minutes. Patient
should drink lukewarm solution.
Take 1 cup, 3-4 times a day, for 1
month.
2. Can also be applied as poultice.
Cough,
Bronchitis,
Coughing with
blood
JULS189
MORACEAE
Brosmium rubescens Taubert
Palo Sangre,
Palo de la
Sangre, Ablita
Wood and
Bark, fresh or
dried
Oral
7 roots or 50 g per 1 bottle of Whiskey
or Tequila mixed with Chuchuwasi,
Cascarilla. Drink during meals, two
times per day for 8-10 days.
Bronchitis
JULS209,
ISA49,
EHCHL64, 62,
RBU/PL311,
GER86
MYRISTICACEAE
Myristica fragrans L.
Nuez Moscada,
Ajonjoli
Seeds, dried Oral
Grind Seeds and boil in 1 L water 1
Seeds to make 4 glasses. Drink 4 cups
per day, 7-15 days. Alternatively
macerate Nuez Moscada with 10 g
of Ajonjoli with 1 bottle of Abuelo
wine, 10 g each of Palo Sangre, Palo
Huaco, bee honey, Pacra, Huanarpo
Macho, bee pollen, Huevo de
Angelote and Para Para. Take 1
cup in the mornings, middays and
evenings until bottle is fnished.
Cough,
Asthma,
Bronchitis
RBU/PL385,
EHCHL155,
JULS292,
GER197
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
343

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
MYRTACEAE
Eucalyptus globulus Labill.
Alcanfor,
Eucalipto
Serrano,
Eucalipto
1. Leaves,
dried
2. Leaves,
fresh or dried
1. Oral
2. Topical
1. Boiled, cover the head with steam
for 15 minutes. Boil 10 g in 1l water,
combined with Manzanilla, Matico,
Nogal, Ajos Giro and Chilca. Inhale
1 time per week, 3-4 times a month.
2. Bath, 500 g Eucalipto boiled with
with Chilca, Palo Santo, Romero,
Ajos Giro. 2 times a month, do not
use too much because plant is very
hot, patient must be naked and
covered with a sheet over his head,
then sitting to absorb the vapor for
20 minutes. Stay inside home for 24
hours after the bath. 1 every 30 days.
2 times only.
1. Bronchitis,
Respiration,
Cold, Cough,
Sinusitis,
Asthma
2. Cold,
ISA130,
JULS61,
VFCHL35,
JULS153,
GER14,
EHCHL12
OLACACEAE
Heisteria acuminata (H. & B.)
Engler
Chuchuasi,
Chuchuhuasi
Bark, fresh or
dried
Oral
Crush Bark and put in 1 bottle of
wine to macerate. Drink 1 cup 3
times a day for 15 days, stop for 15
days, then start treatment again for
15 more days.
Cold, Cough
RBU/PL287,
JULS138,
GER164
ONAGRACEAE
Fuchsia ayavacensis H.B.K.
Conchalalay,
Conchalalay
colorado
Leaves and
Stems, fresh
or dried
Topical
5 g mixed with Sauco, Nogal, Salvia,
Aasquero grande and 7 Espiritus
with 3 L boiled water. Boil for 1
hour, then let cool down to tepid
temperature (lukewarm). 2 Baos
per week in agreement with what La
Mesa indicates or twice a month.
Cold ISA82, ISA1
PHYTOLACCACEAE
Gallesia integrifolia (Spreng.)
Harms.
Palo de ajo Stems, dried Oral
Boil 20 g of Palo de Ajo with 1/2 cup
of water for 2 minutes. Drink cold,
1/8 cup a day for 8 days.
Bronchitis,
Asthma
GER116
PIPERACEAE
Piper aduncum L.
Yerba del
Soldado,
Tilonga, Matico,
Mogo-Mogo
1. Leaves,
fresh or dried
2. Leaves,
fresh
1. Oral
2. Topical
1. Boil 5-10 Leaves per 1 L of
water for 3-5 min mixed with
Salvia real, Escorsionera, Vira-
vira, Borraja, and Asma chilca.
Drink 1 L daily for 15 days.
2. Boil 50 g per 8 L for 10 minutes
combined with Eucaliptus, Laurel,
Verbena, Altamisa. Bathe twice
a week. Alternativel Grind and
pulverize 200 g of the plant material.
Apply the powder on affected areas.
Apply once a day, until the wound
is healed.
1. Cold, Cough,
Wounds,
Bronchitis,
Chills,
Tuberculosis
2. Bronchitis,
Colic (women
VFCHL26,
RBU/PL277,
TRUVan/
Erica24,
JULS15,
GER141,
JULS199
Piper nigrum L. Pimienta negra Seeds, dried Oral
Add plant material, Asma Chilca,
Borraja, Escorcionera, Muyaca,
Vira Vira, Veronica, Cinnamon
and a portion of Garlic. Make the
mixture concentrated by boiling for
5 minutes. Drink hot. Take 1 cup, 2
times a day, for 2 weeks.
Bronchitis JULS227
PLANTAGINACEAE
Plantago linearis H.B.K.
Llantn serrano,
Llantn de la
costa
Root, fresh Oral
Boil 2 roots per 1 L water for three
minutes and combined with Matico,
Nogal, Vira vira, Eucalipto. Drink 4
times a day, as needed.
Cough,
Bronchitis
JULS35,
JULS86,
GER133
Plantago major L. Llantn
Seeds, fresh
or dried
Oral
10 g or 1 Tbsp per 1 L of water, one
cup in the morning, at noon and one
in the evening, before eating.
Bronchitis,
Cough
VFCHL50,
EHCHL11,
TRUVan/
Erica13
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
344
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
POACEAE
Cymbopogon citratus (DC.) Stapf.
Cedron, Hierba
Luisa, Maria
Luisa
Leaves, Roots
and Stems,
fresh or dried
Oral
Boil 1 L of water, then add 5 g
of Hierba Luisa. Let sit for 2 to 3
minutes. Add a little Tequila. Stems
have more alkaloids and more
strength. Patient should drink hot
solution. May consume with food
best at breakfast.
Cold, Cough,
Flu
EHCHL16,
VFCHL30,
JULS181,
GER25
Uncaria tomentosa (Willdenow
ex Roemer & Schultes) DC.
Ua de gato,
Uncaria
tormentosa, Ua
de gato de la
selva
Leaves and
Stems, fresh
or dried
Oral,
Topical
Grind material. Better used dried.
Boil 10 g per 1 L water, 10 min
combined with Chanca Piedra,
Linaza, Boldo, Flor de Overo, Bolsa
de Pastor. Drink 1 L daily, three
times per day for 15 days at least or
as needed. Drink lukewarm. Solution
can also be used in a poultice. Wash
wound and apply soaked Leaves.
Bronchitis,
Asthma
VFCHL11,
RBU/PL263,
EHCHL103,
JULS275,
GER230
Zea mays L.
Espiga de maiz,
Chuno de maiz,
Maiz
Seeds, dried Oral
1/2 L of water, 1/2 kg of corn, a
bunch of Chancaca and boil for 5 to
10 minutes (until corn is cooked).
Hot servings (reheat if not fresh).
Once eaten, stay in room, do not
come out to rid the chills. 2 times a
day for 2 days.
Chills, Pain in
the lungs
JULS69,
JULS139,
GER31,
GER186
RANUNCULACEAE
Laccopetalum giganteum (Wedd.)
Ulbrich
Huamanripa,
Pacra, Flor de
guarmarya
Leaves, fresh
or dried
Oral
2 small Leaves per 1/2 L water, boil.
Drink 1 L per day, until 3 months.
Cough,
Bronchitis,
Asthma, Flu,
Cold
VFCHL53,
GER162,
RBU/PL321,
EHCHL42,
JULS284,
ROSACEAE
Rubus robustus C. Presl.
Zarzamora,
Moyaca, Zarza,
Zarza parrilla,
Mora, Cushai
Flowers and
Leaves, fresh
or dried
Oral
3 Flower buds per cup boiled water,
mixed with Llatama. Drink 1 L per
day, 1 month. Can also be inhaled.
Cough,
Bronchitis
EHCHL132(a),
ISA41, ISA48,
JULS47,
EHCHL132(b)
RUBIACEAE
Cinchona offcinalis L.
Cascarilla,
Quinuagiro
1. Flowers
and Leaves,
dried
2. Bark
Oral
1. 1 Tbsp per 1 L boiling water,
mixed with Flor Blanca, Grama
Dulce and Rose essence, 1 L
daily for 2 months or more.
2. Boil 50 g of Cascarilla in 1 cup
of water for 10 minutes. Drink
lukewarm 1/4 cup 1 time a day for
15 days.
1. Cough
2. Colds
RBU/PL314,
JULS127,
ISA19, GER167
SALICACEAE
Salix chilensis Molina Sauce Leaves, fresh
1. Topical
2. Oral
1. Smash Leaves for juice, apply
as enema once. Do not ingest. Use
only when the patient is very sick.
2. Boil 10 g of Sauce and 10 Fruits of
Capuli in 1 L of water for 30 minutes.
Drink warm, 1/2 small cup every
time the patient has chills.
Colds
TRUBH25,
JULS82,
GER39
SCROPHULARIACEAE
Escobedia grandifora (L.f.)
Kuntze
Azafran
Flowers,
dried
Oral
Boil 1/2 L of water for 3 mins with
20 g of Azafran. Drink hot, 1 cup in
the morning, 1 cup in the night for
a week.
Bronchitis,
Pneumonia,
Chills (general)
JULS110
Galvesia fruticosa J. Gmelin Curil, Macacha
Flowers,
Leaves and
Stems, fresh
or dried
Oral
In 1 L of water add 10 g of the Flowers
and the Stems plus Zarzamora and
Matico, Nogal. 3 to 4 times a day for
2 weeks.
Cold,
Bronchitis,
Asthma
VFCHL37,
JULS289
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
345

Medicinal plants of Peru used in respiratory disorders
Rev. peru. biol. 17(2): 331 - 346 (August 2010)
SOLANACEAE
Cestrum auriculatum L'Herit
Hierba santa,
Agrasejo
Leaves, fresh
or dried
Oral
5 g per 1 L with Corpus Way,
Carqueja, and Flor de Overo. Drink
1 L per day.
Cough,
Bronchitis
JULS166,
RBU/PL281,
EHCHL172,
ISA122,
GER174,
EHCHL102
Solanum americanum Mill.
Hierba mora,
Hierba del
susto, Baja del
espanto, Semora
Fruits fresh Topical
Crush 20 fruits to extract juice, 2
drops per nostril.
Sinusitis, Flu,
Cold
EHCHL125,
JULS76,
EHCHL87,
GER85,
GER159
Solanum tuberosum L. Chuno de papa Tuber, dried Oral
1/2 kg of Chuo de Papa in 1/2 L of
water. Add Chancaca, Angamacha,
Valeriana Estrella and boil for 10 to
15 minutes or until the starch comes
out. Remove it from the fame. Serve
hot as a pudding or a candy 3 times
a day for 2 days within 10 days of
the baby's birth. The preparation
makes a kind of candy and should
be served hot. Oral it while blowing
on it because it should be consumed
freshly cooked. Take the last dose in
bed so not to go outside in the cold.
Bronchitis,
Respiratory
problems
JULS140,
JULS141
TILIACEAE
Tilia platyphyllos Scop. Tilo
Flowers and
Leaves, fresh
Oral
Boil 1 L of water, then add 10g of
Sauco. Add Manzanilla, Hinojo,
Coleo, Ajenjo, Toronjil, Pimpinela
and Claveles. Cover and let it sit for
2-3 minutes. Patient should drink
warm solution, 3-4 cups per day for
1 month.
Cough, Cold JULS257
ULMACEAE
Celtis loxense C.C. Berg
Palo huaco, Palo
blanco
Bark, Stems
and Leaves,
dried
Oral
Add plant material, Palo Sangre,
Chuchuasi, Huanaco, Huevo
Angelote, Pacra, Pollen, Miel de
Palo, Honey, Chuchuwasi, Cascarilla
and Huanarpo Macho into a mixture
with 1 bottle of Abuelo wine or
Tequila. Let mixture sit for 1 week.
Drink cold, 1 small wine glass 3
times a day until bottle is fnished.
Patient can repeat the treatment.
Bronchitis
JULS208,
EHCHL65,
GER87,
ISA7
VERBENACEAE
Clerodendron sp. Brochamelia
Flowers,
fresh or dried
Oral
1 L of water and add 10 g of the
herb. Boil for 3 to 5 minutes. Can be
mixed with 10 g of Huamanripa and
Veronica. Drink 1 cup 3 times a day
for 2 weeks. Toz Ferina indicates a
condition, where a baby can't breathe
and turns blue and makes a "rooster
like" noise.
Bronchitis,
Asthma,
Whooping
cough
JULS115
Lantana scabiosaefolia H.B.K.
Mastrando,
Mastrante
Leaves and
Stems, fresh
or dried
Oral
20-100 g per 1 L water, boil 3 min.
mix with Canchalagua, Culantrillo,
Purenrosa, Panisara, and Salvia Real.
1 L per day, 3 days. Patient should
drink lukewarm solution. This
treatment is only for women.
Cold
VFCHL51,
GER6
Lippia integrifolia (Grieseb.)
Hieron
Poleo del inca
Leaves and
Stems, fresh
Oral 5 g per 1L water, 1 L daily, 1 month. Cold, Bronchitis EHCHL76
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
346
Bussmann & Glenn
Rev. peru. biol. 17(2): 331 - 346 (Agosto 2010)
Verbena littoralis H.B.K.
Verbena,
Berbena
Whole plant,
fresh or dried
Oral
Boil 30 g per 1 L for 3 min., mix with
Cerraja, Moradilla, and Verdolaga. 2
glasses per day for 4 days. Take one
in the morning and one at night.
Colds
RBU/PL369,
JULS77,
EHCHL69,
VFCHL28,
GER138
VITACEAE
Vitis vinifera L. Uva Fruits, dried Oral
Add 1/2 L of fresh milk with 10 g of
dried grape (raisin). Boil the mixture
for 3-4 minutes. Drink hot. Take 1
glass, 3 times a day for 2 weeks.
Bronchitis JULS266
ZINGIBERACEAE
Zingiber offcinale Roscoe
Kion, Quion,
Gengibre,
Gengible
Root, fresh Oral
Cut Kion into small pieces. Add 10 g
of this, along with Matico, Nogal and
Veronica. Boil in 1/2 L of water. Take
1 cup, 3 times a day for 1 week.
Cold, Cough,
Bronchitis
JULS237,
GER206
NON PLANT MATERIAL

Polen de Zapote,
Polen de Espina
Negra, Polen de
Arboles, Polen
de Ciachon
(Insect feces)
Insect feces Oral
Insect larvae bore into the root of
the tree. Use the feces of the larvae
('pollen'). 4 g per 1 L water. Is very
strong, so use a small amount. 1 L
daily, 1 month
Bronchitis,
Asthma,
Tuberculosis
ISA124
Appendix 1. Continuation.
Family/Genus/Species
Indigenous
name
Plant part
used
Admin. Preparation Use Coll. #
347

Palmeras usadas por los indgenas Ashninkas
Rev. peru. biol. 17(3): 347 - 352 (December 2010)
Rev. peru. biol. 17(3): 347 - 352 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Palmeras usadas por los indgenas Ashninkas en la Amazona Peruana
Joanna Sosnowska
1
, Damaso Ramirez
2
y Betty Milln
2
Palms used by Ashaninka indigenous people in Peruvian Amazon
1 W. Szafer Instituto de Botnica,
Academia Polaca de Ciencias,
ul. Lubicz 46, 31-512 Cracovia,
Polonia.
Emai l Joanna Sosnowska:
j.sosnowska@botany.pl
2 Museo de Historia Natural, Uni-
versidad Nacional Mayor de San
Marcos, Avda. Arenales 1256 Jess
Mara, Lima 14, Per.
Email Damaso Ramirez: wilsonX-
VIII@gmail.com,
Email Betty Milln: bmillans@
unmsm.edu.pe, bmillans@gmail.
com
Presentado: 12/02/2010
Aceptado: 23/07/2010
Publicado online: 00/11/2010
Resumen
El presente artculo muestra el conocimiento e importancia de las palmeras en la vida de los nativos Ashninkas.
Presentamos una descripcin cualitativa y cuantitativa de 32 entrevistas, obtenidos durante la visita a siete
comunidades nativas ubicadas en los mrgenes de los ros Peren y Tambo en el departamento Junn, Per.
Registramos 15 especies de palmeras usadas por los Ashninkas, agrupadas bajo cinco categoras de uso:
alimenticio, construccin, herramienta, ornamental y medicinal. Las especies con usos ms amplios son: Attalea
phalerata, Bactris gasipaes, Oenocarpus bataua y Socratea exorhiza. Las partes de las palmeras ms utilizadas
son los frutos, principalmente gracias a su valor comestible. La cercana de las comunidades Ashninkas del
valle del Peren a ciudades, infuiran en un cambio en el tipo de vida tradicional, donde las palmeras son los
ms importantes recursos naturales utilizados por ellos. Sin embargo, en las comunidades del valle Tambo la
vida tradicional, el conocimiento y practica en el uso de las palmeras esta an vital.
Palabras clave: Arecaceae, Ashninka, etnobotnica, Per.
Abstract
In this paper we present traditional knowledge and importance of palms in Ashaninka peoples life. Qualitative
and quantitative description is based on 32 interviews obtained during visits in seven native communities situ-
ated near by Perene and Tambo rivers in Junn department of Peru. We registered 15 species of palms used
by Ashaninka people; those were classifed in fve categories by use: food, construction, tools, ornaments and
medicaments. Species with the most diverse uses were Attalea phalerata, Bactris gasipaes, Oenocarpus bataua
and Socratea exorhiza. The most useful palm parts are fruits used mainly as a food. The proximity of Ashninkas
communities from Peren Valley to the cities would produce a change in the traditional way of life, where palm
trees are the most important natural resources used by them. However, the traditional life, knowledge and
practice in using of palms are still alive in communities of Tambo River.
Keywords: Arecaceae, Ashaninka, ethnobotany, Peru.
Introduccin
Los Ashninkas son uno de los pueblos nativos ms nu-
merosos de la Amazona peruana. Mucho se ha escrito sobre su
cultura, organizacin social y violencia poltica en su territorio
(Varese 2006, Weiss 2005). En este artculo intentamos mostrar
el conocimiento e importancia de las palmeras en su vida.
Tradicionalmente, los Ashaninkas vivan como familias
dispersas en el monte, orgullosos de su autonoma, libertad y
resistencia a los diferentes cambios desde la poca de la conquista
espaola (Weiss 2005). La conformacin de comunidades na-
tivas fue impuesta por el Estado peruano en los aos de 1970,
siguiendo el modelo andino (Espinosa 1996). Los polticos de
ese entonces y los de ahora, no solo ignoran las caractersticas
especfcas de la organizacin social en la selva, sino tambin las
tecnologas del manejo del bosque desarrolladas por los Ashnin-
cas, para mantener el frgil equilibrio ecolgico de la Amazona.
Hoy en da la cuenca del ro Peren, poblado por los
Ashninkas y grandes poblaciones de colonos, es una fuente
abundante de productos agrcolas. Plantaciones de caf, ctri-
cos, pltanos y otros frutos dominan el paisaje del valle Peren.
Este panorama es muy diferente en comparacin con el valle
Tambo que fue aislado por Sendero Luminoso en la poca
de la violencia y donde adems el acceso es ms difcil. Hoy en
da los Ashninkas an dependen de los recursos que le brinda
la selva para su subsistencia, dentro de los cuales las palmeras
forman parte importante como alimento (Mauritia fexuosa,
Oenocarpus bataua, Bactris gasipaes), fbras (Astrocaryum cham-
bira) o construccin (Socratea exorrhiza, Iriartea deltoidea).
Todos estos productos forman parte de la vida cotidiana de los
nativos amaznicos.
En el presente artculo damos a conocer los resultados del
estudio etnobotanico sobre las palmeras, obtenidos durante la
expedicin realizada a comunidades Ashninkas del Departa-
mento de Junn, en la Amazona peruana.
rea del estudio
Entre octubre y diciembre de 2008, se visitaron siete comu-
nidades nativas Ashninka. Cinco ubicadas en la cuenca del ro
Peren: Marankiari, Bajo Aldea, Zotani, Pitocuna, Impitato
Cascada, y dos ubicadas en la cuenca del ro Tambo: Puerto
Ocopa y Savareni (Tabla 1) en el Departamento de Junn (Fig.1).
Material y mtodos
Se realizaron colectas intensivas de las palmeras utilizadas,
con la ayuda de miembros de cada comunidad nativa evaluada,
los cuales adems fueron nuestros guas. Se realizaron observa-
ciones y entrevistas acerca de los usos de las palmeras. La infor-
macin fue recolectada realizando entrevistas semi-estructuradas
(Alexiades 1996) a 30 pobladores indgenas Ashninkas y dos
personas de otro origen (uno Ashninka/Ynesha y otro Piro).
A los entrevistados se les mostraron las palmeras que se haban
colectado en la zona.
Entre las 32 personas entrevistadas, la gran mayora hablan
en su idioma nativo (Ashninka), por lo cual registramos los
nombres de las palmeras en su idioma nativo y los nombres usa-
dos en espaol. Las muestras fueron determinadas de acuerdo a
Henderson et al. (1995) y Kahn & Milln (1992). Los nombres
cientfcos de las especies siguen la clasifcacin presentada por
Dransfeld et al. (2008) y Govaerts y Dransfeld (2005).
La coleccin completa fue depositada en el Herbario del W.
Szafer Instituto de Botnica (KRAM) de la Academia Polaca de
348
Sosnowska et al.
Rev. peru. biol. 17(3): 347 - 352 (Diciembre 2010)
Ciencias en Cracovia y en el Herbario San Marcos (USM) del
Museo de Historia Natural de la Universidad Nacional Mayor
de San Marcos en Lima, Per.
Resultados
Se encontraron un total de 15 especies de palmeras usadas por
los pobladores de las 7 comunidades nativas visitadas. La especie
Cocos nucifera (coco) era considerado por los Ashninkas como
no natural y no fue incluido en este estudio.
A continuacin, presentamos una descripcin cualitativa y
cuantitativa de nuestras observaciones de las diferentes formas
en las cuales las palmeras son utilizadas en el rea de estudio.
Las descripciones estn organizadas alfabticamente por espe-
cie y bajo cinco categoras de uso: alimenticio, construccin,
herramienta, ornamental y medicinal. Tambin incluimos
los nombres en espaol y Ashninka. Las especies registradas
cuentan con un espcimen de herbario, los nmeros de colec-
cin se encuentran citados bajo la denominacin de muestra,
representando las colecciones realizadas por J. Sosnowska y D.
Ramirez y depositadas en los herbarios KRAM y USM.
Astrocaryum perangustatum F.Kahn & B.Milln
Ashninka: tiroti; Espaol: huikungo
Uso alimenticio. Los frutos son comestibles; el palmito es
extrado para su consumo; las inforescencias son recolectadas
y consumidas cocidas; las larvas de coleptero (suris) que se
desarrollan en los troncos cados son recolectados y consumidas
crudos o cocidos.
Uso en construccin. El tronco es utilizado como postes
de las casas y las hojas suelen ser utilizadas para el techado de
las viviendas.
Uso como herramienta. Las semillas se usan para elaborar
artesanas; las espinas se usan como agujas y puntas de fechas;
las hojas jvenes, son utilizados en la fabricacin de abanicos,
sopladores y esteras, tambin para la fabricacin de canastas
para guardar yuca o algodn; las fbras del raquis son utilizadas
para hacer escobas.
Uso medicinal. Las races son utilizadas en la preparacin
de un extracto contra la hepatitis.
Muestra: JS 30.
Attalea phalerata Mart. ex Spreng.
Ashninka: tsiaro; Espaol: shapaja
Uso alimenticio. Los frutos y sus aceite son comestibles;
las semillas son colectadas para preparar mantequilla; el palmito
es extrado para consumo; las larvas de coleptero (suris) son
cosechadas de los troncos en descomposicin y luego consumidos
crudos o cocidos.
Uso en construccin. El tronco se utiliza en construccin
de postes; las hojas en el techado de las viviendas.
Marankiari
Bajo Aldea
Zotani
Pitocuna
Impitato Cascada
Puerto Ocopa
Savareni
Satipo
La Merced
Junn
Junn
Per
Ro
P
e
re
n

Ro
T
a
m
b
o
R

o

E
n
e
Figura 1. Ubicacin de las siete comunidades Ashninka del presente estudio, Departamento Junn, Per.
Ro Comunidad Coordenadas Altitud (m)
Perne Bajo Marankiari 10
o
56'S, 75
o
11'W 650
Perne Bajo Aldea 10
o
53'S, 74
o
54'W 560
Perne Zotani 10
o
51'S, 74
o
55'W 850
Perne Pitocuna 11
o
00'S, 74
o
39'W 470
Perne Impitato Cascada 11
o
00'S, 74
o
40'W 460
Tambo Puerto Ocopa 11
o
08'S 74
o
10'W 370
Tambo Savareni 11
o
13'S, 73
o
41'W 270
Tabla 1. Comunidades Ashninka en el Departamento de Junn en la
Amazona de Per, visitados en 2008 con el propsito de estudiar usos
de las palmeras (Arecaceae), indicando en cual ro estn localizados,
las coordenadas y altitud sobre el nivel del mar medido con GPS.
349

Palmeras usadas por los indgenas Ashninkas
Rev. peru. biol. 17(3): 347 - 352 (December 2010)
Uso como herramienta. Los frutos se usan en la elaboracin
de artesanas; las hojas son usadas para la fabricacin de abani-
cos, sopladores de fuego, esteras, paneras y canastas; las fbras
del raquis son utilizadas para hacer escobas; la bractea se usa
como fsforos, ya que se mantiene encendida por un tiempo;
la inforescencia es usada por los nios como juguete.
Uso ornamental. Los frutos y fores son usados como
adorno.
Uso medicinal. El aceite extrado del fruto se usa como
locin para mejorar la piel de la cara; las races son utilizadas para
la preparacin de un extracto contra la hepatitis, es ms fuerte
que el extracto de tiroti (Astrocaryum perangustatum).
Muestra: JS 29.
Bactris gasipaes Kunth var. gasipaes
Ashninka: kiri; Espaol: pijuayo
Uso alimenticio. Los frutos maduros son utilizados para
la preparacin de bebidas (masato) y la extraccin de aceite; las
larvas de colepteros (suris) son recolectados de los troncos en
descomposicin y consumidas crudas o cocidas.
Uso en construccin. Los clavos preparados del tronco se
usan en la construccin de las balsas.
Uso como herramienta. Los troncos son utilizados en la
fabricacin de fechas y arcos. Tambin se usan los palos muy
delgados para hilar algodn. Las hojas pueden servir para fab-
ricar esteras y abanicos.
Uso medicinal. La raz es utilizada para la preparacin de
un extracto usado contra la infeccin urinaria.
Muestra: JS 3.
Bactris sp.
Ashninka: ashanki; Espaol: nejilla
Uso alimenticio. Las semillas son consumidas como cara-
melos.
Uso como herramienta. Las semillas son utilizados para
elaborar collares y del peciolo de la hoja se fabrican fechas
Uso medicinal. La raz es utilizada para la preparacin de
un extracto usado contra la calvicie. Las espinas son utilizadas
para retirar otras espinas incrustadas en las personas.
Muestra: JS 10.
Chamaedorea angustisecta Burret
Ashninka: shikashika
Uso en construccin. Las hojas suelen ser utilizadas para la
construccin del techado de las viviendas.
Uso como herramienta. Las semillas son usadas para la
elaboracin de collares; la for es utilizada como adorno; las hojas
son utilizadas en la cocina, para envolver el pescado y para hacer
sopladores de fuego; los troncos son utilizados en la fabricacin
de arcos y fechas para nios, tambin se extraen palos delgados
para hilar algodn; el tronco con races es utilizado como escoba
Uso ornamental. La for es utilizada para elaborar perfumes.
Uso medicinal. La pepa del fruto es utilizado como com-
presa para las dolencias dermatolgicas.
Muestra: JS 6.
Elaeis guineensis Jacq.
Ashninka: datil.
Uso alimenticio. Los frutos son comestibles.
Uso en construccin. Las hojas sirven para la fabricacin
del techo de las viviendas.
Muestra: JS 41.
Euterpe precatoria Mart.
Ashninka: tsirentsi; Espaol: huasai
Uso alimenticio. Los frutos de tsirentsi son utilizados para
preparar un refresco o es mezclado con yuca para preparar ma-
sato (tradicional bebida alcohlica de la Amazona); el palmito
es extrado para consumo; las larvas de coleptero (suris) que se
desarrollan en los troncos cados son recolectados y consumidos,
crudos o cocidos.
Uso en construccin. Ocasionalmente las hojas son utiliza-
das para la fabricacin del techo de las casas y el tronco para la
fabricacin de cercos (en defciencia de otro material mejor);
Uso como herramienta. Las semillas se usan para elaborar
collares; las hojas son utilizadas para la fabricacin de esteras,
sopladores, abanicos y canastas
Uso medicinal. Las races son utilizadas para la preparacin
de un extracto usado contra el dolor de espalda, huesos, infec-
cin de tero, riones y para hacer crecer el pelo de los nios.
Muestra: JS 39.
Geonoma interrupta (Ruiz & Pav.) Mart.
Ashninka: kapashi; Espaol: palmichi
Uso alimenticio. Los frutos son comestibles
Uso en construccin. Las hojas son utilizadas para la fab-
ricacin de los techos de viviendas; los troncos son utilizados
como cerca.
Uso como herramienta. Los frutos se usan para elaborar
artesanas; el tronco para fabricar fechas.
Uso medicinal. La hoja y la raz se usan en el bao de los
nios con el fn de fortalecer su salud.
Muestra: JS 7.
Iriartea deltoidea Ruiz & Pav.
Ashninka: camona; Espaol: pona
Uso alimenticio. Los frutos verdes son comestibles sola-
350
Sosnowska et al.
Rev. peru. biol. 17(3): 347 - 352 (Diciembre 2010)
mente cocidos; las larvas de colepteros (suris) que desarrollan
en los troncos cados son recolectados y consumidos.
Uso en construccin. Las hojas son utilizadas para la fabri-
cacin de un techado temporal; la madera obtenida del tronco, es
utilizada para los pisos y las paredes de las viviendas, los troncos
duros son utilizados para postes, tarima, cama y cerca.
Uso como herramienta. Los frutos se usan para elaborar
artesanas; las hojas se usan para fabricar esteras.
Uso medicinal. El palmito es consumido para mejorar el
hgado; la raz se aplasta y se aplica directo al pie infamado; la for
es usada, durante el bao de los nios, para la curacin del susto.
Muestra: JS 8.
Mauritiella sp.
Espaol: aguajillo
Uso alimenticio. Los frutos son comestibles.
Muestra: sin muestra colectada.
Mauritia fexuosa L.f.
Ashninka: toniro; Espaol: aguaje
Uso alimenticio. Los frutos son comestibles y utilizados
para la elaboracin de refresco aguajina; las larvas de colepteros
(suris) que se desarrollan en los troncos cados son recolectados
y consumidos.
Uso en construccin. Las hojas son utilizadas en la con-
struccin del techado temporal de las casas.
Uso como herramienta. Los frutos y las hojas se usan para
elaborar artesanas
Uso ornamental. Los frutos son usados como adornos
ornamentales.
Uso medicinal. Los frutos tienen propiedades afrodisacos.
Muestra: JS 12.
Oenocarpus bataua Mart.
Ashninka: shaki; Espaol: hungurawi
Uso alimenticio. Los frutos son comestibles y utilizados en
la preparacin de refresco, chicha, masato, chocolate y aceite;
el palmito es extrado para su consumo; las larvas de coleptero
(suris) que se desarrollan en los troncos cados son recolectados
y consumidas.
Uso en construccin. Las hojas suelen ser utilizadas para la
fabricacin del techo de las viviendas.
Uso como herramienta. Los frutos se usan para elaborar
artesanas, las semillas para elaborar botones; las hojas jvenes
se usan para la fabricacin de artesanas, abanicos, canastas,
paneras y esteras; la hoja o inforescencia se usa como escoba.
Uso medicinal. Los frutos se usan contra la diabetes y
cncer; el palmito es consumido para mejorar el hgado; la
raz es utilizada para preparar una infusin contra la diabetes y
paludismo; la raz tambin es usada para teir el cabello.
Muestra: JS 9.
Oenocarpus mapora H.Karst.
Ashninka: chorinaki; Espaol: sinamillo
Uso alimenticio. De los frutos se prepara refresco; el palmito
es comestible.
Uso en construccin. Las hojas son utilizadas para el techado
de las viviendas; los troncos son utilizados como postes.
Uso como herramienta. Las hojas son utilizadas para la
fabricacin de esteras y abanicos; de la madera del tronco se
fabrican fechas.
Muestra: JS 40.
Phytelephas macrocarpa Ruiz & Pav.
Ashninka: humiro; Espaol: yarina
Uso alimenticio. Las semillas recin formadas son co-
mestibles y se sirve en reuniones para degustar; las fores son
importantes para obtener miel de las abejas
Uso en construccin. Las hojas son utilizadas para la fab-
ricacin del techado de las viviendas.
Uso como herramienta. Las semillas maduras se usan
ocasionalmente para elaborar artesanas pero son un material
muy duro y difcil de trabajar; del fruto se fabrican vajillas, las
hojas se usan para elaborar canastas temporales para la pesca; los
peciolos de las hojas verdes son utilizados para la fabricacin de
canastas; de las hojas tambin se fabrican abanicos; la infores-
cencia es usada por los nios como juguete.
Uso ornamental. Las mujeres usan las hojas y fores de hu-
miro como adorno; las hojas son utilizadas para la construccin
de la casa ritual, donde se alberga a las mujeres en su primera
menstruacin.
Uso medicinal. El liquido de los frutos es usado para curar
las infecciones de los ojos, estomago riones y susto; la raz es
usado como cicatrizante; la for es utilizada para prepara un
extracto contra la esterilidad masculina.
Muestra: JS 2.
Socratea exorrhiza (Mart.) H.Wendl.
Ashninka: tsentero; Espaol: kashapona
Uso alimenticio. El palmito es comestible.
Uso en construccin. Las hojas son utilizadas para el
techado temporal de las casas; los troncos son usados en la
construccin de paredes, piso, cerca y cama.
Uso como herramienta. La pepa de los frutos se usa para
colorear la kushma (la ropa tradicional); las hojas son usadas para
la fabricacin de corrales de aves; la raz es usada como utensilio
de rallador en la cocina.
Uso medicinal. La raz se usa para fortalecer fsicamente a
los varones y en el bao de los nios para alejar el mal espiritu.
351

Palmeras usadas por los indgenas Ashninkas
Rev. peru. biol. 17(3): 347 - 352 (December 2010)
Despus de baar, se pasa entre las races y se come pltano muy
maduro para incitar el vomito.
Muestra: JS 36.
Las especies con mayor cantidad de usos fueron: Attalea
phalerata, Bactris gasipaes, Oenocarpus bataua y Socratea exor-
rhiza. La importancia es descrita como el nmero de partes de
la palmera en cada categora de uso. Los usos de las palmeras
son muy diversos. Siete especies tienen aplicaciones en todas las
categoras (Fig. 2).
Las partes de las palmeras ms utilizadas son los frutos,
principalmente por su valor comestible. Solamente las hojas
y troncos son tiles en construccin, principalmente para la
fabricacin de techos y postes de casa. La gran importancia de
los troncos en la categora de uso alimenticio resulta porque son
hbitat de las larvas de colepteros (suris), que se cosechan de
los troncos cados. Entre los usos medicinales ms importantes
de las palmeras, resaltan las races (Fig. 3).
Conclusin
Encontramos una gran variacin de uso de las palmeras
entre las comunidades Ashaninka estudiadas. Tambin se ob-
serva variacin en los informantes, en cules y cuntos usos
un conoca; estas variaciones dependieron de la edad y sexo de
cada informante. De hecho, las diferencias en conocimiento
de usos de las palmeras entre las comunidades fueron mayores
que las encontradas entre edad y sexo de los informantes. Las
comunidades del valle Peren estn mas cerca de la ciudades
que las comunidades del valle Tambo. Hoy en da la cuenca
del rio Peren est poblada por colonos, y expone a los nativos
a un contacto intensivo con la cultura occidental, que resulta
en un cambio del tipo de vida tradicional, donde las palmeras
son los ms importantes recursos naturales. La vida tradicional,
conocimiento y prctica en el uso de palmeras esta an vital en
comunidades del valle Tambo.
Kantantsi orijaniki
(Resumen en idioma Ashninka)
Oka sankenarentsi oinijantiro jaoka okantasanotari ora shaashi
ashaninkaiteki.Okantakoti kenketsarentsi okaratake 32 sampitantsi
cokarati oshirinkapaka 7 nanpitsi saikajetatsiri ashaninka perenesati
aisati tamposati aka satipoki Satipo, Junn, Per. Osankinatakotaka
ocarati 15 shaaniro palmeras, yobayetari aisati yantantaro ibanko,
ichakopite, ipankitiro aisati isayetaro ashaninkaite. Ora yantasanoy-
etiri ojita tsiaro, kiri, shaki aisati tsentero. Ora yaasanoyetiri shaaniro
palmera oitsoki orointa yoyetari. Nanpitsipee timayetatsiri pereneki
otimi kempeji antyiaroite nanpitsi isaikinta birakocha, iro kantakairo
ipiakojetantakaroki yantayetiri acharineite, itimati oshekiti oshiyoki
shaaniro palmeras. Anta tampoki irosati imatiro yantiro antantsi aisati
iyotantsi yantirini acharineite.
Iropero aantsi: Arecaceae, Ashninka, etnobotnica, Per.
Agradecimientos
Agradecemos a la gente Ashninka por compartir su cono-
cimiento de palmeras con nosotros y a las organizaciones CE-
CONSEC y CART gracias a las cuales nuestra investigacin fue
possible. Gracias a Jos David Rivera Shiaretti por la traduccin
del resumen a idioma Ashninka y Miroslaw Rajter por su ayuda
en la preparacin de los documentos indispensable para conducir
trabajo en el campo. Esta publicacin se ha realizado gracias a
Figura 2. Las palmeras con usos mas amplios - numero de partes
usadas de la especie por categoras de uso.
0
5
10
15
20
25
30
35
40
fruto hoja tronco raz flor
N

m
e
r
o

d
e

e
s
p
e
c
i
e
s

e
n

c
a
t
e
g
o
r

a
s

d
e

u
s
o
Medicinal
Ornamental
Herramienta
Construccin
Alimenticio
Figura 3. Importancia de las partes usadas de las especies de pal-
meras por categora de uso.
0 2 4 6 8 10 12 14
Attalea phalerata
Bactris gasipaes
Oenocarpus bataua
Socratea exorrhiza
Euterpe precatoria
Iriartea deltoidea
Phytelephas macrocarpa
Astrocaryum perangustatum
Chamaedorea angustisecta
Geonoma interrupta
Mauritia flexuosa
Oenocarpus mapora
Bactris sp.
Mauritiella sp.
Nmero de partes por categoras de uso
Alimenticio
Construccin
Herramienta
Medicinal
Ornamental
Elaeis guineensis
352
Sosnowska et al.
Rev. peru. biol. 17(3): 347 - 352 (Diciembre 2010)
la Autorizacin N
o
139-2008-INRENA-IFFS-DCB otorgada
por el Instituto Nacional de Recursos Naturales del Ministerio
de Agricultura de la Repblica del Per. Se agradece el apoyo
econmico del Ministerio de Ciencias y Educacin Superior del
Polonia (N N305 022036).
Literatura citada
Alexiades M. N. 1996. Collecting ethnobotanical data: an introduc- Collecting ethnobotanical data: an introduc-
tiontobasicconceptsandtechniques.Pp.53-94.En:M.
N. Alexiades (ed.) Selected guidelines for ethnobotanical
research: a feld manual.Advances in economic botany
10.NewYorkBotanicalGarden,Bronx,N.Y.
Dransfeld,J.,N.W.Uhl,C.M.Asmussen,etal.2008.GeneraPal-
marum.TheEvolutionandClassifcationofPalms.The
Board of Trustees of Royal Botanic Gardens, Kew.
EspinosaO.1996.ElpuebloAshninkaysuluchaporlaciudadana
en un pas pluricultural. Pp. 77-132. En: Derechos huma-
nos y pueblos indgenas de la amazona peruana. Lima:
APEP CAAAP.
GovaertsR.&J.Dransfeld. 2005. World Checklist of Palms. The
Board of Trustees of Royal Botanic Gardens, Kew.
Henderson, A., G. Galeano, R. Bernal. 1995. Field guide to the palms
of the Americas. Princeton University Press, New Jersey.
Kahn,F.&B.Milln.1992.Astrocaryum(Palmae)inAmazonia.
A preliminary treatment. Bull. Inst. Fr. t. And. 21(2):
459-531.
Varese S. 2006. La sal de los cerros. Resistencia y utopia en la
amazona peruana. Fondo Editorial del Congreso del
Per,Lima.
WeissG.2005.Camparibereos.Pp.1-74.En:SantosF.&F.Bar-
clay(eds.)GuaEtnogrfcadelaAltaAmazona,vol5.
STRI IFEA, Lima.
353

Actividad inhibitoria de DrosEra caPillaris sobre mycobactErium tubErculosis
Rev. peru. biol. 17(3): 353 - 358 (December 2010)
Rev. peru. biol. 17(3): 353 - 358 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Actividad inhibitoria de plantas in vitro de Drosera capillaris sobre
Mycobacterium tuberculosis
Jimmy Alvarado
1
, Hilda Vsquez
1
, Guillermo E. Delgado
1
, Dalva Trevisan
2
, Oscar
Horna
3
, Jurandir Pereira
2
y Consuelo Rojas
1
*
Inhibitory activity of in vitro plants from Drosera capillaris against
Mycobacterium tuberculosis
1Facultad de Ciencias Biolgicas,
Universidad Nacional Pedro Ruiz
Gallo, Ciudad Universitaria, Juan
XXIII No 391, Lambayeque - Per.
*E-mail: crojasi2002@yahoo.es
2Departamento de Qumi ca
Centro de Cincias Exatas. Uni-
versidade Estadual de Londrina,
Paran, Brasil.
3Direccin Regional de Salud.
Laboratorio de Referencia Regional
en Salud Pblica Lambayeque,
Per. Av. Salaverry No 1610
Chiclayo.
*Autor para correspondencia
Presentado: 01/10/2010
Aceptado: 13/12/2010
Publicado online: 00/11/2010
Resumen
El objetivo del trabajo fue demostrar la actividad inhibitoria de plantas in vitro de Drosera capillaris (Droseraceae)
sobre Mycobacterium tuberculosis. Las plantas de D. capillaris fueron propagadas en cultivos in vitro a partir de
plntulas y hojas adultas. Se utiliz metanol como solvente de extraccin y el sistema de cromatografa a gas
en la determinacin de los metabolitos secundarios. El medio de cultivo Lowenstein-Jensen, suplementado con
las concentraciones 1,25; 2,5 y 5 mg/mL de la fraccin clorofrmica del extracto crudo metanlico, fue utilizado
en la evaluacin del crecimiento de cinco cepas de M. tuberculosis. Los resultados indicaron que plantas de
3 5 cm de altura fueron obtenidas despus de 10 12 meses de cultivo in vitro. La naftoquinona plumbagina
fue determinada por comparacin con el tiempo de retencin del patrn correspondiente, as como de otros
compuestos hidrocarbonados similares de cadena larga. El crecimiento de M. tuberculosis fue inhibido en un
rango de 40 93,1% en los tratamientos 2,5 y 5 mg/mL. La concentracin inhibitora mnima (CIM) y CIM
90
fue
1,25 mg/mL y 2,5 5 mg/mL, respectivamente. Se demostr la accin antibacteriana del extracto metanlico
de plantas in vitro de D. capillaris, probablemente por accin de la plumbagina y de los otros metabolitos se-
cundarios detectados.
Palabras claves: cultivo de tejidos, extracto metanlico, ftoterapia, plumbagina, tuberculosis.
Abstract
The objective of the work was to demonstrate the inhibitory activity of in vitro plants of Drosera capillaris (Dro-
seraceae) on Mycobacterium tuberculosis. The plants of D. capillaris were propagated in in vitro cultures from
plantlets and mature leaves. It was used metanolic extract and gas chromatography to determinate secondary
metabolites. Lowenstein-Jensen media, supplemented with 1.25; 2.5 y 5 mg/mL concentrations of cloroformic
fraction obtain from metanolic crude extract, was used in the growth evaluation of fve M. tuberculosis strains.
The results indicated that plantlets of 3 5 cm up to, were obtained 10 12 months after in vitro culture. The
naphtoquinone plumbagin was determinated by comparison with currently pattern retention, like as another
hidrocarbonic compounds seem to long chain. M. tuberculosis growth was inhibited in 40 93.1% range, 2.5
and 5 mg/mL treatments, respectively. The minimum inhibitory concentration (MIC) y MIC
90
was 1.25 mg/mL
and 2.5 5 mg/mL, respectively. Was showed the antibacterial activity in metanolic extract of D. capillaris in
vitro plants, probably by the action of the plumbagin and another secondary compounds found.
Keywords: Metanolic extract, phytotherapy, plumbagin, tissue cultura, tuberculosis.
Introduccin
La tuberculosis (TBC) es una enfermedad infecto-contagiosa
causada por Mycobacterium tuberculosis, tambin conocido como
bacilo de Koch. Es considerada la enfermedad ms prevalente en
el mundo y solo en el 2006 se estim en 9,2 millones (139 por
100 000 habitantes) los nuevos casos de infectados con TBC,
de los cuales 500 000 fueron multidrogo resistentes (resistentes
a isoniacida y rifampicina); el nmero de muertes fue de 1,7
millones o 200 fallecidos por hora (WHO, 2006). Alrededor
del 95% de los casos y 98% de muertes por TBC ocurren en
los pases en vas de desarrollo, en tanto que el 75% de los ca-
sos que se presentan en estos pases estn en el grupo de edad
econmicamente activa (de 15 a 50 aos); en el Per la tasa de
morbilidad en el ao 2007 alcanz la cifra de 125,1 por 100
000 habitantes (Bonilla 2008).
Precisamente, la resistencia a drogas antituberculosas y la
co-infeccin TB-VIH constituyen una seria amenaza para
los programas nacionales de control de TB en el mundo y en
especial en los pases en desarrollo (Aziz et al. 2006, Asencios
et al. 2009), de all la necesidad de formular nuevas y variadas
estrategias en el control de la enfermedad donde no solamente
se considere el aspecto biomdico sino tambin el aspecto social
(Jave 2009, Ticona 2009).
La familia Droseraceae, conocidas como plantas carnvoras,
comprende 4 gneros entre los que se encuentra Drosera con
125 especies distribuidas en todo el mundo incluyendo regiones
tropicales y tundras, excepto en desiertos y la Antrtida (Culham
& Gornall 1994). Drosera capillaris Poir. (atrapainsectos) se
distribuye desde Amrica del Norte hasta Venezuela y Brasil
(Silva & Giulietti 1997) pero no ha sido reportada para la fora
del Per (Brako & Zarucchi 1993).
Drosera capillaris, al igual que otras especies carnvoras,
presenta diversas adaptaciones morfolgicas y anatmicas para
nutrirse de insectos que caen en sus trampas; stas se encuentran
provistas de glndulas pedunculadas con exudados pegajosos que
atraen y digieren a los insectos gracias a sus enzimas proteolticas,
lo que constituye una respuesta evolutiva a su crecimiento en
hbitats defcientes en nitrgeno (Cronquist 1988).
En cultivo de tejidos, desde los primeros trabajos realizados
en D. rotundifolia (Simola 1978), diversos protocolos en micro-
propagacin, organognesis directa e indirecta y embriognesis
somtica, han sido desarrollados hasta en 12 especies de Drosera
(amaj et al. 1999); sin embargo, en D. capillaris no ha sido
realizado trabajo alguno en cultivo de tejidos. Por otro lado,
numerosas especies de Drosera son usadas tradicionalmente
para varios propsitos medicinales, como agentes antitusgenos
354
Alvarado et al.
Rev. peru. biol. 17(3): 353 - 358 (Diciembre 2010)
y antiespasmdicos y antiasmticos; en infecciones bronquiales
y afecciones pulmonares (amaj et al. 1999). Todo ello debido
a la presencia de las naftoquinonas, metabolitos secundarios
normalmente sintetizados y acumulados en varias especies de
Drosera (Culham & Gornall 1994, Zenk et al. 1969). Entre las
naftoquinonas ms importantes tenemos la plumbagina y la
7-metiljuglona (Finnie & van Staden 1993), las que fueron es-
tudiadas en diferentes especies de Drosera como marcadores qui-
miotaxonmicos (Culham & Gornall 1994, Zenk et al. 1969).
Estas naftoquinonas, adems, tienen propiedades antivirales,
antibacterianas, antifngicas, anticancergenas, antileprsicas y
antiesclerticas (amaj et al. 1999).
Por estas razones en el presente trabajo se ha estudiado la
actividad inhibitoria del extracto crudo metanlico de plantas
micropropagadas in vitro de D. capillaris sobre Mycobacterium
tuberculosis causante de la tuberculosis.
Material y mtodos
Material biolgico.- El material vegetal fue colectado en
setiembre de 1988 en el Valle del Cauca, Cali (Colombia) e
introducido en condicin in vitro en la Unidad de Recursos
Genticos del Centro Internacional de Agricultura Tropical
(CIAT), Cali. En tal condicin fue transferido por el Dr. Gui-
llermo E. Delgado Paredes al Laboratorio de Cultivo de Tejidos
y Recursos Genticos de la Universidad Nacional Pedro Ruiz
Gallo (UNPRG), Lambayeque (Per), donde se conserva por
subcultivos anuales. La especie fue identifcada como Drosera
capillaris Poir. consultando el trabajo sobre Droseraceae del
Brasil (Silva & Giulietti 1997) y verifcado por la especialista en
Droseraceae, Dra. Tania R.S. Silva, del Instituto de Biocincias
de la Universidad de So Paulo (Brasil). Muestras herborizadas
han sido depositadas en el Herbario Pedro Ruiz Gallo de la
Facultad de Ciencias Biolgicas de la UNPRG.
El material microbiolgico estuvo constituido por cinco cepas
de Mycobacterium tuberculosis, aisladas, identifcadas y codifca-
das (C1, C2, C3, C4 y C5) en el rea de TBC del Laboratorio
de Micobacterias (Laboratorio de Referencia Regional en Salud
Pblica, Lambayeque, Per).
Micropropagacin.- Plantas adultas in vitro de D. capillaris,
de 10 12 meses de edad, fueron utilizadas en el proceso de
micropropagacin. Los explantes estuvieron constituidos por
pequeas plntulas con 5 10 hojas y hojas adultas individua-
les de 15 mm de longitud; y fueron cultivados, en condiciones
aspticas, en frascos de vidrio transparentes conteniendo el medio
de cultivo conformado por las sales minerales MS (Murashige &
Skoog, 1962), las vitaminas tiamina.HCl 1 mg/L y m-inositol
100 mg/L, los reguladores de crecimiento cido naftalenactico
(ANA) y cido giberlico (AG
3
) 0,02 mg/L, respectivamente, y
sacarosa 2%. El pH del medio de cultivo fue ajustado en 5,8 0,1
con NaOH y HCl 0,5N, respectivamente, antes de la gelifcacin
con phytagel 0,3%. La esterilizacin se realiz en autoclave a 120
o
C de temperatura y 15 lbs/pulg
2
de presin durante 20 minutos.
Obtencin del extracto.- Plantas in vitro de 10 12 meses de
edad fueron deshidratadas a temperatura ambiente bajo sombra
durante 24 h y luego secadas a estufa a 40
o
C por 48 h; posterior-
mente, fueron molidas en mortero de porcelana hasta constituir
un polvo fno; 54 g de esta masa fue sometida a extraccin con
metanol (MeOH) por dos veces consecutivas con permanencia
del solvente por 48 h; despus del fltrado y evaporado el solven-
te, el extracto crudo metanlico fue recuperado con cloroformo
ante la difcultad de su recuperacin con MeOH.
Anlisis por cromatografa a gas.- El extracto crudo
metanlico fue analizado en el Laboratorio de Qumica de la
Universidad Estadual de Londrina, Paran (Brasil), utilizando el
sistema de cromatografa a gas (Budzianowsky 1995). El equipo
utilizado fue un cromatgrafo a gas detector FID-SHIMADZU
modelo GC. 17-D; columna HP-5, establecindose las siguien-
tes condiciones de corrida: Inyector: 300
o
C, detector: 300
o
C,
columna: 200
o
C/2 min, temperatura fnal: 320
o
C 10
o
C/
min, volumen de corrida: 2,7 mL/min, solvente: hexano, gas de
arrastre: helio, tiempo de corrida: 30 min y patrones utilizados:
plumbagina (5-hidroxi-2-metil-1,4-naftoquinona) y algunos
compuestos hidrocarbonados de cadena larga.
Determinacin de la actividad inhibitoria de la fraccin
clorofrmica del extracto crudo metanlico de D. capi-
llaris.- Para la preparacin de la suspensin Mycobacterium
tuberculosis y diluciones con una esptula esterilizada se tomo
el mayor nmero de colonias de las cepas y se colocaron en la
pared interna de tubos de ensayo que contenan 5 mL de agua
destilada esterilizada; se trituraron y mezclaron las colonias
con una bagueta esmerilada esterilizada hasta obtener una sus-
pensin homognea; se dej reposar durante 30 - 60 segundos
hasta sedimentar y luego se tom el sobrenadante y ajust la
turbidez de la suspensin (suspensin madre) comparando con
el patrn de turbidez que contiene 1 mg/mL de masa bacilar. Se
prepararon diluciones al dcimo de 10
-1
a 10
-6
seleccionndose
las diluciones 10
-3
, 10
-5
y 10
-6
.
Las soluciones de la fraccin clorofrmica del extracto crudo
metanlico de D. capillaris fueron preparadas tomando 312,5;
625 y 1 250 mg del extracto crudo metanlico y diluidos en 10
mL de cloroformo como volumen fnal; posteriormente, cada
solucin fue agregada a 250 mL del medio de cultivo Lowens-
teinJensen (L-J), obtenindose las concentraciones de 1,25;
2,5 y 5 mg/mL, respectivamente; luego se dispens en tubos de
ensayo tapa rosca a razn de 6 mL por tubo de ensayo; se llev
al coagulador a 85
o
C por 45 minutos y fnalmente a control
de esterilizacin con las tapas ligeramente fojas a 37
o
C/24 h.
El proceso de siembra de M. tuberculosis se realiz en una
cmara de seguridad biolgica tipo II clase A, establecindose
tres series de dilucin: 10
-3
, 10
-5
y 10
-6
, eliminndose previamente
el lquido condensado en el medio de cultivo. De cada una de
las diluciones indicadas, se sembr 0,2 mL de la dilucin en las
siguientes rplicas: 2 tubos de ensayo con medio de cultivo L-J
sin extracto crudo (control), 4 con medio de cultivo L-J con
cloroformo (blanco), 5 con medio de cultivo L-J con extracto
acuoso, 3 con medio de cultivo L-J con la fraccin clorofrmica
del extracto metanlico 1,25 mg/mL, 3 con medio de cultivo
L-J con la fraccin clorofrmica del extracto metanlico 2,5 mg/
mLy 3 con medio de cultivo L-J con la fraccin clorofrmica
del extracto metanlico 5 mg/mL. Estos tubos de ensayo fueron
inicialmente mantenidos en posicin horizontal, con rotacin
suave para distribuir homogneamente la suspensin en la su-
perfcie del medio de cultivo; luego se llevaron a estufa a 37
o
C.
Lectura e interpretacin de resultados.- Las lecturas se
realizaron a las 4 y 6 semanas de instalado el experimento. En
el caso de los tubos de ensayo control la media de las colonias
contadas indic el nmero de bacilos sembrados. En el caso de
355

Actividad inhibitoria de DrosEra caPillaris sobre mycobactErium tubErculosis
Rev. peru. biol. 17(3): 353 - 358 (December 2010)
los tubos de ensayo con extracto crudo se parte del hecho de
que la suspensin madre de la cepa en estudio contiene 1 mg/
mL de masa bacilar; sin embargo, la cantidad de bacilos en 1
mg de masa bacilar vara considerablemente de una cepa a otra,
variacin que puede ser de uno cien millones de grmenes/
mL, por lo que fue necesario sembrar las diluciones 10
-3
y 10
-5
.
El procedimiento est resumido en la fgura 1.
Determinacin de la Concentracin mnima inhibitoria
(CMI) y CMI
90
.- Se determinaron los valores CMI y CMI
90
,
teniendo en cuenta la concentracin ms baja del extracto crudo
capaz de inhibir el crecimiento visible de M. tuberculosis despus
del periodo de incubacin y la concentracin del extracto capaz
de inhibir el 90% del crecimiento bacteriano, respectivamente
(Andrews 2001).
Diseo experimental y anlisis estadstico.- Se utiliz el
diseo de contrastacin de hiptesis con estmulo creciente
(Goode & Hatt 1986) donde las cepas de M. tuberculosis fue-
ron los grupos experimentales a las que se enfrent diferentes
concentraciones de la fraccin clorofrmica del extracto crudo
metanlico de D. capillaris. En el anlisis estadstico de los
datos se realiz el anlisis de varianza as como las pruebas de
comparaciones mltiples de Tukey con un nivel de signifcacin
de 0,05%.
Resultados
La propagacin clonal in vitro de D. capillaris se realiz
utilizando como explantes hoja y planta ntegra. En el primer
caso se formaron 5 10 brotes por explante siguiendo el modelo
de organognesis directa, es decir, sin formacin de callo, que
luego de 6 meses de cultivo las plantas alcanzaron una altura
promedio de 3 cm, y en el segundo caso se formaron nuevas
plantas a partir de las yemas axilares que alcanzaron una altura
promedio de 4 5 cm en el lapso de 6 meses. En ambos casos
las plantas formadas desarrollaron un ptimo sistema radicular,
quedando habilitadas para su eventual transferencia a condicio-
nes de invernadero.
El anlisis cromatogrfco mostr 8 picos claramente dife-
renciados, correspondiendo a diferentes sustancias, tal como lo
indican sus particulares tiempos de retencin. El pico de inters
fue el 2, correspondiendo a la plumbagina, con un tiempo de
retencin de 3,76 min; los otros picos (3 8) correspondieron
a otras sustancias hidrocarbonadas de cadena larga de 18, 20,
24, 26, 27 y 32 carbones (Figura 2).
4 semanas

6 semanas

Cepas de Mycobacterium tuberculosis
Estandarizacin: Mc Farland 1
Sembrado a partir de las diluciones: 10
-3
, 10
-5
y 10
-6
, en los
tubos de ensayo con medio de cultivo Lowenstein-Jensen

Incubacin a 37
o
C
Primera lectura
Segunda lectura
Figura 1. Flujograma en el proceso de siembra de Mycobacterium
tuberculosis en medio de cultivo Lowenstein-Jensen suplementado
con diferentes concentraciones de la fraccin clorofrmica del extracto
crudo metanlico de plantas in vitro de Drosera capillaris.
H
OH
O
O
CH
3
Plumbagina
1
2
3
4
5
6
7
8
mV
40
20
0
0
10 20 30 min
PKNo Time Area Height Conc
1 1,063 9388 5009 6,0199
2 3,762 19228 6302 12,3301
3 6,353 19157 4614 12,2842
4 8,071 13459 2533 8,6304
5 11,868 32014 7074 20,5284
6 14,082 4452 987 2,855
7 14,510 5612 1061 3,5987
8 19,494 52637 5170 33,7533
155947 32750 100,0000
Figura 2. Perfl ftoqumico del extracto crudo metanlico de plantas
de Drosera capillaris despus de 12 meses de cultivo in vitro.
Cepas
a
Tratamiento
(mg/mL)
Promedio
de colonias
(N
o
)
Porcentaje (%)
Inhibicin Resistencia
C1
0,0 240
1,25 79,7 66,8 33,2
2,5 56,0 76,7 23,3
5,0 56,0 76,7 23,3
C2
0,0 252,5
1,25 101,0 60,0 40,0
2,5 30,0 88,1 11,9
5,0 17,3 93,1 6,9
C4
0,0 325
1,25 195,0 40,0 60,0
2,5 35,5 89,1 10,9
5,0 52,7 83,8 16,2
Tabla 1. Efecto inhibitorio in vitro de la fraccin clorofrmica del
extracto crudo metanlico de plantas in vitro de Drosera capillaris (tra-
tamiento) sobre Mycobacterium tuberculosis (Promedio de colonias).
a
Las cepas C3 y C5 fueron excluidas en la evaluacin puesto que no desarro-
llaron el nmero mnimo de 200 colonias.
356
Alvarado et al.
Rev. peru. biol. 17(3): 353 - 358 (Diciembre 2010)
Los resultados del efecto de la fraccin clorofrmica del
extracto crudo metanlico de D. capillaris sobre M. tuberculosis
se muestra en la Tabla 1, observndose que la inhibicin en el
crecimiento bacteriano fue modulada por el factor cepa y el
factor concentracin. Las cepas C3 y C5 fueron excluidas en la
evaluacin puesto que no desarrollaron el nmero mnimo de
200 colonias en el testigo, tal como lo recomienda la metodologa
utilizada (OPS, 1986), por tanto, nicamente fueron evaluadas
las cepas C1, C2 y C4. En estas cepas, conforme se incrementaba
la concentracin del extracto (1,25; 2,5 y 5 mg/mL) el porcen-
taje de inhibicin tambin se incrementaba, desde 40% en la
concentracin 1,25 mg/mL para la cepa C4 hasta 93,1% en la
concentracin 5 mg/mL para la cepa C2. La prueba de Tukey,
con 0,05 de signifcacin indic que las concentraciones 2,5 y
5 mg/mL fueron estadsticamente signifcativas y, asimismo,
exhibieron la mayor capacidad de inhibicin en el crecimiento
de M. tuberculosis (Tabla 2).
La CIM para las cepas C1 y C2 fue 1,25 mg/L en tanto que
la CIM
90
para las cepas C2 y C4 fueron 5 y 2,5 mg/L, respec-
tivamente (Tabla 3).
Discusin
Una de las aplicaciones ms importantes y prcticas del cultivo
de tejidos vegetales es la micropropagacin cuyos fundamentos
fueron establecidos por Murashige (1974). En el caso de Dro-
sera, varios autores han realizado trabajos en cultivo de tejidos
utilizando como explantes semillas, hojas, pices, races y fores,
en medio de cultivo MS (Murashige & Shoog 1962) y en varias
combinaciones de las auxinas cido indol-3-actico (AIA) y
ANA con la citocinina benziladenina (BA), en bajas concentra-
ciones (amaj et al. 1999); sin embargo, en nuestro trabajo, la
auxina ANA 0,02 mg/mL no fue suplementada con citocinina
alguna sino con AG
3
0,02 mg/mL, alcanzando altos niveles de
brotamiento y elongacin de brotes y hojas. Adicionalmente, a
la micropropagacin, la utilizacin de otras tcnicas del cultivo
de tejidos, como la induccin de callos y el establecimiento de
suspensiones celulares (Danelutte et al. 2005), abren la posibi-
lidad de inducir la produccin en gran escala de determinados
metabolitos secundarios no solamente conocidos sino tambin
inditos en condiciones naturales, sin necesidad de depredar la
especie en su ambiente natural y ms an cuando se utilizan
partes sensibles de la planta como en el caso races.
Numerosos estudios ftoqumicos han demostrado que varias
especies de Drosera sintetizan dos grupos principales de metabo-
litos secundarios: naftoquinonas y favonoides, tanto en plantas
de campo como en plantas micropropagadas in vitro (Culham
& Gornall 1994, Zenk et al. 1969, Budzianowsky et al. 1993).
Las naftoquinonas son compuestos que pertenecen a la familia
qumica de los fenilpropanos de estructura C6 C1 + C5. En
Drosera destacan la plumbagina y la 7-metiljuglona, biosinteti-
zadas a partir de la tirosina en la ruta del acetato-polimanolato
(Durand & Zenk 1971, 1976); sin embargo, tambin han sido
identifcadas otras naftoquinonas consideradas menores como
droserona, hidroxidroserona, droserona-5-glucsido, rosoloside
e hidroxidroserona-5-glucsido y otras como biramentaceona
y 2-metilnaftazarina-5-O-glucsido, consideradas artefactos
producidos por extraccin con solventes orgnicos (amaj et al.
1999). En nuestro trabajo, al igual que en plantas de campo de D.
capillaris (Durand & Zenk 1976) y de D. natalensis (Crouch et
al. 1990), solamente fue posible la identifcacin de plumbagina
pero no de 7-metiljuglona, en tanto que ambas sustancias fueron
identifcadas en D. capensis (Crouch et al. 1990, Wawrosch et
al. 1996) y D. intermedia (Budzianowsky et al. 1993, Bonnet
et al. 1984) y en el caso de D. hilaris (Wawrosch et al. 1996),
D. rotundifolia (Wawrosch et al. 1996, Bonnet et al. 1984) y D.
spathulata (Budzianowsky et al. 1993), nicamente se identifc
7-metiljuglona. Respecto a los favonoides, si bien es cierto no se
han reportado en nuestro trabajo, quercetina, hiperina, isoquer-
citrina, astragalina y miricetina-3-ramnosida (Budzianowsky et
al. 1993) han sido identifcados en D. spathulata y D. intermedia.
Mycobacterium tuberculosis es una bacteriana con la habilidad
para adquirir resistencia a mltiples antibiticos lo que conlleva
a la ocurrencia de cepas multidrogoresistente (MDR-TB) como
resultado de un tratamiento inconsistente o parcial a lo que
se suma la escasa colaboracin del paciente; ello determina la
necesaria utilizacin de drogas de segunda lnea anti-TB, tales
como aminoglicsidos, polipptidos, fuoroquinolonas, etio-
namida y cido -aminosaliclico (Gibbons 2008). En efecto
-y como es de deducir-, el tratamiento de la tuberculosis se
basa en conceptos muy distintos a los de las dems infecciones
bacterianas (Coll 2003). Mycobacterium tuberculosis tiene un
tiempo de generacin prolongada y la capacidad para entrar
en periodos de latencia con una actividad metablica limitada,
lo cual difculta la accin de los antimicrobianos. La bacteria
presenta una resistencia natural a numerosos antibacterianos, por
el hecho de poseer una pared compleja, muy hidrfoba, con una
permeabilidad reducida para un gran nmero de compuestos
(Jarlier & Nikaido 1994). Al respecto, estudios genticos han
demostrado que la resistencia a los frmacos antituberculosos
se debe a mutaciones cromosmicas espontneas en los genes
que codifcan la diana del frmaco o enzimas implicadas en la
activacin del frmaco (Somoskovi et al. 2001). En tal sentido,
se ha descrito la ocurrencia de enzimas modifcantes como las
betalactamasas (Kwon et al. 1995) o sistemas de efujo (Cole et al.
1998), derivados de plantas, entre las que podemos contar a D.
capillaris, que inhiben los mecanismos efuyentes de resistencia
a los antibiticos bacterianos (Gibbons 2008).
Se considera que la accin del extracto crudo de D. capillaris
Orden de
Mrito
Concentracin
(mg/mL)
Inhibicin en
el crecimiento
(%)
Signifcacin
(0,05)
1 1,25 55,6 a
2 2,5 83,9 b
3 5,0 84,5 b
Tabla 2. Prueba de signifcacin de Tukey (p<0,05) para tres cepas
de Mycobacterium tuberculosis frente a diferentes concentraciones
de la fraccin clorofrmica del extracto crudo de plantas in vitro de
Drosera capillaris.
Cepas CIM (mg/mL) CIM
90
(mg/mL)
C1 1,25 ND
C2 1,25 5,0
C4 ND 2,5
Tabla 3. Concentracin Inhibitoria Mnima (CIM) y CIM
90
de la fraccin
clorofrmica del extracto crudo metanlico de plantas in vitro de Dro-
sera capillaris sobre Mycobacterium tuberculosis. ND, no determinado.
357

Actividad inhibitoria de DrosEra caPillaris sobre mycobactErium tubErculosis
Rev. peru. biol. 17(3): 353 - 358 (December 2010)
sobre M. tuberculosis se realiza en la capa de lpidos de la pared
celular, que es disuelta por la plumbagina, que ingresa al cito-
plasma por difusin a travs del peptidoglicano; asimismo, la
eventual presencia de favonoides (Budzianowsky et al. 1993,
Schlly & Kapetanidis, 1989), contribuira a degradar los lpidos
de la pared celular bacteriana, propiciando la formacin de poros
y alterando la permeabilidad de la misma, lo que facilitara la
entrada de la plumbagina al citoplasma produciendo un ingreso
desordenado de sustancias txicas y la salida de sustancias nece-
sarias para la clula. Adicionalmente, una vez en el interior, la
plumbagina seguira actuando sobre las enzimas de la clula al
reaccionar con los radicales SH y NH
2
, causando su completa
inactivacin y de esta manera obstaculizando su actividad enzi-
mtica (Walker 2000).
La utilizacin del extracto crudo de la planta tendra ciertas
ventajas sobre la utilizacin de metabolitos secundarios puros
puesto que se minimizara el riesgo de inducir resistencia, ade-
ms, que el uso de extractos heterogneos de toda la biomasa
de la planta podra inducir un efecto sinergstico sobre algn
organismo especfco (Leatemia & Isman 2004). Al respecto,
estudios realizados sobre la actividad biocida de extractos crudos
comparando con sustancias puras (piperamidas), obtenidas de
Piper tuberculatum, han demostrado un efecto ms potente
del extracto crudo sobre Aedes atropalpus (Scott et al. 2002) y
Anticarsia gemmatalis (Navickiene et al. 2007), respectivamente,
que cuando se utilizaron sustancias puras, an en combinaciones
binarias, terciarias y cuaternarias.
Agradecimiento
Al Br. Alexander Huamn Mera, por su asistencia tcnica en
la preparacin del manuscrito.
Literatura citada
Andrews J.M. 2001. Determination of minimum inhibitory concen-
trations. J. Antimicrob. Chemother. 48 (Suppl. 1): 5-16.
Asencios L., N. Quispe, A. Mendoza-Ticona, E. Leo, L. Vsquez,
O. Jave & C. Bonilla. 2009. Vigilancia Nacional de la
resistenciaamedicamentosantituberculosos,Per2005-
2006. Rev Peru Med Exp Salud Publica 26(3): 278-87.
Aziz M.A., A. Wright, A. Lazlo, A. De Muynck, F. Portaels, A.
Van Deun, C. Wells, P. Nunn, L. Blanc & M. 2006. Ravi-
glione. Epidemiology of antituberculosis drug resistance
(theGlobalProjectonAnti-tuberculosisDrugResistance
Surveillance) an update analysis. The Lancet 368:2142-54.
BonillaC.2008.SituacindelatuberculosisenelPer.ActaMed
Per 25(3) 163-170
BonnetM.,M.Coumans,M.Holfnger,J.L.Ramaut&T.Gaspar.
1984.High-performancegaschromatographyof1,4-na-
phtoquinones from Droseraceae. Chromatograph. 18:
621-622.
BrakoL.&J.L.Zarucchi.1993.CatalogueoftheFloweringPlants
and Gymnosperms of Peru. Missouri Botanical Garden.
St. Louis, Missouri.
BudzianowskyJ.1995.NaphtoquinonesofDroseraspathulatafrom
in vitro cultures. Phytochemistry 40: 1145-1148.
BudzianowskyJ.,L.Skrypczak,K.Kukulczanka.1993.Phenolic
compounds of Drosera intermedia and Drosera spathulata
from in vitro cultures. Acta Hortic. 330: 277-280.
ColeS.T.,R.Brosh,J.Parkhill,etal.1998.Decipheringthebiology
of Mycobacterium tuberculosis from the complete genome
sequence.Nature393:537-544.
Coll P. 2003. Frmacos con actividad frente a Mycobacterium tu-
berculosis.Enferm.Infecc.Microbiol.Clin.21:299-308.
CronquistA.1988.TheEvolutionandClassifcationofFlowering
Plants.SecondEditionUSA.NewYorkBotanicalGarden.
555 pp.
CrouchI.J.,J.F.Finnie&J.vanStaden.1990.Studiesontheisolation
of plumbagin from in vitro and in vivo grown Drosera
species. Plant Cell Tiss. Org. Cult. 21: 78-82.
CulhamA. & R.J. Gornall. 1994. The taxonomic signifcance of
naphthoquinones in the Droseraceae. Biochem. System.
Ecol. 22: 507-515.
Danelutte AP, Costantin MB, Delgado GE, Braz-Filho, R, Kato MJ.
2005. Divergence of secondary metabolism in cell suspen-
sion cultures and differentiated plants of Piper cernuum and
P. crassinervium. J. Braz. Chem. Soc. 16(6B): 1425-1430.
Durand R. & M.H. Zenk. 1971. Biosynthesis of plumbagin
(5-hydroxy-2-methyl-1,4-naphtoquinone) via the acetate
pathwayinhigherplants.TetrahedronLett.32:3009-3012.
Durand R. & M.H. Zenk. 1976. The biosynthesis of the naphto-
quinone 7-D methyljuglone. Biochem. Physiol. PLanz.
169:213-217.
FinnieJ.F.&J.vanStaden.1993.Droseraspp.(Sundeaw):micro-
propagation and the in vitro production of plumbagin. In:
Biotechnology in Agriculture and Forestry. Medicinal and
Aromatic Plants XI.Y.P.S. Bajaj (ed.). Springer-Verlag,
Berlin. 24: 164-167.
Gibbons S. 2008. Phytochemicals for bacterial resistance strengths,
weaknessesandopportunities.PlantaMed.74:594-602.
GoodeW.J. & P.K. Hatt. 1986. Mtodos de Investigacin Social.
Dcima cuarta edic. Ed. Trilla, Mxico. 236 p.
JarlierV.&H.Nikaido.1994.Mycobacterialcellwall:Structureand
role in natural resistance to antibiotics. FEMS Microbiol.
Lett. 123: 11-18.
JaveO.2009.Investigandoentuberculosis.Dndeestamos,quinos
somos, hacia dnde nos dirigimos?. Rev Peru Med Exp
Salud Publica 26(3): 276-77.
KwonH.H.,H.Tomioka&H.Saito.1995.Distributionandcharac-
terization of beta-lactamases of mycobacteria and related
organisms. Tuber. Lung Dis. 76: 141-148.
Leatemia J. & B. Isman. 2004. Toxicity and antifeedant activity of
crude seed extract of Annona squamosa (Annonaceae)
against lepidopteran pests and natural enemies. Int. J. Trop.
Insect Sci. 24: 150-158.
MurashigeT.&F.Skoog.1962.Arevisedmediumforrapidgrowth
and bioassays with tobacco tissue cultures. Physiol. Plant.
15:473-479.
MurashigeT.1974.Plantpropagationthroughtissueculture.Ann.
Rev. Plant Physiol. 25: 135-166.
Navickiene H.M.D., J.E. Miranda, S.A. Bortoli, M.J. Kato, V. da S.
Bolzani & M. Furlan. 2007. Toxicity of extracts and iso-
butyl amides from Piper tuberculatum: potent compounds
with potential for the control of the velvetbean caterpillar,
Anticarsiagemmatalis.PestManag.Sci.63:399-403.
OPS (Organizacin Panamericana de la Salud). 1986. Manual de
Normas y Procedimientos Tcnicos para la Bacteriologa
de la Tuberculosis. Nota Tcnica No 28. 42 p.
amajJ.,M.Blehov,A.Repk,A.Oveka&M.Bobk.1999.
Drosera species (sundew): In vitro culture and the produc-
tion of plumbagine and other secondary metabolites. In:
Biotechnology in Agriculture and Forestry. Medicinal and
Aromatic Plants XI.Y.P.S. Bajaj (ed.). Springer-Verlag,
Berlin. 43: 105-135.
Schlly T. & Kapetanidis I. 1989. Flavonol and naphthoquinone
glycosides of Drosera rotundifolia. Planta Med. 55: 611-
612.
Scott I.M., E. Puniani, T. Durst, et al. 2002. Insecticidal activity of
Piper tuberculatum Jacq. Extracts: synergistic interaction
of piperamides. Agr. Forest Entomol. 4: 137-144.
358
Alvarado et al.
Rev. peru. biol. 17(3): 353 - 358 (Diciembre 2010)
SilvaT.R.&A.M.Giulietti.1997.LevantamentodasDroseraceae
do Brasil. Bolet. Bot. Univ. So Paulo. 16: 75-105.
SimolaI.K.1978.Theeffectofseveralaminoacidsandsomeinorga-
nic nitrogen sources on the growth of Drosera rotundifolia
inlongandshort-dayconditions.Z.Pfazenphysiol.90:
61-68.
SomoskoviA.,L.M.Parsons&M.Salfnger.2001.Themolecular
basis of resistance to isoniazide, rifampicin, and pyrazi-
namide in Mycobacterium tuberculosis. Respir. Res. 2:
164-168.
TiconaE.2009.Tuberculosis:Seagotelenfoquebiomdico?.Rev
Peru Med Exp Salud Publica 26(3): 273-75.
Walker TS. 2000. Microbiologa. Mc Graw-Hill Interamericana.
Mxico. 513 pp.
Wawrosch C., J. Markotai, B. Steinberger & B. Kopp. 1996. In
vitro Vermehrung von Sonnentau- Arten. Sci. Pharm.
64: 621-622.
WHO (World Health Organization). 2006. WHO report global
tuberculosis control surveillance, planning, fnancing.
World Health Organization (WHO/HTM/TB/2006.362).
Geneva. 246 pp.
Zenk M.H., M. Fubringer & W. Steglich. 1969. Ocurrence and
distribution of 7-metiljuglone and plumbagine in the
Droseraceae.Phytochemistry8:2199-2200.
359

Agentes etiolgicos que afectan los langostinos silvestres en Tumbes
Rev. peru. biol. 17(3): 359 - 364 (December 2010)
Rev. peru. biol. 17(3): 359 - 364 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Prevalencia y distribucin de los principales agentes etiolgicos
que afectan los langostinos silvestres en Tumbes, Per
Rubn Alfaro Aguilera
1
*, Mervin Guevara Torres
1
, Isaas Gonzales Chvez
1
Prevalence and distribution of the principal etiologic agents that affecting
wild shrimps from Tumbes, Peru
1 Laboratorio de Sanidad Acucola,
Instituto del Mar del Per- IMARPE,
Sede Tumbes, Panamericana Norte
Km. 1249, Zorritos, Tumbes, Per.
E-mail Rubn Alfaro:
ralfaro@imarpe.gob.pe
Presentado: 03/09/2010
Aceptado: 28/11/2010
Publicado online: 00/11/2010
Resumen
Se determin la prevalencia y distribucin de diferentes agentes patgenos en langostinos silvestres, en la zona
de esteros de la Regin Tumbes - Per, entre marzo y diciembre de 2009. Los canales de marea considerados
en este estudio fueron: Boca del Ro Tumbes, El Alcalde, Jel, El Bendito, Envidia, Soledad y Algarrobo. Se
colect un total de 1926 langostinos entre juveniles y pre-adultos de las especies Litopenaeus vannamei, L.
stylirostris y Farfantepenaeus californiensis. Utilizando la tcnica de la PCR, se detect la presencia de los
patgenos NHPB (0,62%), IHHNV (0,31%), BP (1,61%) y WSV (2,75%); no se encontr infeccin por TSV.
Las tres especies en estudio fueron positivas a WSV y BP, presentndose la mayor prevalencia de infeccin
por WSV (2,98%) en la especie L. stylirostris y por BP (2,66%) en L. vannamei. La NHPB fue detectada en
las especies L. vannamei y L. stylirostris con 0,77% y 0,43% de prevalencia respectivamente. Se obtuvo una
prevalencia de 0,52% para IHHNV en L. vannamei. Las ms altas prevalencias de las infecciones por WSV,
BP, NHPB e IHHNV se registraron en los canales de marea El Alcalde (10,79%), Algarrobo (4,51%), Envidia
(2,26%) y Jel (5,05%). Los datos sealan la presencia constante de diversos patgenos virales y bacterianos
en diferentes especies de peneidos y su amplia distribucin a lo largo del litoral tumbesino, lo que constituye
un riesgo potencial para el desarrollo de la acuicultura en la regin, y podra afectar las poblaciones naturales
de langostinos.
Palabras Clave: Prevalencia, WSV, IHHNV, BP, enfermedades langostinos.
Abstract
Prevalence and distribution of different pathogens of wild shrimp in the tidal channels of the Region Tumbes -
Peru, during March to December 2009. The tidal channels considered in this study were: Boca del Rio Tumbes,
El Alcalde, Jel, El Bendito, Envidia, Soledad and Algarrobo. We collected a total of 1926 shrimps between
juvenile and pre-adults of the species Litopenaeus vannamei, L. stylirostris y Farfantepenaeus californiensis.
Using the PCR technique, detected the presence of pathogens NHPB (0.62%), IHHNV (0.31%), BP (1.61%)
and WSV (2.75%); no infection was found by TSV. The three species studied were positive for WSV and BP
showed the highest prevalence of WSV infection (2.98%) in the species L. stylirostris and BP (2.66%) in L.
vannamei. The NHPB was detected in the species L. vannamei, L. stylirostris to 0.77% and 0.43% prevalence
respectively. There was a prevalence of 0.52% for IHHNV in L. vannamei. The highest prevalence of infec-
tions WSV, BP, NHPB and IHHNV were recorded in the tidal channels El Alcalde (10.79%), Algarrobo (4.51%),
Envidia (2.26%) and Jel (5.05%) respectively. Data showed that the constant presence of various pathogens
in different penaeid species and their wide distribution along the coast Tumbes, which could produce an impact
on wild stocks of shrimp and being a potential risk for development of aquaculture in the region.
Keywords: Prevalence, WSV, IHHNV, BP, shrimp diseases.
Introduccin
La actividad de cultivo de langostinos o camarones peneidos
en el Per est concentrada en la regin Tumbes, en ambientes
aledaos al ecosistema de manglares y esteros. Se ha demostrado
que muchos patgenos que causan enfermedades en los sistemas
de cultivo provienen de poblaciones naturales, de las mismas
especies o de especies emparentadas a las cultivadas. As mismo,
las enfermedades de las especies en cultivo, tambin pueden
afectar a las poblaciones naturales poniendo en riesgo su estatus
sanitario (Raynard et al. 2007).
Los langostinos peneidos tanto silvestres como de cultivo,
son afectados por diversos agentes patgenos, principalmente
de naturaleza viral y bacteriana. Las infecciones virales son
consideradas las ms importantes desde el punto de vista epi-
demiolgico, causando prdidas signifcativas en la produccin
de langostinos en todo el mundo.
Una de las enfermedades de peneidos ms letales, es la pro-
ducida por el virus de la mancha blanca (white spot syndrome
virus, WSV o WSSV), que adems afecta varias especies de
crustceos decpodos de ambientes marinos, estuarinos y de
agua dulce (Lo et al. 1996, Corbel et al. 2001, Chakraborty
et al. 2002, Snchez-Martnez et al. 2007). Esta enfermedad
puede producir mortalidades acumulativas en estanques de
cultivo del 80 al 100% despus de 7 a 10 das de la infeccin
(Nakano et al. 1994).
El Baculovirus penaei (BP), es considerado enzotico en pe-
neidos silvestres del continente Americano y Hawai. Se tienen
registros de su presencia en langostinos silvestres y de cultivo de
varias regiones de la costa del Pacfco, desde Per a Mxico y
en pases como Brasil, Cuba y el sureste de los Estados Unidos
(OIE 2006, Lightner 1996, Fajer et al. 1998). Son susceptibles
a la infeccin por BP algunas especies de los gneros Litope-
naeus, Farfantepenaeus y Penaeus (Lightner 1996); ha producido
elevadas mortalidades en estadios de larvas y postlarvas, as
como reduccin de la alimentacin y bajas tasas de crecimiento
(Morales & Cuellar-Anjel 2008).
Otro agente patgeno que infecta a la mayora de las especies
de peneidos, es el virus de la necrosis hipodrmica y hemato-
poytica infecciosa (IHHNV, Infectious hypodermal and hae-
matopoietic necrosis virus), que produce infecciones graves en
juveniles y pre-adultos de L. stylirostris; causando mortalidades
masivas en esta especie (OIE 2006). En L. vannamei, la infec-
360
Alfaro et al.
Rev. peru. biol. 17(3): 359 - 364 (Diciembre 2010)
cin por IHHNV es de tipo crnico, produciendo deformidad
cuticular y crecimiento reducido e irregular (Lightner 1996).
Este virus se encuentra distribuido a nivel mundial, tanto en
langostinos silvestres como de cultivo (Morales & Cuellar-Anjel
2008). En el hemisferio occidental, ha sido descrito desde Per
a Mxico, incluyendo Hawai, la Polinesia francesa y Nueva
Caledonia; adems, ha sido reportado en varios pases de Asia
y en el medio oriente (OIE 2006).
El virus del sndrome de Taura (TSV), apareci inicialmente
en Ecuador en el ao 1992, y ahora se encuentra distribuido
en muchos pases de Amrica central, Sudamrica y Hawai
(Lightner 1996). Tambin, ha sido registrado hace algunos aos
en Taiwn y China, siendo el origen de la infeccin la especie
L. vannamei procedente del hemisferio occidental (Lien et al.
2002). Se han documentado infecciones en poblaciones silvestres
de L. vannamei, L. stylirostris y L. setiferus, siendo en los estadios
posteriores a postlarvas 12 y juveniles de langostinos, las infeccio-
nes ms severas (Morales & Cuellar-Anjel 2008). La enfermedad
producida por TSV presenta 03 fases bien defnidas, una fase
aguda en el cual se produce la mayor mortandad de langostinos;
la fase de transicin o recuperacin y la fase crnica, donde los
langostinos infectados no muestran sntomas de la enfermedad.
Entre los patgenos bacterianos de importancia, la NHPB
(bacteria de la necrosis del hepatopncreas) produce una enfer-
medad severa, con mortalidades entre 20 a 90% en los sistemas
de cultivo (Loy et al. 1996). Esta bacteria ha sido reportada solo
en peneidos de Amrica y ha sido reconocida en diferentes espe-
cies, entre ellas: L. vannamei, L. aztecus, L. setiferus, L. stylirostris
y F. californiensis.
Los patgenos seleccionados evaluados en esta investigacin,
tienen caractersticas comunes tales como generar prdidas
signifcativas de produccin, afectar a poblaciones naturales de
crustceos acuticos y presentar rpida propagacin en pobla-
ciones de cultivo.
En presente trabajo, se estudio la prevalencia y distribucin de
patgenos virales y bacterianos en peneidos silvestres en ambien-
tes naturales aledaos a las zonas de cultivo de la Regin Tumbes.
Material y mtodos
rea de estudio.- Se evaluaron seis canales de marea del
ecosistema de manglar de la Regin Tumbes (Fig. 1), ubicados
en las provincias de Tumbes y Zarumilla: Boca del Ro Tumbes
(33028,92S; 80 2949,86W), El Alcalde (33056,22S;
802636,12W), Jel (32943,98S; 802228,98W), El
Bendito (32659,76S; 80193,6W), Soledad (32731,86S;
801830,48W) y Algarrobo (32813,68S; 801753,34W).
Debido a la poca captura de langostinos para completar la
muestra mnima requerida, a partir de junio hasta diciembre se
incorpor al estudio el canal de marea Envidia (32718,36S;
801845,42W). Estos canales de marea, adems de ser los
ms accesibles, se encuentran aledaos a las zonas de cultivo de
langostinos y sirven como zona de captacin de agua y descarga
de efuentes por las empresas langostineras, lo que los hace de
utilidad para este estudio.
Colecta de muestras.- Entre los meses de marzo a diciembre
de 2009, se capturaron juveniles y pre-adultos de langostinos
silvestres con periodicidad quincenal. La captura se realiz
mediante lances de atarraya, hasta completar un mnimo de
20 ejemplares por canal de marea. Las muestras de langostinos
obtenidas fueron etiquetadas y transportadas en hielo al Labo-
ratorio de Sanidad Acucola de la Sede IMARPE Tumbes. En
el laboratorio, se tomaron datos individuales de los langostinos
como peso, talla y alguna caracterstica adicional externa de
inters (facidez, coloracin rojiza, msculo blanco, deformidad
o necrosis cuticular). Las branquias y hepatopncreas fueron
extrados y conservados en etanol al 96% y almacenadas a -20
C, hasta su anlisis respectivo.
Extraccin de cidos nucleicos.- Las extracciones de ADN
se realizaron por individuo, utilizando el mtodo estndar
CTAB-DTAB (Gustincich et al. 1991), con modifcaciones. En
un microtubo de 1,5 mL se coloc 25 mg del tejido branquial
y se agreg 600 L de solucin DTAB (dodeciltrimetilamonio
bromuro 8%, NaCl 1,5 M, Tris HCl 100 mM pH 8,8 y EDTA
50 mM), a los tejidos de hepatopncreas se aadi adems 100
L de EDTA 500 mM. Con la ayuda de un micromacerador
de plstico se homogeniz el tejido, la mezcla fue incubada
a 75 C por 5 min, despus de lo cual se agreg 700 L de
Figura 1. Ubicacin geogrfca de los canales de marea en estudio, en el ecosistema manglar de la Regin Tumbes, Per.

80.53 LW 80.48 LW 80.43 LW 80.38 LW 80.33 LW 80.28 LW
80.53 LW 80.48 LW 80.43 LW 80.38 LW 80.33 LW 80.28 LW 80.23 LW
3.58 LS
3.55 LS
3.53 LS
3.50 LS
3.48 LS
3.45 LS
3.43 LS
3.40 LS
TUMBES
ZARUMI LLA
MAR DE GRAU


Boca del Ro Tumbes
El Alcalde
Jel
El Bendito
Soledad
Algarrobo
Tumbes
Per
81,0W 80,5W 80,0W
E
c
u
a
d
o
r
Piura
Tumbes
Pto. Pizarro
Envidia
361

Agentes etiolgicos que afectan los langostinos silvestres en Tumbes
Rev. peru. biol. 17(3): 359 - 364 (December 2010)
cloroformo HPLC, se mezcl en vortex y se centrifug en una
microcentrfuga a 12000 rpm por 5 min. El sobrenadante (250
L) fue transferido a otro microtubo de 1,5 mL que contena
100 L de solucin CTAB (5% cetiltrimetilamonio bromuro,
0,4 M NaCl) y 900 L de agua destilada autoclavada; se mezcl,
incub a 75 C por 5 min y centrifug a 12000 rpm por 10
min; el sobrenadante fue descartado y el pellet resuspendido en
150 L de solucin disolvente (NaCl 1,2 M) se incub a 75 C
por 5 min y se centrifug a 12000 rpm por 5 min. Finalmente
la solucin fue transferida a un nuevo microtubo con 300 L de
etanol 95%, se mezcl y centrifug nuevamente a 12000 rpm
por 5 min, el pellet fue lavado con etanol al 75%, secado por
10 min y resuspendido con agua ultrapura.
Las extracciones de ARN se realizaron por grupos de 5
ejemplares, con el kit de extraccin de ARN del Laboratorio
IQ-2000
TM
(GeneReach BiotechnologyCorp, Taiwan) siguiendo
las indicaciones del fabricante.
Anlisis por PCR.- Los cebadores especfcos para los dife-
rentes patgenos en estudio y sus productos de amplifcacin, se
muestran en la Tabla 1. Las muestras fueron analizadas mediante
la tcnica de PCR simple para el descarte de la NHPB. Las re-
acciones se realizaron en mezclas de 20 L, con 2 L de bufer
Taq 10X (100 mM Tris-HCl pH 8,8, 500 mM KCl y 0,8% de
Nonidet P-40), 1,5 mM de MgCl
2
, 0,125 mM de cada dNTPs,
1,25 U de Taq ADN polimerasa recombinante (Fermentas Life
Sciences, Lituania), 10 pmol de cada cebador y 2 L de ADN
extrado. El perfl de la PCR se realiz en un termociclador (9800
Fast Termal Cycler, Applied Biosystems, USA), este consta de
35 ciclos de 94 C por 30 s, 58 C por 30 s, 72 C por 1 min
y una extensin fnal a 72 C por 5 min.
Para la deteccin del IHHNV, se prepar un volumen de
reaccin fnal de 20 L, constituida por 2 L de bufer Taq
10X, 2 mM de MgCl
2
, 0,2 mM de cada dNTPs, 1,25 U de Taq
ADN polimerasa recombinante, 150 ng de cada cebador y 2 L
de ADN extrado. El programa de la PCR (termociclador 9800
Fast Termal Cycler, Applied Biosystems, USA) consta de un
ciclo a 94 C por 5 min, 35 ciclos de 95 C por 30 s, 55 C por
30 s, 72 C por 1 min y una extensin fnal a 72 C por 5 min.
El Baculovirus penaei fue analizado utilizando un volumen
de reaccin de 20 L, constituido por 2 L de bufer Taq 10X,
1,5 mM de MgCl
2
, 0,2 mM de cada dNTPs, 1 U de Taq ADN
polimerasa recombinante, 5 pmol de cada cebador y 2 L de
ADN extrado. La PCR (termociclador 9800 Fast Termal
Cycler, Applied Biosystems, USA) se realiz con un ciclo a 95
C por 5 min, 30 ciclos de 94 C por 30 s, 58 C por 45 s, 72
C por 45 s y una extensin fnal a 72 C por 5 min.
Se utiliz nested PCR para deteccin del WSV, siendo 50
L el volumen fnal de cada reaccin, constituido por 5 L de
bufer Taq 10X, 1,5 mM de MgCl
2
, 0,2 mM de cada dNTPs,
1 U de Taq ADN polimerasa recombinante, 10 pmol de cada
cebador y 1 L de ADN extrado. La PCR fue realizada en un
termociclador (Termolyne Amplitron II, USA), el perfl de
amplifcacin consta de un ciclo de 94 C por 5 min, seguido de
30 ciclos de 94 C por 30 segundos, 52 C por 30 segundos y 72
C por 45 segundos y una extensin fnal a 72 C por 5 minutos.
La deteccin del TSV se realiz con RT-PCR, la sntesis del
ADN complementario (ADNc), se prepar siguiendo el proto-
colo descrito por Fermentas Life Sciences (Lituania), utilizando
para este fn 20 pmol de cebadores especfcos y 2 L de ARN
extrado en un volumen fnal de 11 L por cada microtubo de re-
accin. Se procedi a incubar a 70 C por 5 min y posteriormente
se agreg una mezcla de 20 L con los siguientes componentes:
4 L de bufer 5X (250 mM Tris-HCl pH 8,3, 250 mM KCl,
20 mM MgCl
2
, 50 mM DTT), 0,5 U de inhibidor de RNasa
(Fermentas), 200 U de enzima RT M-MuLV (Fermentas), 1
mM de cada dNTPs y 13,7 L de agua ultrapura.
La RT-PCR se efectu mediante un ciclo a 42 C por 60
min y un ciclo a 70 C por 10 min (termociclador 9800 Fast
Termal Cycler, Applied Biosystems, USA). La PCR se realiz
en un volumen fnal de 20 L, utilizndose 2 L de bufer Taq
10X, 2,5 mM de MgCl
2
, 0,2 mM de cada dNTPs, 1,25 U de
Taq ADN polimerasa (Fermentas), 10 pmol de cada cebador
y 2 L de ADNc. El programa de amplifcacin const de un
ciclo a 94 C por 5 min, seguido de 30 ciclos de 94 C por 30
segundos, 60 C por 30 segundos y 72 C por 45 segundos y
una extensin fnal a 72 C por 5 minutos.
Los productos de amplifcacin fueron verifcados por elec-
troforesis (TAE 1X), en geles de agarosa al 1%, teidos con
bromuro de etidio (0,5 ug/mL) y por electroforesis en TAE 1X.
Anlisis de datos.- Los datos fueron procesados en el pro-
grama Working in Epidemiology (de Blas 2006, http://www.
winepi.net/), con un nivel de confanza del 95%. La distribucin
de los diferentes patgenos fue procesada en la hoja de clculo
Microsoft Ofce Excel y en el programa Surfer.
Patgeno Cebador Secuencia Producto Referencia
NHPB
pf-1 5 ACG TTG GAG GTT CGT CCT TCA G 3 441 pb Loy et al. 1996
pr-2 5 TCA CCC CCT TGC TTC TCA TTG T 3
IHHNV
77012F 5 ATC GGT GCA CTA CTC GGA 3 356 pb OIE 2006
77353R 5 TCG TAC TGG CTG TTC ATC 3
BP
BPA 5 GAT CTG CAA GAG GAC AAA CC 3 560 pb OIE 2006
BPB 5 ATC GCT AAG CTC TGG CAT CC 3
WSV
1 rx
146F1 5 ACT ACT AAC TTC AGC CTA TCT AG 3 1.447 pb OIE 2006
146R1 5 TAA TGC GGG TGT AAT GTT CTT ACG A 3
2 rx
146F2 5 GTA ACT GCC CCT TCC ATC TCC A 3 941 pb OIE 2006
146R2 5 TAC GGC AGC TGC TGC ACC TTG T 3
TSV
9992F 5' AAG TAG ACA GCC GCG CTT 3' 231 pb OIE 2006
9195R 5' TCA ATG AGA GCT TGG TCC 3'
Tabla 1. Relacin de cebadores especfcos para cada patgeno evaluado y productos de amplifcacin de la PCR.
362
Alfaro et al.
Rev. peru. biol. 17(3): 359 - 364 (Diciembre 2010)
Resultados
Prevalencia.- Un total de 1926 langostinos de las especies L.
vannamei, L. stylirostris y F. californiensis fueron colectados (Tabla
2). La mayora de especmenes capturados presentaron aparente
buen estado de salud y los signos de enfermedad observados en
algunos casos fueron coloracin rosada del cuerpo, opacidad
difusa y lechosa del msculo, expansin de cromatforos del
epitelio cuticular, urpodos rojos, branquias oscuras o necrosis
multifocal en cutcula.
Las mayores prevalencias obtenidas, corresponden a los
patgenos WSV (2,75%) y BP (1,61%), sin obtenerse resultados
positivos al TSV (Tabla 3). Teniendo en cuenta la poblacin en
estudio, se estimaron las prevalencias mximas y mnimas de cada
uno de los patgenos enzoticos de la zona en estudio (Fig. 2).
Se observ que las especies L. vannamei y L. stylirostris son
infectados por WSV, BP y NHPB; slo L. vannamei es infectado
por IHHNV. En F. californiensis, se encontr a los virus BP y
WSV con valores de prevalencia iguales (1,72%) (Fig. 3).
Los valores de prevalencia puntual mxima para WSV se
encontraron en la ltima quincena de junio (10,17%) y prim-
era quincena de julio (16,30%) y los ms bajos entre los meses
de setiembre a diciembre (0,00 a 2,08%). La NHPB present
un comportamiento similar al WSV, presentndose brotes de
infeccin por esta bacteria en la poca de menores temperaturas
(4,62%). El BP mantiene valores constantes entre los meses de
marzo a mayo, pero desde setiembre hasta noviembre se regis-
tra su valor ms alto de prevalencia (7,56%). El IHHNV fue
detectado en el mes de setiembre (0,67%), y alcanz su mayor
prevalencia en el mes de diciembre con 5,71% (Fig. 4).
Distribucin geogrfca.- En los canales de marea en estudio,
no se encontraron todos los patgenos evaluados. Se obtuvo
muestras positivas al WSV en seis de las zonas monitoreadas,
siendo el canal de marea El Alcalde la zona con mayor nmero de
muestras positivas a este patgeno; en el canal de marea Envidia
no se registr su presencia (Fig. 5a). El IHHNV se present slo
en los canales de marea Jel (5,05%) y Envidia (0,38%) (Fig.
5b). Las mayores prevalencias para BP fueron obtenidas en los
canales de marea El Bendito y Algarrobo con 3,21% y 4,51%
respectivamente (Fig. 5c).
Discusin
En el Per, especfcamente la zona noroccidental, donde se
desarrolla el cultivo de langostinos, es considerada por muchos
investigadores rea enzotica de diversas enfermedades que
causan prdidas signifcativas en la produccin. Los agentes
infecciosos de mayor relevancia en el Per segn su aparicin
en el tiempo comprenden a BP, IHHNV, NHPB, TSV y WSV
(Direccin Regional de Pesquera de Tumbes: Estadsticas de pro-
duccin 2003. Documento interno, datos no publicados). Las
especies L. vannamei, L. stylirostris y F. californiensis, nativas de
los canales de marea o esteros de Tumbes, presentan una elevada
susceptibilidad a estos patgenos, sumndose a los factores que
afectan negativamente a la posible recuperacin de este recurso
en reas naturales.
Durante el tiempo que dur el estudio, se presentaron brotes
de infeccin de los patgenos NHPB, IHHNV, BP y WSV,
en las diversas zonas de estudio. El WSV no slo mostr los
valores ms altos de prevalencia, si no que se encontr en casi
todas las zonas monitoreadas. El WSV tiene la particularidad
de presentar un amplio rango de hospederos, considerndose a
todos los crustceos decpodos como especies susceptibles a la
infeccin (Wang et al. 1998, Peng et al. 1998), a diferencia de
Especie Ejemplares capturados
Litopenaeus vannamei 1164
Litopenaeus stylirostris 704
Farfantepenaeus californiensis 58
Total 1926
Tabla 2. Nmero de ejemplares de langostinos peneidos por especie,
capturados en los
Figura 2. Valores de prevalencia (rangos mnimos y mximos proba-
bles) de los principales agentes etiolgicos que afectan los langostinos
silvestres, Tumbes, 2009.
Patgeno Tamao de muestra Infectados Prevalencia (%)
NHPB 1926 12 0,62
IHHNV 1926 6 0,31
BP 1926 31 1,61
WSV 1926 53 2,75
TSV 892 0 0,00
Tabla 3. Prevalencias de infeccin en langostinos peneidos captura-
dos en los canales de marea de Tumbes, marzo a diciembre de 2009.
Figura 3. Prevalencia de infeccin por especie de peneido silvestre
capturado en los canales de marea de la Regin Tumbes, marzo a
diciembre de 2009.
0
0,5
1
1,5
2
2,5
3
3,5
4
NHPB IHHNV BP WSV TSV
Patgeno
P
r
e
v
a
l
e
n
c
i
a

(
%
)
0,00
0,50
1,00
1,50
2,00
2,50
3,00
3,50
WSV BP NHPB IHHNV TSV
P
r
e
v
a
l
e
n
c
i
a

(
%
)
Patgeno
L. vannamei
F. californiensis
F. californiensis
363

Agentes etiolgicos que afectan los langostinos silvestres en Tumbes
Rev. peru. biol. 17(3): 359 - 364 (December 2010)
otros patgenos de langostinos que presentan cierta especifcidad
de hospederos. Rajendran et al. (1999), manifestan que un
mecanismo esencial para la persistencia de algunos virus, es la
existencia de hospederos alternativos y reservorios en diferentes
poblaciones de origen silvestre. Estas caractersticas explican su
amplia distribucin en las zonas de muestreo de este estudio.
Valores de prevalencias en diversos langostinos y cangrejos,
para WSV fueron de 3,5%, 11,6%, 5,2% y 3,4% en los aos
2001, 2002, 2003 y 2004 respectivamente (IMARPE-Tumbes,
datos no publicados), con tendencia a disminuir con el paso del
tiempo; para el ao 2005, la prevalencia reportada para el WSV
fue de 3,3%, y de 1,7% para el 2006, siguiendo la tendencia
de aos anteriores. Sin embargo; en el 2009 la prevalencia al
WSV fue de 2,75%, incremento posiblemente infuenciado por
el aumento en las densidades de los cultivos de langostinos y la
descarga de sus efuentes en los canales de marea monitoreados.
Datos de la OIE (2009), indican que las prevalencias de infec-
cin por este virus son menores al 1% en poblaciones silvestres.
La mayor prevalencia (10,79%) en el canal de marea El Al-
calde ocurre posiblemente por la extensa rea de produccin en
la zona, la inadecuada tecnifcacin en el manejo de los cultivos
por parte de sus cultivadores, y las descargas de desechos sin
ningn tratamiento previo, que mantienen a los langostinos
silvestres en condicin de estrs, hacindolos ms susceptibles a la
infeccin por WSV, resultando en un aumento de la prevalencia,
comparado con aos anteriores.
Para el patgeno BP, los datos muestran prevalencias puntu-
ales desde 0 hasta 5,22%, encontrndose resultados positivos en
gran parte del tiempo que dur la investigacin. Al parecer la
presencia de este patgeno no est condicionada por las variac-
iones de temperatura, contrario a lo observado con el WSV, cuya
presencia estara modulada por las variaciones de temperatura.
Figura 4. Variacin temporal de prevalencias de infeccin por WSV, BP, NHPB e IHHNV, durante marzo a diciembre de 2009.
0
2
4
6
8
10
12
14
16
18
Mar Abril May Jun Jul Sep Oct Nov Dic
WSV
P
r
e
v
a
l
e
n
c
i
a

(
%
)
22
23
24
25
26
27
28
29
30
31
C
BP NHPB IHHNV T promedio T mx T mn
Figura 5. Distribucin del (a) WSV, (b) IHHNV, (c) BP y (d) NHPB en canales de marea, durante marzo a diciembre de 2009. Canales de
marea: 1. Boca del Ro Tumbes 2. El Alcalde 3. Jel 4. El Bendito 5. Envidia 6. Soledad y 7. Algarrobo.

3.58 LS
3.55 LS
3.53 LS
3.50 LS
3.48 LS
3.45 LS
3.43 LS
3.40 LS
TUMBES
ZARUMILLA
MAR DE GRAU
Canales de marea
Leyenda
Zonas con WSV
(El nmero de los aros vara
dependiendo de la prevalencia)
TUMBES
ZARUMILLA
MAR DE GRAU
Canales de marea
Leyenda
Zonas con IHHNV
(El nmero de los aros vara
dependiendo de la prevalen cia)

80.53 LW 80.48 LW 80.43 LW 80.38 LW 80.33 LW 80.28 LW 80.23 LW
3.58 LS
3.55 LS
3.53 LS
3.50 LS
3.48 LS
3.45 LS
3.43 LS
3.40 LS
TUMBES
ZARUMILLA
MAR DE GRAU
Canales de marea
Leyenda
Zonas con BP
(El nmero de los aros vara
dependiendo de la prevalencia )

80.53 LW 80.48 LW 80.43 LW 80.38 LW 80.33 LW 80.28 LW 80.23 LW
TUMBES
ZARUMILLA
MAR DE GRAU
Canales de marea
Leyenda
Zonas con NHPB
(El nmero de los aros vara
dependiendo de la prevalencia )
(a) (b)
(c) (d)
364
Alfaro et al.
Rev. peru. biol. 17(3): 359 - 364 (Diciembre 2010)
Se observa que en la poca con menores temperaturas (junio y
julio), las prevalencias del WSV aumentan considerablemente
(prevalencia mxima 11,28% en el mes de julio). Observaciones
en aos anteriores indican el mismo patron (IMARPE-Tumbes,
datos no publicados); concluyendo que la estacin de invierno
es de alto riesgo y poco apropiado para el cultivo de langostino.
Similar relacin parece ocurrir con la bacteria de la NHP, que fue
reportada en esta poca. Lightner (2006) asocia la presencia de
este patgeno con los factores ambientales como temperatura (29
a 35 C) y salinidades elevadas (20 a 38 ppt) durante periodos
prolongados; en nuestros resultados la presencia de la NHPB
fue mayor en los canales de marea que presentan salinidades
ms elevadas de la zona (36 a 41 ups), pero en periodos de bajas
temperaturas (25 a 26C).
Las prevalencias para el IHHNV durante los meses de marzo
a noviembre fuctuaron entre 0 y 0,67%, con una prevalencia
global de 0,31%. La prevalencia obtenida en el mes de diciembre
(5,71%) al parecer estuvo infuenciada por escapes accidentales
en la cosecha de L. vannamei cultivados e infectados. En esta
poca, en una empresa langostinera aledaa al canal de marea
Jel, se report alta incidencia del IHHNV en sus estanques de
cultivo entre los meses de noviembre a diciembre (IMARPE-
Tumbes, datos no publicados).
Esta condicin signifca un riesgo potencial y de carcter letal
para la poblacin silvestre de L. stylirostris, altamente susceptible
a la infeccin por el IHHNV. Las prevalencias del IHHNV
en langostinos de cultivo intensivo fuctan entre 4 - 96% y
en semi-intensivos de 0 - 100% (IMARPE-Tumbes, datos no
publicados), se pone de manifesto el peligro potencial de la
transmisin de este virus a las poblaciones naturales peneidos
si no se cuenta con las medidas de bioseguridad adecuadas, que
impidan el escape accidental de langostinos de cultivo.
Aunque no se obtuvo resultados positivos al TSV y debido
a su carcter endmico en la regin (Lightner 1996), se cal-
cul la prevalencia mxima posible que se podra obtener en
la poblacin bajo estudio, la cual fuctu entre 0 y 0,33%. Es
escasa la informacin concerniente a la prevalencia de TSV en
poblaciones de langostinos silvestres. La OIE (2006), refere que
en regiones de cultivo con presencia endmica de TSV, las preva-
lencias fuctan de 0 al 100%, encontrndose ocasionalmente
en L. vannamei silvestres. Segn Brock et al. (1997), no existen
evidencias que este virus halla impactado a las poblaciones na-
turales, al parecer se presenta como una enfermedad subclnica
en las poblaciones de langostinos silvestres.
Se conoce que los patgenos que se encuentran en muy bajas
prevalencias en organismos silvestres, por lo general sin causar
enfermedad clnica, pueden dar lugar a altos niveles de preva-
lencia y mortalidad en organismos en cultivo, debido al elevado
nivel de estrs producto de las altas densidades de poblacin y
otros factores fsicos y qumicos que alteran la calidad del agua
de cultivo (Raynard et al. 2007).
La presencia de brotes de infeccin de los patgenos WSV,
BP, NHPB e IHHNV en langostinos peneidos de diferentes
canales de marea de Tumbes con prevalencias mayores a las de
aos anteriores, indican un riesgo latente de transmisin de estos
patgenos hacia los cultivos de langostinos y tambin de cierta
forma afectar a las poblaciones de las especies ms susceptibles
de peneidos silvestres de las zonas del manglar, las cuales deben
ser protegidas por razones econmicas y ecolgicas.
Literatura citada
BrockJ.A.1997.Special topic review: Taura syndrome, a disease
important to shrimp farms in the Americas. World J. Mi-
crobiol & Technol. 13: 415-418.
Corbel V., Z. Zuprizal, C. Shi, et al. 2001. Experimental infection
of European crustaceans with white spot syndrome virus
(WSSV). J. Fish. Dis. 24 (7): 377-382.
Chakraborty A., S. Otta, B. Joseph, et al. 2002. Prevalence of white
spot syndrome virus in wild crustaceans along the coast
ofIndia.CurrentScience.82:1392-1397pp.
Fajer E., Y. Noriega, D. Menndez, T. Fras. 1998. Prevalencia
de Baculovirus penaei PsSOV Bonami (antes BP) en
camaronespeneidoscubanossilvestres.Vet.Mx.29(2):
209-211pp.
GustincichS,ManfolettG,DelSalG,SchneiderC,CarniciP.1991.
A fast method for high quality genomic DNA extraction
fromwholehumanblood.Biotechniques.11(3):298-302.
LienT,HsiungH,HuangC,SongY.2002.Genomic similarity of
Taura syndrome virus (TSV) between Taiwan and Western
Hemisphere isolates. Fish Pathology. 37(2): 71-75 pp.
LightnerD.V.1996.Ahandbookofshrimppathologyanddiagnos-
tic procedures for diseases of cultured penaeid shrimp.
World Aquaculture Society. Baton Rouge. Louisiana.
USA. 304 pp.
Lo C.F., C.H. Ho, S.E. Peng, C.H. Chen, et al. 1996.White spot
syndrome baculovirus (WSBV) detected in cultured and
captured shrimp, crabs and other arthropods. Dis. Aquat.
Org. 27: 215-225.
LoyJ.K., P.F. Frelier, P.Varner, J.W.Templeton.1996. Detection
of the etiologic agent of necrotizing hepatopancreatitis
in cultured Penaeus vannamei from Texas and Peru by
polymerase chain reaction. Diseases of Aquatic Organ-
isms. 25: 117-122.
Morales V. & J. Cuellar-Anjel. 2008. Gua tcnica - Patologa e
inmunologadecamaronespeneidos.ProgramaCYTEC
Red II-D Vannamei. Panam. 270 pp.
NakanoH.,H.Koube,S.UmezawaS,F.Momoyama,etal.1994.
Mass mortality of cultured Kuruma shrimp, Penaeus
japonicus,inJapanin1993:epizootiologicalsurveyand
infectiontrials.FishPathol29:135-139.
OIE. 2006. (en lnea) Manual de pruebas de diagnstico para los
animales acuticos. <http://www.oie.int/esp/normes/
fmanual/e_SUMMRY.HTM>
PengS.E.,C.F.Lo,C.H.Ho,etal.1998.Detection of white spot
baculovirus (WSBV) in giant freshwater prawn, Machro-
brachium rosenbergii, using polymerase chain reaction.
Aquaculture. 164: 253-262.
RajendranK.V.,K.K.VijayanK,T.C.Santiago,R.M.Krol.1999.
Experimental host range and histopathology of white spot
syndrome virus (WSSV) infection in shrimp, prawns,
crabs and lobsters from India. Journal of Fish Diseases.
22:183-191.
Raynard R., T. Wahli, I. Vatsos & S. Mortensen (Eds.) 2007. Review
of disease interactions and pathogen exchange between
farmed and wild fnfsh and shellfsh in Europe. VESO
projectnumber:1655.VESO,Oslo,Norway.459pp.
Snchez-MartnezJ.G.,G.Aguirre-Guzmn&H.Meja-Ruz.2007.
White Spot Syndrome Virus in cultured shrimp: A review.
AquacultureResearch38(13):1339-1354.
Wang Y.C., C.F. Lo, P.S. Chang, G.H. Kou. 1998. Experimental
infection of white spot baculovirus in some cultured and
wild decapods in Taiwan. Aquaculture 164: 221-231.
365

Identificacin y actividad de la venombina A del veneno de bothroPs atrox
Rev. peru. biol. 17(3): 365 - 370 (December 2010)
Rev. peru. biol. 17(3): 365 - 370 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Identifcacin molecular y actividad sobre sustratos cromognicos
de la venombina A del veneno de la serpiente peruana Bothrops atrox
Gustavo A. Sandoval
1
, Fanny Lazo
1
, Edith Rodriguez
1
, Armando Yarlequ
1
* y
Russolina B. Zingali
2
Molecular identifcation and activity upon chromogenic substrates of a
venombin A from Bothrops atrox Peruvian snake venom
*corresponding author
1 Laboratorio de Biologa Mole-
cular, Facultad de Ciencias Bio-
lgicas, Universidad Nacional
Mayor de San Marcos. Ciudad
Universitaria, Av. Venezuela Cdra.
34 s/n. Apartado 110058, Lima 11,
Per. Email Armando Yarlequ:
ayarleque48@gmail.com
2 Laboratorio de Hemostasia y
Venenos. Departamento de Bioqu-
mica Mdica. Universidad Federal
de Rio de Janeiro. Rio de Janeiro
Brazil.
Presentado: 01/11/2009
Aceptado: 15/12/2010
Publicado online: 00/11/2010
Resumen
En el presente trabajo se ha realizado la identifcacin molecular de la enzima similar a trombina (EST) del
veneno de Bothrops atrox y se ha evaluado su actividad enzimtica sobre diversos sustratos sintticos. La
enzima fue purifcada utilizando tres pasos cromatrogrfcos, sobre Sephadex G-75, CM-Sephadex C-50 y
Agarosa-PAB, determinndose su peso molecular por PAGE-SDS. La identifcacin molecular de la enzima
aislada se realiz por la tcnica de peptide mass fngerprinting basada en espectrometra de masas MALDI-TOF
y posterior anlisis in silico. Las actividades fbrinocoagulante y amidoltica fueron ensayadas sobre fbrin-
geno bovino y BApNA, respectivamente, as como la hidrlisis sobre los sustratos cromognicos especfcos
S-2238, S-2251 y S-2266. Como resultado de los ensayos bioqumicos y estructurales, la EST del veneno
de B. atrox, present un peso molecular de 29,6 kDa. El anlisis mediante espectrometra de masas de los
pptidos obtenidos, permiti identifcar a esta enzima como una venombina A, presentando una identidad del
75%. Del anlisis de actividad enzimtica, se obtuvo que la EST de B. atrox produjo coagulacin del fbringeno
bovino y present actividad sobre BApNA, S-2238 y S-2266, siendo incapaz de hidrolizar el sustrato S-2251.
El empleo de estas aproximaciones estructurales y funcionales ha permitido lograr la identifcacin molecular
del principal componente del veneno de B. atrox relacionado con su accin coagulante, as como evaluar en
detalle la naturaleza de su actividad enzimtica sobre diversos sustratos.
Palabras claves: Bothrops atrox, enzima similar a trombina, MALDI-TOF, sustratos cromognicos.
Abstract
In this work, the thrombin-like enzyme (TLE) from Bothrops atrox has been identifed by mass spectrometry and
its enzymatic activity evaluated upon several synthetic substrates. The enzyme was purifed to homogeneity using
three chromatography steps on Sephadex G-75, CM-Sephadex C-50 and Agarose-PAB. Also, molecular weight
by PAGE-SDS was determined. For molecular identifcation of this enzyme, mass spectrometry-based peptide
mass fngerprinting was used and later in silico analysis. Enzymatic activities were determined using bovine
fbrinogen, BApNA and also upon specifc chromogenic substrates such as S-2238, S-2251 y S-2266. As a result
of these biochemical and structural procedures, we obtained a TLE from B. atrox venom with a molecular weight
of 29,6 kDa. Mass spectrometry analysis of obtained peptides, allow us to identify this enzyme as a venombin A,
showing a 75% sequence homology. After recording enzymatic activity, this TLE showed coagulant activity on
bovine fbrinogen and upon BApNA, S-2238 y S-2266, being unable to hydrolyze S-2251 substrate. Using this
combination of structural and functional approaches, we have identifed the main component of B. atrox venom
related to its coagulant activity, as well as a detailed evaluation of its enzymatic activity upon several substrates.
Keywords: Bothrops atrox, Thrombin-like enzyme MALDI-TOF, chromogenic substrates.
Introduccin
Las serpientes del gnero Bothrops habitan una extensa regin
de Amrica y en el Per se presentan hasta 17 especies, siendo
el Jergn, Bothrops atrox (Linnaeus, 1758), la ms abundante,
peligrosa y causante del 90% de los accidentes ofdicos en el
Per (Loja et al. 2000, Yarlequ 2000). Como consecuencia
de la mordedura se presenta dolor intenso en la zona afectada,
edema, hemorragia y un severo descenso de la presin arterial
que ocasiona la muerte; en otros casos una masiva necrosis
que lleva a la amputacin del miembro afectado (Lvano &
Fernndez 2004).
Estudios previos del veneno de B. atrox han determinado
actividades estersica, fbrinoltica y kininogensica, las cuales
se encuentran relacionadas con la marcada accin del veneno
sobre la coagulacin sangunea (Loayza et al. 1985). Entre las
enzimas relacionadas con esta accin se encuentran las similares a
trombina (ESTs), las cuales de igual forma que la trombina, pro-
ducen cogulos que bloquean la circulacin sangunea aunque
su mecanismo de accin sea diferente, ya que preferentemente
liberan slo fbrinopptidos A o B, mientras que la trombina
produce la liberacin de ambos fbrinopptidos de la molcula
del fbringeno, es decir, los fbrinopptidos A y B (Braud et
al. 2000; Lu et al. 2005). Esta enzima ha sido detectada en
varios venenos botrpicos includo B. atrox utilizando como
sustratos plasma bovino como tambin fbringeno bovino y
canino (Orejuela et al. 1991). En un estudio previo, Sandoval
et al. (2010), lograron purifcar la EST de B. atrox e identifcar
algunas propiedades bioqumicas como el peso molecular y
el contenido de azcares, as como su accin sobre steres de
arginina como el BAEE.
Para el estudio de las propiedades estructurales y funcionales
de las enzimas presentes en los venenos de serpiente se han usado
diferentes aproximaciones siendo la ms comn la obtencin de
la secuencia de aminocidos, as como la accin enzimtica sobre
sustratos naturales, las cuales tienen como desventaja el empleo
de una gran cantidad de muestra para los respectivos anlisis
(Smolka et al. 1998). En este aspecto, el empleo alternativo
de tcnicas microanalticas como la espectrometra de masas
MALDI-TOF (matriz-assisted laser desortion/ionization - time-of-
fight mass spectrometry) permiten la identifcacin de protenas a
travs de la interpretacin de los espectros de fragmentacin de
los pptidos generados a partir de su protelisis (habitualmente
366
Sandoval et al.
Rev. peru. biol. 17(3): 365 - 370 (Diciembre 2010)
con tripsina). Estos espectros son comparados con una base de
datos de protenas digeridas in silico y analizados con softwares
especfcos (ProFound, Mascot, etc.) (Ashcroft 2003). A su
vez, el empleo de sustratos cromognicos que imiten los sitios
de corte de las enzimas sobre los sustratos originales permite
lograr una mayor profundidad en el estudio del reconocimiento
enzima-sustrato, importante en el diseo posterior de inhibidores
sintticos para estas protenas (Castro et al. 2001).
En este contexto, en el presente trabajo se describe la identi-
fcacin molecular de la enzima similar a trombina del veneno
de B. atrox mediante espectrometra de masas MALDI-TOF,
as como su actividad diferencial sobre diversos sustratos cro-
mognicos.
Materiales y mtodos
Material Biolgico.- Se utiliz el veneno de ejemplares adul-
tos de Bothrops atrox procedentes de Pucallpa (Ucayali, Per) y
mantenidos en cautiverio en el serpentario Oswaldo Meneses del
Museo de Historia Natural de la Universidad Nacional Mayor
de San Marcos. El veneno fue extrado por presin manual de
las glndulas venenosas, siendo luego lioflizado y conservado a
4 C hasta su utilizacin en las pruebas experimentales corres-
pondientes.
Cuantifcacin de protenas.- La cantidad de protena fue
calculada midiendo la absorbancia de luz UV a 280 nm (War-
burg & Christian 1941) en un espectrofotmetro Shimadzu UV
120-02. Adems se emple el mtodo de Lowry et al. (1951)
modifcado (Loayza et al. 1985) utilizando un fotocolormetro
y albmina srica bovina como protena estndar.
Purifcacin de la enzima similar a trombina.- Para la
purifcacin de la EST del veneno de B. atrox se emple la
metodologa segn Sandoval et al. (2010). Se utiliz 200 mg
de veneno crudo disuelto en bufer acetato de amonio 0,05 M,
pH 6,0; el cual fue separado mediante fltracin molecular en
Sephadex G-75 (45,2 x 1,2 cm), luego por intercambio cati-
nico en CM Sephadex C-50 (35 x 1,2 cm) y fnalmente usando
cromatografa de afnidad en Agarosa-PAB (6 x 0,8 cm). Para el
monitoreo de la purifcacin se emple la actividad enzimtica
sobre BApNA, y las fracciones con mayor actividad fueron
concentradas y mantenidas en congelacin hasta su uso.
Evaluacin de la pureza y determinacin del peso mole-
cular.- Se emple la electroforesis en geles de poliacrilamida en
condiciones denaturantes con SDS (PAGE-SDS), de acuerdo al
mtodo de Laemmli (1970), utilizando un equipo de electrofo-
resis vertical en placa Mini-PROTEAN 3. La corrida electrofo-
rtica se realiz aplicando 100 V constantes durante 1 h. Luego
de transcurrido el tiempo, el gel fue transferido a una solucin
colorante de azul brillante de Coomassie al 0,1% por 10 min,
para luego ser desteido hasta evidenciar las bandas proteicas.
El peso molecular de la enzima purifcada fue estimado por
comparacin con una mezcla de protenas para electroforesis
en gel (Amersham Biosciences), conteniendo: fosforilasa b (97
kDa), albmina srica bovina (66 kDa), ovalbumina (45 kDa),
anhidrasa carbnica (30 kDa) e inhibidor de tripsina (20,1 kDa).
Digestin in gel e identifcacin molecular mediante es-
pectrometra de masas MALDI-TOF.- Luego de realizada la
electroforesis en geles de poliacrilamida, la banda correspondien-
te a la enzima similar a trombina fue escindida y rehidratada con
acetonitrilo 50% en bicarbonato de amonio 25 mM. La protena
fue reducida con ditiotreitiol (DTT) 10 mM en bicarbonato de
amonio 25 mM a 57 C durante 1 h, y S-carbamidometilada
con iodoacetamida 55 mM en bicarbonato de amonio 25 mM
a temperatura ambiente durante 1 h.
La digestin in gel fue llevada a cabo con tripsina 12,5 ng/
L a 37 C durante 15 h. Posteriormente, se mezclaron 0,5 L
de los fragmentos peptdicos con 0,5 L de cido -ciano-4-
Figura 1. Sustratos sintticos empleados para la caracterizacin de
la EST de Bothrops atrox.
NO
2
NH
HN
O
HCl O
HN
HN
NH
2
N-Benzoil-DL-arginina p-nitroanilida (BApNA)
O
O
O
NO
2
HCl H
2
N
CH
3
CH
3
H
3
C
H
3
C
HCl H
2
N
HN
NH
H
N
H
N
N
H
H
H H
H-D-valina-leucina-arginina p-nitroanilida (S-2266)
HCl H
2
N
HCl H
2
N
H
N
H
N
O
O
NO
2
NH
HN
H
H
O
N
H-D-fenil-pipecolil-arginina p-nitroanilida (S-2238)
HCl NH
2
NO
2
H
N
O
O
HCl H
2
N
CH
3
CH
3
H
3
C
H
3
C
H
N
N
H
H
H H
O
H-D-valina-leucina-lisina p-nitroanilida (S-2251)
H
367

Identificacin y actividad de la venombina A del veneno de bothroPs atrox
Rev. peru. biol. 17(3): 365 - 370 (December 2010)
hidroxicinmico en acetonitrilo 50% / TFA 1% (10 mg/mL)
y luego fueron aplicados a un espectrmetro de masas Applied
Biosystems 4700 Proteomics Analyzer, ABI, para su anlisis
mediante espectrometra de masas MALDI-TOF utilizando un
rango de deteccin de 500 a 4500 Da. Mediante esta tcnica
se realiza la ionizacin de las molculas y su obtencin en fase
gaseosa (desorcin/ionizacin asistida por matriz, MALDI), para
luego ser acelerados hacia un analizador y separados en funcin
de su relacin masa/carga (m/z) y determinando el tiempo de
llegada a un detector (tiempo de vuelo, TOF).
Los pmfs (peptide mass fngerprints) recuperados del procedi-
miento anterior fueron grafcados utilizando el programa Data
Explorer Versin 4,4 (Applied Biosystems) y analizados emplean-
do el programa on line MASCOT (http://www.matrixscience.
com) (Perkins et al. 1999) siendo contrastados contra la base de
datos de secuencias de protenas para espectrometra de masas
(MSDB). Mediante este anlisis, los picos correspondientes a los
pmfs son combinados in silico con los de protenas conocidas per-
mitiendo la identifcacin de la protena digerida inicialmente.
Actividad Fibrinocoagulante.- Esta actividad se evalu por
la medida del tiempo de formacin del cogulo originado por la
accin de la enzima sobre el fbringeno bovino (Sigma-Aldrich
Chemical Co) (Devi et al. 1972). Una unidad de actividad (U) se
defne como la inversa del tiempo de coagulacin en segundos.
Actividad sobre Sustratos Cromognicos.- En primer lugar
se midi la actividad amidoltica empleando BApNA (Sigma-
Aldrich Chemical Co) como sustrato (Fig. 1), midindose la
liberacin de p-nitroanilida a 405 nm (Erlanger et al. 1961).
Una unidad de actividad (U) es expresada como moles de p-
nitroanilida liberados por minuto.
Posteriormente se emplearon los siguientes sustratos: S-2238
(H-D-fenilalanil-L-pipecolil-L-arginina-p-nitroanilida, sustrato
cromognico para trombina), S-2251 (H-D-valil-leucil-lisina-
p-nitroanilida, sustrato cromognico para plasmina) y S-2266
(H-D-valil-leucil-arginina-p-nitroanilida, sustrato cromogni-
co para kalikrena glandular) provenientes de Chromogenix
(Mlndal, Suecia), disueltos en bufer Tris-HCl 0,05 M; pH 7,5
conteniendo NaCl 0,15 M, a una concentracin fnal de 0,1 mM
(Fig. 1). La hidrlisis de los sustratos sintticos por el veneno
crudo y por la enzima purifcada fue medida en una lectora de
microplacas Termomax (Molecular Devices, Menlo Park, CA,
USA), siguiendo la absorbancia a 405 nm a 37 C durante 20
min a intervalos de 10 segundos.
Resultados
Purifcacin de la enzima y estimacin del peso molecu-
lar.- Siguiendo los pasos descritos por Sandoval et al. (2010) se
pudo obtener la enzima similar a trombina de B. atrox al estado
homogneo, la cual fue monitoreada por su actividad sobre el
sustrato sinttico BApNA. El ensayo electrofortico en PAGE-
SDS mostr que la enzima purifcada corresponde a una nica
banda homognea con un peso molecular aproximado de 29,6
kDa (Fig. 2).
Identifcacin de la enzima purifcada mediante espectro-
metra de masas MALDI-TOF.- Del anlisis por espectrometra
de masas MALDI-TOF, se pudieron recuperar 16 fragmentos
peptdicos producto de la digestin de la enzima purifcada, con
valores de masas comprendidos entre los 500 y 4500 Da (Tabla
1). Estos valores obtenidos fueron utilizados para la identifca-
97 kDa
66 kDa
45 kDa
30 kDa
20,1 kDa
Figura 2. Electroforesis en gel de poliacrilamida con SDS (PAGE-
SDS) bajo condiciones no reductoras de la enzima similar a trombina
de Bothrops atrox.
Figura 3. Reporte del anlisis in silico por MASCOT de los pptidos
de la EST de Bothrops atrox obtenidos por espectrometra de masas
MALDI-TOF.
Mascot Search Results
User : Gustavo Sandoval
Email : gsandoval@peru.com
Search title : TLE from Bothrops atrox
Database : MSDB 20060831 (3239079 sequences; 1079594700
residues)
Timestamp : 27 Dec 2010 at 01:39:08 GMT
Top Score : 125 for A28169, venombin A (EC 3.4.21.74) precursor
- barba amarilla
Mascot Score Histogram

-
Protein score is 10*Log(P), where P is the probability that the
observed match is a random event.

Protein scores greater than 78 are significant (p<0.05).

1. A28169 Mass: 28854 Score: 125 Expect: 1e-06
Matches: 14
venombin A (EC 3.4.21.74) precursor - barba amarilla
MATRIX
SCIENCE
{
}
N
u
m
b
e
r

o
f

h
i
t
s
Protein score
15
10
5
0
50 75 100 125
368
Sandoval et al.
Rev. peru. biol. 17(3): 365 - 370 (Diciembre 2010)
cin de la protena mediante el programa MASCOT (opcin:
peptide mass fngerprinting). Como resultado del anlisis in silico
se obtuvo un score de alineamiento de 125 (expect: 10
-6
) con
la protena denominada venombina A (EC 3.4.21.74) (Fig. 3).
Los pptidos recuperados comprenden un 75% del total de su
secuencia.
Actividad sobre diferentes sustratos.- La EST purifcada
fue capaz de coagular el fbringeno bovino; comparando los
tiempos de coagulacin obtenidos con el veneno crudo y la
enzima purifcada se encontraron actividades especfcas de
1,26 y 5,50 U/mg respectivamente, siendo la actividad de la
enzima purifcada 4,37 veces ms que la actividad del veneno
crudo (Tabla 2).
La enzima purifcada tambin mostr una gran capacidad
para hidrolizar sustratos sintticos como el BApNA (0,874
U/mg), siendo la actividad purifcada 25,5 veces respecto a la
actividad mostrada por el veneno crudo (Tabla 2).
En el caso de las actividades sobre otros sustratos sintticos
especfcos stas fueron de 8,7 y 22,7 U/mg sobre S-2238 para
el veneno crudo y la enzima purifcada respectivamente, y de
7,8 y 23,4 U/mg sobre S-2266 para el veneno crudo y la enzi-
ma purifcada respectivamente. No se encontr actividad sobre
S-2251 bajo las mismas condiciones de trabajo tanto para el
veneno crudo como para la enzima purifcada (Tabla 2).
Discusin
Los venenos de serpientes de la familia Viperidae, presentan
cantidades signifcativas de enzimas similares a trombina, las
cuales son serinoproteasas y son similares a la trombina tanto en
sus propiedades fsicoqumicas como en los aminocidos de su
sitio activo, ya que contienen residuos reactivos de serina, cido
asprtico e histidina, hacindolos susceptibles a agentes espec-
fcos que modifcan su accin enzimtica (Braud et al. 2000).
En el presente trabajo la purifcacin de la enzima similar a
trombina (EST) del veneno de B. atrox consisti de una com-
binacin de tcnicas cromatogrfcas de fltracin molecular, las
que permiten separar las molculas segn su peso molecular;
intercambio inico, donde las molculas son discriminadas de
acuerdo a su carga elctrica; y fnalmente mediante afnidad
enzima-inhibidor, utilizando p-aminobenzamidina (PAB). Esta
molcula es un inhibidor competitivo especfco de serinopro-
teasas, mediante la cual se pueden retener a las fracciones con
afnidad permitiendo la eliminacin de contaminantes. Del
anlisis electrofortico de las fracciones obtenidas se observ una
sola banda proteica de 29,6 kDa, indicando la homogeneidad
del preparado (Fig. 2). Esta enzima tiene un mediano peso mo-
lecular, pero se encuentra dentro del rango de pesos moleculares
reportados para varias enzimas similares a trombina aisladas de
venenos de serpiente (Sandoval et al. 2010).
Sustrato pH
Actividad Especfca (U/mg protena)
Incremento de la actividad
Veneno crudo Enzima
Fibringeno bovino 7,4 1,26 5,50 4,4
BApNA 8,1 0,034 0,874 25,5
S-2266 7,5 7,8 23,4 3,0
S-2238 7,5 8,7 22,7 2,6
S-2251 7,5 0,0 0,0 0,0
Tabla 2. Actividad del veneno crudo y de la EST de Bothrops atrox sobre diferentes sustratos.
Secuencia Posicin Masa terica (Da) Masa experimental (Da)
R.YFCGMTLINQEWVLTAAHCNR.R 48-68 2583,1821 2584,1893
R.IHLGK.H 73-77 566,3540 567,3613
K.HAGSVANYDEVVR.Y 78-90 1415,6793 1416,6866
K.FICPNK.K 96-101 777,3843 778,3916
K.NVITDK.D 104-109 688,3755 689,3828
K.DIMLIR.L 110-115 759,4313 760,4385
K.DIMLIR.L Oxidation (M) 110-115 775,4262 776,4335
R.LDRPVK.N 116-121 726,4388 727,4461
K.NSEHIAPLSLPSNPPSVGSVCR.I 122-143 2317,1485 2318,1557
R.IMGWGAITTSEDTYPDVPHCANINLFNNTVCR.E 144-175 3665,6701 3666,6773
R.EAYNGLPAK.T 176-184 961,4869 962,4941
K.TLCAGVLQGGIDTCGGDSGGPLICNGQFQGILSWGSDPCAEPR.K 185-227 477,0196 4478,0267
R.KPAFYTK.V 228-234 853,4698 854,4470
K.VFDYLPWIQSIIAGNK.T 235-250 1862,9931 1864,0003
Tabla 1. Masas tericas y experimentales de los pptidos de la EST de Bothrops atrox obtenidas por espectrometra de masas MALDI-TOF.
La masa experimental fue calculada en base a la masa de los pptidos monoisotpicos, asumiendo su valor como [M+H]
+
.
369

Identificacin y actividad de la venombina A del veneno de bothroPs atrox
Rev. peru. biol. 17(3): 365 - 370 (December 2010)
Para la identifcacin molecular de la enzima purifcada se
emple el anlisis por espectrometra de masas MALDI-TOF;
que permite obtener informacin de la masa molecular e infor-
macin estructural del compuesto analizado.
Del anlisis por espectrometra de masas de las bandas de gel
correspondientes a la EST de B. atrox y la posterior bsqueda
en bases de datos, se obtuvo un score de alineamiento de 125
(expect: 10
-6
) con la venombina A (EC 3.4.21.74), EST del
veneno de B. moojeni (Fig. 3). Esta protena, a diferencia de la
trombina, convierte el fbringeno en fbrina liberando slo el
fbrinopptido A (Itoh et al. 1988). Esta caracterstica le confere
un efecto defbrinogenante permitiendo que la fbrina sea rpi-
damente degradada a travs del proceso fbrinoltico y eliminado
mediante la orina (Lu et al. 2005). Actualmente es usado en el
campo clnico para el tratamiento de enfermedades trombticas .
Este anlisis nos permiti adems, ubicar y alinear los frag-
mentos producto de la digestin de la enzima en estudio. Los
fragmentos recuperados cubrieron un 75% de la secuencia
de la venombina A indicando una alta homologa entre las
secuencias de ambas protenas. La venombina A es la enzima
similar a trombina del veneno de B. moojeni y su secuencia de
aminocidos exhibe una homologa signifcativa con enzimas
proteolticas como la tripsina, la kalikreina pancretica y la
trombina, lo cual indica que se trata de un miembro de la familia
de las serinoproteasas (Itoh et al. 1998).
A fn de complementar los resultados estructurales obtenidos
por espectrometra de masas MALDI-TOF, se evalu la activi-
dad enzimtica de la EST purifcada sobre un sustrato natural
como el fbringeno, as como sobre sustratos cromognicos,
los cuales contienen residuos de aminocidos que imitan los
sitios de corte de la enzima sobre el sustrato original. A fn de
facilitar la medicin de la actividad, dichos sustratos presentan
un grupo cromognico en el extremo carboxilo terminal, el cual
es liberado como parte de la hidrlisis y posteriormente detectado
por espectrofotometra.
En el presente trabajo se evalu la actividad enzimtica de la
EST de B. atrox sobre diversos sustratos sintticos que contienen
como grupo cromognico a la p-nitroanilida (Fig. 1). Durante
los diversos pasos de purifcacin se emple el sustrato BApNA
el cual permite la caracterizacin de enzimas del grupo de las
serinoproteasas como la tripsina y quimiotripsina y al cual per-
tenecen las enzimas similares a trombina de venenos de serpiente
(Castro et al. 2001, 2004). Las fracciones que mostraron ms
actividad sobre este sustrato fueron ensayadas en su capacidad
para coagular el fbringeno bovino obtenindose resultados
positivos indicando que ambas actividades estn presentes en la
enzima en estudio. En el caso de los sustratos sintticos S-2266,
S-2238 y S-2251, su empleo nos permiti determinar la especi-
fcidad en reconocimiento de los aminocidos unidos al grupo
cromognico p-nitroanilida por parte de la enzima similar a
trombina de B. atrox. Como se muestra en la Tabla 2, la enzima
fue capaz de hidrolizar los sustratos S-2266 (sustrato para ka-
likrena glandular) y S-2238 (sustrato para trombina), mientras
que fue incapaz de hidrolizar el sustrato S-2251 (sustrato para
plasmina). En base a las caractersticas estructurales de estos
sustratos podemos afrmar que la enzima presenta una especif-
cidad para hidrolizar sustratos que contengan preferentemente
arginina como el aminocido que se une al grupo cromognico
a diferencia de la lisina la cual se encuentra en la estructura del
S-2251, lo cual constituye una evidencia adicional de que esta
enzima pertenece al grupo de las serinoproteinasas. Este anlisis
tambin fue realizado utilizando la enzima similar a trombina
de Lachesis muta muta empleando sustratos cromognicos con
aminocidos diversos en su estructura (Magalhaes et al. 2003). El
hecho de que la enzima purifcada hidrolice sustratos especfcos
para dos enzimas diferentes como la kalikreina y la trombina
indican por un lado que nuestra enzima presenta caractersticas
de la trombina como la de coagular el fbringeno, mientras que
por otro est relacionada con las enzimas del grupo tripsina/ka-
likrena. Esto fue demostrado por Itoh et al. (1988) para el caso
de batroxobina, la enzima similar a trombina de la serpiente B.
moojeni mediante el anlisis de la secuencia nucleotdica del gen.
De esta forma, mediante una combinacin de aproximaciones
estructurales y funcionales se ha podido caracterizar la naturaleza
qumica y enzimtica de la EST de B. atrox, identifcndola
como una venombina A, serinoproteasa con un rol importante
en el envenenamiento por viperdos del gnero Bothrops y cuya
deteccin y neutralizacin resultan de inters para el diagnstico
y tratamiento de accidentes ofdicos.
Agradecimientos
El presente trabajo fue desarrollado gracias al fnanciamiento
otorgado a Gustavo Sandoval por la Red de Macrouniversidades
de Amrica Latina y el Caribe a travs de una beca de investi-
gacin en la Universidad Federal de Rio de Janeiro como parte
del desarrollo de su tesis de maestra en Biologa Molecular.
Literatura citada
Ashcroft A.E. 2003. Protein and peptide identifcation: the role
of mass spectrometry in proteomics. Nat. Prod. Rep.
20(2):202-215.
Braud S., C. Bon C & A. Wisner. 2000. Snake venom proteins acting
onhemostasis.Biochimie.82(9-10):851-859.
Castro H.C., D.M. Silva, C. Craik C, et al. 2001. Structural features
of a snake venom thrombin-like enzyme: thrombin and
trypsin on a single catalytic platform? Biochim Biophys
Acta.1547(2):183-195.
Castro H.C., R.B. Zingali, M.G. Albuquerque, et al. 2004. Snake
venom thrombin-like enzymes: from reptilase to now. Cell
Mol Life Sci. 61(7-8):843-856.
DeviA.,S.Banerjee&A.L.Copley.1972.Coagulantandesterase
activities of thrombin and Bothrops atrox venom. Toxicon.
10(6):563-573.
ErlangerB.F.,N.Kokowsky&W.Cohen.1961.Thepreparationand
properties of two new chromogenic substrates of trypsin.
ArchBiochemBiophys.95:271-278.
ItohN.,N.Tanaka,I.Funakoshi,etal.1988.Organizationofthe
gene for batroxobin, a thrombin-like snake venom enzyme.
Homology with the trypsin/kallikrein gene family. J Biol
Chem. 263(16):7628-7631.
Laemmli UK. 1970. Cleavage of structural proteins during the
assembly of the head of bacteriophage T4. Nature.
227(5259):680-685.
Lvano J. & R. Fernndez. 2004. Diagnstico y tratamiento de los
accidentes por animales ponzoosos. Instituto Nacional
deSalud,MinisteriodeSalud,Lima,Per.1eraedicin.
74 Pp.
LoayzaS.,Y.Morante,S.Campos,etal.1985.Enzimasproteolticas
en el veneno de las serpientes peruanas Lachesis muta y
Bothropsatrox.BolSocQuimPer.52(3):151-163.
LojaD.,R.Avils,Y.Necochea,etal.2000.OfdismoporBothrops
atrox: Estudio clnico-epidemiolgico. Diagnstico.
38(5):261-265.
370
Sandoval et al.
Rev. peru. biol. 17(3): 365 - 370 (Diciembre 2010)
LowryO.H.,N.J.Rosebrough,A.L.Farr,etal.1951.Proteinmea-
surement with the Folin phenol reagent. J Biol Chem.
193(1):265-275.
Lu Q., J.M. Clemetson & K.J. Clemetson. 2005. Snake venoms and
hemostasis.JThrombHaemost.3(8):1791-1799.
Magalhaes A., R.N. Ferreira, M. Richardson, et al. 2003. Coagulant
thrombin-like enzymes from the venoms of Brazilian and
Peruvian bushmaster (Lachesis muta muta) snakes. Comp
Biochem Physiol B Biochem Mol Biol. 136(2):255-266.
OrejuelaP.,A.Zavaleta,M.Salas,etal.1991.Thrombin-likeactivity
in snake venoms from Peruvian Bothrops and Lachesis
genera.Toxicon.29(2):1151-1154.
Perkins D.N., D.J. Pappin, D.M. Creasy, et al. 1999. Probability-
based protein identifcation by searching sequence da-
tabases using mass spectrometry data. Electrophoresis.
20(18):3551-3567.
SandovalG.,L.Lerma,E.Rodrguez,etal.2006.Purifcationof
polyclonal antibodies against Bothrops atrox Peruvian
snakevenom(Jergon)byaffnitychromatography.Rev
SocQuimPer.72(3):140-149.
Sandoval G.A., N. Ruiz, F. Lazo, et al. 2010. Isolation and partial
characterization of a thrombin-like enzyme from Bothrops
atrox Peruvian snake venom Jergon. Rev Soc Quim
Per.76(2):156-164.
SmolkaM.B.,S.Marangoni,B.Oliveira,etal.1988.Purifcation
and partial characterization of a thrombin-like enzyme,
balterobin, from the venom of Bothrops alternatus. Toxi-
con.36(7):1059-1063.
Warburg O. & W. Christian. 1941. Isolierung and Kristallisation
der Garungs ferments enolase. Biochem Z. 310: 384-421.
YarlequA. 2000. Las serpientes peruanas y sus venenos. Fondo
Editorial, Universidad Nacional Mayor de San Marcos.
Lima-Per.78Pp.
371

Toxicidad aguda y crnica del lindano
Rev. peru. biol. 17(3): 371 - 376 (December 2010)
Rev. peru. biol. 17(3): 371 - 376 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Toxicidad aguda y crnica del lindano sobre Ceriodaphnia cornuta
(Cladocera: Daphniidae)
Jorgelina Jurez y Alcira Villagra de Gamundi
Acute and chronic toxicity of lindane on Ceriodaphnia cornuta (Cladocera:
Daphniidae)
Instituto de Limnologa (ILINOA),
Facultad de Ciencias Naturales e
Instituto Miguel Lillo, Universidad
Nacional de Tucuman, Argentina.
E- ma i l J o r g e l i n a J u r e z :
jorgelina_j@yahoo.com
NOTA CIENTFICA
Presentado: 18/08/2009
Aceptado: 23/07/2010
Publicado online: 00/11/2010
Resumen
El lindano es un plaguicida organoclorado cuya toxicidad produce efectos nocivos en la salud humana y la
biota. El objetivo de este estudio fue evaluar la toxicidad aguda y crnica del lindano sobre el microcrustceo
Ceriodaphnia cornuta. Para las pruebas agudas se emple un diseo esttico, usando 10 neonatos 24
horas de edad para el control y para cada concentracin de lindano (5, 10, 15, 20 y 25 mg/L). Se realizaron
tres rplicas de cada tratamiento. Se control la inmovilizacin de los individuos a las 48 hs y se calcularon
los valores de CL
50
. Los bioensayos crnicos consistieron en un diseo semi-esttico, utilizando 10 neonatos
menores de 24 horas de edad (uno por recipiente) para el control y para cada concentracin subletal del txico
(0,1; 0,15; 0,2; 0,25 y 0,3 mg/L). Se evaluaron los efectos sobre la supervivencia y reproduccin durante 21
das. El valor obtenido de CL
50
48 horas fue de 5,293 0,7 mg/L. Los parmetros reproductivos (neonatos por
hembra, tamao de la camada e ndice de incremento natural) disminuyeron al aumentar la concentracin del
txico evaluado, mientras que el inicio de la madurez sexual se retras, demostrando la sensibilidad de los
organismos prueba al lindano.
Palabras claves: Toxicidad aguda, Toxicidad crnica, Lindano, Ceriodaphnia cornuta
Abstract
Lindane is an organochlorine pesticide toxicity which produces harmful effects on human health and biota. The
aim of this study was to evaluate the acute and chronic toxicity of Lindane on microcrustaceans Ceriodaphnia
cornuta. For acute tests used a static design, using 10 infants 24 hours of age for control and each concen-
tration of lindane (5, 10, 15, 20 and 25 mg/L). There were three replicates of each treatment. Monitored the
detention of individuals at 48 am and calculated LC50 values. Chronic Bioassays consisted of a semi-static
design, using 10 infants 24 hours of age (one per vessel) for the control and each of the toxic sublethal
concentration (0.1, 0.15, 0.2, 0.25 and 0.3 mg/L). The effects on survival and reproduction over 21 days. The
LC
50
value of 48 hours was 5.293 0.7 mg/L. Reproductive parameters (neonates per female, litter size and
rate of natural increase) decreased with increasing concentration of toxic evaluated, while the onset of sexual
maturity is delayed, thus demonstrating the sensitivity of test organisms to lindane.
Keywords: Acute Toxicity, Chronic Toxicity, Lindane, Ceriodaphnia cornuta.
Introduccin
El lindano (-hexaclorociclohexano) es un plaguicida or-
ganoclorado que produce alteraciones orgnicas, genticas y
reproductivas en la biota; cabe sealar tambin, que su afnidad
con los lpidos permite su bioacumulacin y bioconcentracin
a travs de las cadenas trfcas (valos Gmez et al. 2003). Es
usado principalmente para el control de plagas en vegetales
encontrndose entre los agroqumicos de ms frecuente uso.
Segn la Agencia de Proteccin Ambiental (EPA) se incluye entre
los compuestos de toxicidad moderada clase II. Esta sustancia
est prohibida en numerosos pases como Australia, Austria,
Indonesia, Nueva Zelanda, Holanda, Canad y EE.UU. (INE
2004), por el riesgo ecolgico y efectos adversos que causa en la
fauna terrestre y acutica (Iannacone et al. 2000). En Argentina
el lindano est restringido a distintos usos: a) En Sanidad Animal
(Decreto 2143/68) y ms tarde se prohibi completamente su
uso veterinario (Resolucin 513/98), b) En Sanidad Vegetal
(Disp. 80/71), despus se lo prohibi como gorgojicida (Disp.
47/72) como tambin completamente su uso en vegetales
(Resolucin 513/98) y c) Como Insecticida Domisanitario
(Resolucin 7292/98) (Giorgio et al. 2005). Por esta razn es
importante determinar el nivel de riesgo ambiental del plaguicida
lindano sobre organismos representantes del ecosistema acutico
utilizando bioensayos de toxicidad (Iannacone et al. 2000).
Los cladceros son ampliamente empleados en bioensayos
de toxicidad, debido a importantes caractersticas como: re-
produccin partenogentica, corto tiempo generacional, alta
resistencia a cambios ambientales y como organismo fltrador
poco selectivo (Villarroel Utrillas 2004), que permiten disponer
de abundantes especmenes idnticos en un tiempo relativamente
reducido. En tal sentido los individuos cultivados presentan las
condiciones fsiolgicas ptimas para el desarrollo de la prueba
de toxicidad, adems Ceriodaphnia cornuta es una de las tres
especies de cladceros ms abundantes en los cuerpos de aguas
tropicales, adaptado a tolerar bajas concentraciones de oxgeno
y altas variaciones de temperatura, distribuyndose ampliamente
en diversos humedales (Villalobos et al. 2006), lo que favorece
su uso como organismos prueba.
El objetivo del presente estudio fue evaluar la toxicidad aguda
y crnica del lindano sobre neonatos (<24 horas de edad) del
cladcero Ceriodaphnia cornuta.
Condiciones de laboratorio
Los organismos prueba (Ceriodaphnia cornuta G.O. Sars,
1885) fueron colectados del Embalse Celestino Gelsi Tucumn
y se cultivaron en el laboratorio del Instituto de Limnologa
del Noroeste Argentino perteneciente a la Facultad de Ciencias
Naturales e Instituto Miguel Lillo (Universidad Nacional de
372
Jurez
Rev. peru. biol. 17(3): 371 - 376 (Diciembre 2010)
Tucumn Tucumn Argentina). Se mantuvieron en labo-
ratorio en acuarios de 10 litros de capacidad, bajo condiciones
de laboratorio de temperatura ambiente (25 2 C), con un
fotoperiodo natural de aproximadamente 12 horas luz/oscuri-
dad y un pH constante de 7. La frecuencia de alimentacin fue
de 2 veces por semana con jugo de salvado de avena (1 mL de
concentrado/L de medio) y la de limpieza de mudas y desechos,
semanalmente. Las concentraciones del txico fueron preparadas
a partir de una solucin stock proporcionada por el Instituto de
Evaluacin y Control de contaminantes Ambientales (LECCA)
de la Facultad de Ciencias Exactas y Tecnologa de la Universidad
Nacional de Tucumn.
Diseo de experimento
Las pruebas agudas fueron realizadas de acuerdo con el proto-
colo estndar (ISO 1982), inicindose con neonatos, menores de
24 horas de edad, obtenidos de cultivos en masa y alimentados
con jugo de salvado de avena. Se emple un diseo esttico,
usando 10 individuos para el control y para cada concentracin
de lindano (5, 10, 15, 20 y 25 mg/L). Los recipientes de prueba
consistieron (tres rplicas por cada tratamiento) en tubos de
ensayos de 25 mL que contienen 15 mL de agua de dilucin
(medio de cultivo). (Tabla 1). Se control la inmovilizacin de
los individuos en todos los tratamientos experimentales a las
48 h y se contabilizaron para la determinacin posterior de los
valores de CL
50
(concentracin que produce el 50% de mortali-
dad), mediante el programa estadstico Probit (US EPA 1988).
Para los ensayos crnicos se emple un diseo semi-esttico,
utilizando 10 neonatos de aproximadamente 24 hs de edad
(uno por recipiente) para el control y para cada concentracin
subletal de lindano (0,1; 0,15; 0,2; 0,25 y 0,3 mg/L). Los re-
cipientes experimentales fueron iguales a los utilizados en los
ensayos agudos. Se evaluaron los efectos sobre la supervivencia
y reproduccin durante 21 das (neonatos por hembra, tamao
de la camada, edad de madurez sexual, longevidad e ndice de
incremento natural). (Tabla 2). Los neonatos originados fueron
contados y desechados.
Durante el perodo de monitoreo se mantuvieron las condi-
ciones de laboratorio y los patrones rutinarios de alimentacin
y limpieza establecidos para los cultivos masivos.
Los parmetros demogrfcos se calcularon usando las si-
guientes frmulas:
Tasa reproductiva neta (R
0
)= l
x
m
x
Tiempo generacional (Tg)= l
x
m
x
x/ R
0
Tasa intrnseca de crecimiento natural (r)= ln R
0
/T
Donde:
m
x
= Al nmero de neonatos producidos por hembras sobre-
vivientes a la edad x
l
x
= La proporcin de individuos sobrevivientes a la edad x
x= Das
Los datos se analizaron estadsticamente usando el anlisis de
varianza (ANOVA) para determinar las diferencias signifcativas
entre el control y los distintos tratamientos.
Resultados
En la Tabla 3 y Figura 1 se muestran los porcentajes de mor-
talidad observados de neonatos menores de 24 h de edad de C.
cornuta para cada una de las concentraciones de lindano y los
valores obtenidos de CL
50
a 24 y 48 h de exposicin.
La Tabla 4 muestra los efectos del lindano sobre la reproduccin
y supervivencia de C. cornuta. Se observa un incremento gradual
de la edad a la que los organismos alcanzan la madurez sexual,
valores promedios comprendidos entre 10,2 das para el control
y de 14 das para la mxima concentracin (0,3 mg/L) (Fig. 2).
Factor Condicin
Temperatura 25 2 C
Fotoperodo 12:12 h Luz/oscuridad
Envase prueba 25 mL
Volumen de exposicin 15 mL
Edad de organismos prueba Neonatos ? 24 h
N de rplicas por concentracin 3
N de concentraciones ms control 6 (5, 10, 15, 20 y 25 g/mL)
Organismos por envase 10
Organismos totales por concentracin 30
Alimentacin No requiere
Agua de dilucin Agua natural fltrada
Tiempo de exposicin 48 h
Respuesta letal Mortalidad, sin movilidad
Tabla 1. Condiciones de prueba de toxicidad aguda.
Factor Condicin
Temperatura 25 2 C
Fotoperodo 12:12 h Luz/oscuridad
Envase prueba 25 mL
Volumen de exposicin 15 mL
Edad de organismos prueba Neonatos 24 h
N de rplicas por concentracin 10
N de concentraciones ms control
6 (0,1; 0,15; 0,2; 0,25 y 0,3
g/mL)
Organismos por envase 1
Organismos totales por concentracin 10
Renovacin de solucin test semanalmente
Alimentacin 2 veces por semana
Agua de dilucin Agua natural fltrada
Tiempo de exposicin 21 das
Parmetros
Neonatos por hembra,
tamao de la camada,
madurez sexual,
longevidad e ndice de
incremento natural.
Tabla 2. Condiciones de prueba de toxicidad crnica.
Concentraciones
Lindano (mg/L)
% Mortalidad
48 h de exposicin 24 h de exposicin
Control 40 57
5 63 63
10 73 73
15 83 93
20 97 100
25 100 100
CL
50
4,789 0.6 (mg/L) 5,293 0.7(mg/L)
Tabla 3. Porcentaje de mortalidad y CL
50
a 24 y 48 h de exposicin.
373

Toxicidad aguda y crnica del lindano
Rev. peru. biol. 17(3): 371 - 376 (December 2010)
0
20
40
60
80
100
120
Control 5 10 15 20 25
%

M
o
r
t
a
l
i
d
a
d
Lindano (mg/L)
48 h
Exposicin
24 h
Figura 1. Mortalidad de Ceriodaphnia cornuta a 24 y 48 h de ex-
posicin.
0
2
4
6
8
10
12
14
16
0 0,1 0,15 0,2 0,25 0,3
M
a
d
u
r
e
z

s
e
x
u
a
l

(
D

a
s
)
Lindano (mg/L)
0
10
20
30
40
50
60
0 0,1 0,15 0,2 0,25 0,3
N


n
e
o
n
a
t
o
s
/
2
1

d

a
s
Lindano (mg/L)
Figura 2. Efectos del lindano sobre la madurez sexual de Cerioda-
phnia cornuta.
Figura 3. Produccin de neonatos de Ceriodaphnia cornuta despus
de 21 das de tratamiento con lindano.
0
5
10
15
20
25
L
o
n
g
e
v
i
d
a
d

(
D

a
s
)
0 0,1 0,15 0,2 0,25 0,3
Lindano (mg/L)
Lindano (mg/L)
-16
-14
-12
-10
-8
-6
-4
-2
0
2
0 0,1 0,2 0,3 0.4
r
0
1
2
3
4
5
6
0 0,1 0,2 0,3 0,4
R
0
Lindano (mg/L)
Figura 4. Efectos del lindano sobre la longevidad de Ceriodaphnia
cornuta.
Figura 5. Tasa intrnseca de crecimiento natural (r) de Ceriodaphnia
cornuta expuesta a diferentes concentraciones de lindano.
Figura 6. Tasa reproductiva neta (R
o
) de Ceriodaphnia cornuta ex-
puesta a diferentes concentraciones de lindano.
374
Jurez
Rev. peru. biol. 17(3): 371 - 376 (Diciembre 2010)
Despues de 21 das de prueba, Ceriodaphnia cornuta produjo
un nmero considerablemente menor de neonatos a mayor con-
centracin del toxico, aunque a concentraciones de 0,1 y 0,15
mg/L de lindano dieron el mismo resultado (Fig. 3). As mismo,
la longevidad decrece a medida que aumenta la concentracin del
plaguicida, a excepcin de los grupos experimentales 0,1 y 0,15
g/mL con 13 y 13,8 das de supervivencia respectivamente, (Fig.
4). Los resultados para la tasa intrnseca de crecimiento natural
(r) se muestran en la Figura 5. Se observa una acentuada dismi-
nucin a partir de la concentracin de 0,2 mg/L. Esta disminu-
cin es particularmente considerable a la mxima concentracin
del lindano (0,3 mg/L) con un valor de (r) de -13,97. La tasa
reproductiva neta (Fig. 6) mostr valores decrecientes desde el
control (4,91) a la mxima concentracin (0,02).
El anlisis estadstico de los resultados (ANOVA) puso de
manifesto diferencias signifcativas entre el control y los tra-
tamientos en la edad de la primera reproduccin (p= 0,0048),
produccin de neonatos en 21 das (p= 0,0027) y longevidad (p=
0,0012) y no mostr diferencias signifcativas en los parmetros
(r) tasa intrnseca de crecimiento natural (p= 0,1514) y (Tg)
tiempo generacional (p= 0,7749).
Discusin y conclusiones
Los resultados obtenidos permiten hacer algunas conside-
raciones respecto a la efciencia de C. cornuta como organismo
prueba en bioensayos de toxicidad.
Los ensayos agudos evidenciaron que C. cornuta tiene una
menor sensibilidad al lindano, con un valor de CL
50
48 h (5,293
0,7 mg/L) respecto a otros dfnidos de mayor tamao como
Simocephalus vetulus (11,4 g/L) (Jurez et al. 2007) y Daphnia
magna (460 g/L) (Silva et al. 2001) y (Martin et al. 2007). Tam-
bin es ms tolerante en comparacin con los valores registrados
para Daphnia magna y Daphnia longispina (Antunes et al. 2004)
para lindano con LC
50
48 h que oscilaron entre 1802 y 2843
g/L y 2079 y 3116 g/L respectivamente, a distintos niveles
de alimentacin con algas. Villarroel Utrillas (2004), describi
un valor para el organoclorado Propanil sobre D. magna de
5,02 mg/L, valor comparativamente similar al obtenido en el
presente estudio. El porcentaje de mortalidad a las 24 y 48 h
observ un rango de 40 100% y 57 100% respectivamente
(concentraciones de 0 a 25 mg/L).
La Figura 8 expresa la relaciones integradoras de los parme-
tros demogrfcos estudiados pudindose observar la sensibilidad
Lindano (mg/L)
0 0,1 0,15 0,2 0,25 0,3
Madurez sexual (Das) 10,2 10,3 11,7 12 12,5 14
N neonatos/21 das 54 25 25 6 4 2
N neonatos/da 2,6 1,2 1,2 0,3 0,2 0,1
Neonatos/adulto 5,4 2,5 2,5 0,6 0,4 0,2
Longevidad (Das) 19,8 13 13,8 7,4 7 4
R
0
4,91 1,16 1,43 0,2 0,12 0,02
Tg 13 12 14 11 10 14
r 0,024 0,01 0,018 -0,14 -1,28 -13,97
Tabla 4. Efectos del lindano sobre el ciclo de vida y parmetros demogrfcos de Ceriodaphnia cornuta.
Figura 7. Supervivencia de Ceriodaphnia cornuta expuesta a diferentes concentraciones de lindano.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21
1
0,9
0,8
0,7
0,6
0,5
0,4
0,3
0,2
0,1
0
S
u
p
e
r
v
i
v
e
n
c
i
a
Tiempo (Das)
0 mg/L 0,1 mg/L 0,15 mg/L 0,2 mg/L 0,25 mg/L 0,3 mg/L
375

Toxicidad aguda y crnica del lindano
Rev. peru. biol. 17(3): 371 - 376 (December 2010)
de R
0
y r como tambin la correspondencia a sus cambios de la
longevidad y el tiempo generacional. Los resultados de toxicidad
crnica obtenidos demostraron que a medida que aumenta la
concentracin de lindano, el tiempo que transcurre desde el ini-
cio de la prueba hasta que se produce la primera reproduccin de
los organismos, aumenta gradualmente. Durante los 21 das de
duracin del ensayo, se observ una signifcativa disminucin de
neonatos producidos al incrementar la concentracin del plagui-
cida. En tal sentido, entre el control y la primera concentracin
se registra una disminucin con una produccin del 46% en la
camada. Villarroel Utrillas (2004) observ resultados similares
con los organoclorados Tetradifn y Propanil en D. magna, ms
relevante para el segundo txico. La longevidad media tambin
se redujo de 19,8 a 4 das (control mxima concentracin),
en forma similar a los efectos del insecticida Diazinon (Wong
1997) sobre Moina macrocopa con valores de 5,8 a 1,6 das.
La tasa intrnseca de crecimiento natural (r) result ser un
parmetro muy sensible al txico, ya que si bien existen ante-
cedentes sobre la disminucin de su valor entre el control y la
mxima concentracin, tales como, de 0,22 a 0,17 para D. lon-
gispina y D. magna expuestas por 21 das a 607,5 g/L de lindano
(Antunes et al. 2004); 0,33 a 0,14 en D. magna despus de la
exposicin a 0,55 mg/L del herbicida Propanil (Villarroel Utrillas
et al. 2003); 0,25 a -0,7 para D. pulex expuesta a concentracin
de 2 g/L del organofosforado Diazinon (Stark et al. 2003); los
valores obtenidos por nosotros son altamente relevantes ya que
a mxima concentracin, r registr -13,97, evidencindose la
alta mortalidad respecto a la natalidad, en contraposicin del
control (0,02). As mismo, podemos inferir que el lindano tiene
un efecto negativo sobre la supervivencia de C. cornuta (Fig. 7).
Los resultados obtenidos corroboraran la mayor efciencia de
las especies de Ceriodaphnia en bioensayos. Ceriodaphnia cornuta
result ser ms sensible al lindano con un valor de CL
50
48 h
(5,260 0,7 g/mL) menor que los encontrados en Simocephalus
vetulus (11,4 g/L; Jurez et al. 2007) y en Daphnia magna (460
g/L; Silva et al. 2001 y Martins et al. 2007), indicndolo como
un adecuado organismo biosensor de contaminantes.
El tiempo que transcurre desde el inicio de la prueba hasta
que se reproduce por primera vez C. cornuta aumenta gradual-
mente a medida que aumenta la concentracin de lindano.
Tambin se observ una signifcativa disminucin de neonatos
al incrementar la concentracin del plaguicida. Villarroel Utrillas
(2004), observ resultados similares producidos por tetradifn
y propanil en Daphnia magna, ambos plaguicidas causaron una
disminucin progresiva en el nmero de descendientes, que fue
ms relevante con el propanil.
El efecto observado sobre la longevidad es relevante, parme-
tro que decrece considerablemente a mayor concentracin de
lindano respecto del control. El promedio de longevidad tambin
se reduce de 12,5 das bajo condiciones control a 7,6 das en
la mxima concentracin del insecticida endosulfan sobre el
cladcero Moina macrocopa (Chuah et al. 2007) y de 5,8 a 1,6
das para el Diazinon (Wong 1997).
En cuanto a la tasa intrnseca de crecimiento natural (r), los
valores obtenidos demuestran tambin un importante efecto del
lindano a mxima concentracin (-13,97) respecto del control
(0,02). Antunes et al. (2004) registraron para este parmetro
valores de 0,22 y 0,17 para D. longispina y D. magna expuestos
por 21 das a 607,5 g/L de lindano, respectivamente. En ensayos
con los insecticidas organofosforados spinosad y diazinon sobre
D. pulex se observ que la tasa de incremento natural declin
dependiendo de la concentracin (Stark et al. 2003). As mismo
(r) result ser el parmetro ms sensible afectado por la toxicidad
del herbicida propanil en D. magna desde 0,33 para el control a
0,14 despus de la exposicin a 0,55 mg/L. (Villarroel Utrillas et
al. 2003). Los resultados obtenidos de la toxicidad del plaguicida
organoclorado lindano sobre los parmetros reproductivos de
C. cornuta son importantes indicadores del impacto de estos
sobre la biota acutica.
Agradecimientos
Este trabajo se realiz gracias al subsidio recibido del Proyecto
CIUNT (Consejo de Investigaciones de la Universidad Nacio-
nal de Tucumn). 26/G446-1- Ecologa de Humedales del
Noroeste Argentino con especial nfasis al Impacto Ambiental
(2008 - 2012).
Literatura citada
Antunes S., B. Castro & F. Gonalves. 2004. Effect of food level on
the acute and chronic responses of daphnids to lindane.
Environmental Pollution 127: 367-375.
Avalos Gmez M. & J. Ramrez Gutirrez. 2003. La situacin del
lindano en Mxico. Gaceta Ecolgica. Instituto Nacional
deEcologa69:93-100.
-16
-14
-12
-10
-8
-6
-4
-2
0
2
4
6
8
10
12
14
16
18
20
22
0 0,1 0,15 0,2 0,25 0,3
Longevidad (Das)
R
0
Tg
r
Figura 8. Parmetros demogrfcos de Ceriodaphnia cornuta expues-
ta a diferentes concentraciones de lindano.
376
Jurez
Rev. peru. biol. 17(3): 371 - 376 (Diciembre 2010)
ChuahT.S.,J.Y.Loh&Y.S.Hii.2007.AcuteandChronicEffects
of the Insecticide Endosulfan on Freshwater Cladoceran,
Moina macrocopa Straus. Bull. Envirom. Contam. Toxicol.
79:557-561.
Giorgio A. & A. Dign. 2005. Sustancias o Compuestos Txicos
QumicosProhibidosoRestringidosenlaRepblicaAr-
gentina. Programa Nacional de Riesgos qumicos. Pp. 15.
IannaconeJ.,L.Alvario,C.Caballero&J.Snchez.2000.Cuatro
Ensayos Ecotoxicolgicos para Evaluar Lindano y Clor-
pirifos.Gayana64(2):139-146.
INE (Instituto Nacional de Ecologa). 2004. El Lindano en Mxico.
Instituto Nacional de Ecologa Pp. 56.
ISO (International Standards Organization) 1982.Water Quality
Determination of the inhibition of the Mobility of Daphnia
magna Straus (Cladocera, Crustacea). 1st Ed. E. Geneve,
Switzerland1982-03-15.Ref.ISO6341.
Jurez J. & A. Villagra de Gamundi. 2007. Bioensayos preliminares
para evaluar la toxicidad del lindano sobre Simocephalus
vetulus (O.F.Muller, 1776) (Crustacea: Cladocera). Revista
Peruana de Biologa. 14(1): 65 - 67. Versin Online ISSN:
1727-9933.
Martins J., L. Oliva Teles & V. Vasconcelos. 2007. Assays with
Daphnia magna and Danio rerio as alert systems in aquatic
toxicology. Environmental International. 33: 414 425.
Silva J, J. Iannacone, A. Cifuentes, et al. 2001. Assessment of Sen-
sitivity to Pentachlorophenol (PCP) in 18 Aquatic Species,
Using Acute and Chronic Ecotoxicity Bioassays. Eco-
toxicology and Environmental Restoration 4(1): 10 - 17.
Stark J. & R. Vargas. 2003. Demographic changes in Daphnia pulex
(Leydig) after exposure to the insecticides spinosad and
diazinon. Ecotoxicology and Environmental Safety 56:
334 - 338.
USEPA 1988. Short _Term methods for estimating the chronic
toxicity of effuents and receiving waters to marine and
estuarineorganisms.EPA/600/4-87/028.Pp.398-416.
Villarroel Utrillas M. J., E. Sancho, M. D. Ferrando E. Andreu.
2003. Acute, chronic and sublethal effects of the herbicide
propanil on Daphnia magna. Chemosphere 53: 857 - 864.
Villarroel Utrillas M. J. 2004. Tesis Doctoral: Alteraciones Fisio-
lgicas en el Crustceo Daphnia magna por exposicin
a plaguicidas. Server de Publicacions. Universitat de
Valencia. Pp. 212.
Villalobos M. 2006. Estudios sobre la Biologa y Ecologa de Ce-
riodaphnia cornuta Sars. Una revisin. Interciencia. 31
(005): 351 - 357.
WongC.K.1997.EffectsofDiazinononsomepopulationparame-
ters of Moina macrocopa (Cladocera). Water, Air, and Soil
Pollution393:393-399.
377

El Oso Andino en las Yungas de Puno
Rev. peru. biol. 17(3): 377 - 380 (December 2010)
Rev. peru. biol. 17(3): 377 - 380 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Nuevas evidencias de la presencia del Oso Andino (Tremarctos ornatus)
en las Yungas de Puno, el registro ms austral de Per
Gisella Mrquez
1
y Vctor Pacheco
1,2
Presence of the Andean Bears (Tremarctos ornatus) new evidences in the
Yungas of Puno, Perus southernmost record
1 Departamento de Mastozoologa,
Museo de Historia Natural, Uni-
versidad Nacional Mayor de San
Marcos, Apartado 14-0434, Lima-
14, Per. E-mail Gisella Mrquez:
gise0208@yahoo.es
2 Facultad de Ciencias Biolgicas,
Universidad Nacional Mayor de
San Marcos.
NOTA CIENTFICA
Presentado: 25/05/2010
Aceptado: 28/10/2010
Publicado online: 00/11/2010
Resumen
El oso de anteojos Tremarctos ornatus es el nico representante de la familia Ursidae en Suramrica. La
poblacin ms grande y de distribucin continua del oso andino en el Per, se localiza en la ladera oriental
de la cordillera oriental, incluyendo al departamento de Puno, donde casi todos los registros de esta especie
provienen solamente de encuestas. Se describe aqu dos registros indirectos de la presencia del oso en el
departamento de Puno, obtenidos en agosto del ao 2009. El primer registro corresponde a una fecha, con
semillas perteneciente a la familia Lauraceae, encontrada en Yanacocha; y el segundo registro corresponde
a unas marcas de garras del oso hallado en Challohuma. Este ltimo representa el registro ms austral con-
frmado para la distribucin del oso de anteojos en el Per. Nuestros registros evidencian una continuidad
en la distribucin de esta especie en la vertiente oriental de la cordillera andina, desde el sur del Per hasta
el noroeste de Bolivia. Estos registros se hallan tambin muy prximos al Parque Nacional Bahuaja Sonene
(PNBS), uno de los corredores de conservacin ms importantes en el mundo, y muestran la importancia de
establecer estrategias de conservacin tanto dentro como fuera de la zona de amortiguamiento del PNBS.
Palabras claves: nuevas evidencias, Per, Tremarctos ornatus, Puno, Parque Nacional Bahuaja Sonene,
conservacin.
Abstract
The Spectacled bear (Tremarctos ornatus) is the only representative of the family Ursidae in South America.
The largest and most continuous Andean bear population in Peru is located on the eastern slopes of the Ori-
ental Range, including Departamento Puno, where most reports are based only on surveys. We describe two
indirect records of Andean bears presence from Departamento Puno, obtained on August 2009. The frst record
is a scat with seeds belonging to the family Lauraceae, and found in Yanacocha; the second record consists
of some bear's claw marks found in Challohuma, which represents also the southernmost confrmed record of
the Spectacled bear in Peru. Also our records confrm a continuous distribution of this species on the eastern
Andean slopes from southern Peru to northwestern Bolivia. Furthermore, these records, found very close to
the highly diverse Bahuaja Sonene National Park (BSNP), suggest it is very important to establish conservation
strategies both within and outside of BSNPs buffer zone.
Keywords: new records, Peru, Tremarctos ornatus, Puno, Bahuaja Sonene National Park, conservation.
El oso de anteojos Tremarctos ornatus es una especie endmica
de los Andes Tropicales y el nico representante de la familia
Ursidae en Suramrica (Ros-Uzeda et al. 2005). Se encuentra
incluido dentro del apndice I de CITES, es considerado por
la IUCN como una especie vulnerable y por el DS N 034-
2004-AG del Per, como una especie en peligro (Ministerio de
Agricultura 2004). Se distribuye a lo largo de las tres cadenas de
los Andes peruanos, en los distintos tipos de hbitats y elevacio-
nes del Per desde los 250 a 4750 m de altitud (Peyton 1999).
La poblacin ms grande y contigua de osos de anteojos en
el Per se localiza en la ladera oriental de la cordillera oriental
(Peyton 1999), la cual atraviesa la parte norte del departamento
de Puno, y donde se ha reportado la presencia del oso andino
en la provincia de Sandia (Grimwood 1969, Peyton 1980).
Tambin Trinidad Tapia (com. pers.) report a la especie para
la provincia de Sandia, en los distritos de Limbani, Patambuco,
Phara, Sandia, Yanahuaya, Quiaca, San Juan del Oro y San
Pedro de Putina Punco; y para la provincia de Carabaya, en los
distritos de Ayapata, Coasa, Ituata, Usicayos, Oyachea y San
Gabn. La mayora de estas localidades se encuentran fuera del
Parque Nacional Bahuaja Sonene (PNBS) y mantienen una gran
presin antrpica (T. Tapia, com. pers.). Informacin adicional
recopilada por Figueroa y Stucchi (2009) incluye registros del
oso andino dentro del PNBS a 750 m y para la zona de amor-
tiguamiento (ZA) del PNBS entre 800 y 1080 m de altitud.
Todos estos reportes, al parecer numerosos, estn basados
slo en encuestas realizadas a habitantes rurales, con excepcin
de una piel de oso andino (FMNH 78464) colectada por H. H.
Heller en 1950 en la provincia de Sandia, en los alrededores del
distrito de Sandia (Fig. 1) (GBIF 2010). Adems, los reportes
de Grimwood (1969) y Peyton (1980) no determinan el tipo
de registro, pero es muy probable que hagan referencia a este
mismo espcimen.
El presente trabajo describe dos reportes indirectos de la
presencia del oso andino obtenidos en la cuenca media del ro
Tambopata, durante una evaluacin de mamferos realizada en
agosto del 2009. El rea de estudio se ubic en tres localidades:
Challohuma, Yanahuaya y Yanacocha, con elevaciones de 1200,
1600 y 1985 m, respectivamente. Yanahuaya y Yanacocha
presentan caractersticas de un bosque montano bajo, mientras
Challohuma presenta un ambiente tpico de un bosque pre-
montano (Young 1992).
En Yanacocha se realiz una evaluacin de los diferentes tipos
de seales dejadas por los mamferos mayores a lo largo de un
transecto lineal de fuerte pendiente, en un solo da. La distancia
378
Mrquez & Pacheco
Rev. peru. biol. 17(3): 377 - 380 (Diciembre 2010)
total recorrida fue de aproximadamente 0,47 km con 2 m de
ancho (1 m a cada lado del transecto).
Como resultado del mismo se encontr una pila de heces
dispersas de oso andino, que contena semillas perteneciente a la
familia Lauraceae (Fig. 2A), a 2000 m aprox., en los alrededores
del poblado de Yanacocha (1411,6S, 6915,4W). Cerca a
este punto, y solo tres das antes, se haba realizado una quema
intensa con fnes de cultivo. La identifcacin de la feca y las
semillas fueron determinadas en base a comparaciones hechas
con fotografas recopiladas en Figueroa y Stucchi (2009) y con-
frmadas por las especialistas Jessica Amanzo y Judith Figueroa
(com. pers.).
En Challohuma los rastros dejados por mamferos mayores
fueron evaluados a travs de una observacin intensiva mientras
se instalaban las trampas de un transecto para evaluar mamferos
pequeos no voladores. La distancia total recorrida en el transec-
to fue de aproximadamente 0,38 km. Producto de este muestreo
se obtuvo el segundo registro correspondiente a unas marcas de
garras de oso andino sobre un rbol de aproximadamente 20
m de altura dejadas al trepar muy probablemente en busca de
alimento (Fig. 2B). Este registro fue encontrado a 1265 m de
altitud (1412,6S, 6908,7W). Estas marcas coinciden con las
Figura 1. Mapa con la ubicacin de los dos nuevos registros para el
departamento de Puno (crculos negros),el registro ms noroccidental
de Bolivia (tringulo negro) y la piel colectada de Tremarctos ornatus
en Sandia en 1950 (cuadrado negro).
reportadas en la literatura para esta especie (Figueroa y Stucchi
2009), adems tambin fueron confrmadas por las especialistas
Jessica Amanzo y Judith Figueroa.
Estos dos registros basados en la evidencia indirecta de la
presencia de oso andino al sur de la ZA del PNBS, confrman su
actual distribucin en el departamento de Puno y en el extremo
sur de Per (Fig. 1). Estas evidencias fueron halladas en zonas que
no estn protegidas por el Estado, pero muy cerca a los lmites
del Parque Nacional Bahuaja Sonene, rea importante para el
Per, por pertenecer al ncleo del Corredor de Conservacin
Vilcabamba-Ambor, uno de los corredores de conservacin
ms importantes en el mundo debido a su ubicacin en una
regin de alta diversidad biolgica y cultural(Ministerio de
Agricultura 2003).
La piel colectada por H. H. Heller en Sandia en 1950 podra
considerarse como el reporte ms austral en el Per, sin embargo
las coordenadas indicadas por el GBIF (2010) slo brindan in-
formacin referencial, no explcita de la ubicacin del registro;
en cambio nuestro registro especfcamente encontrado en la
localidad de Challohuma (1411,6S, 6915,4W) seria hasta el
momento, el registro ms austral confrmado para la distribucin
del oso andino en el Per.
La localidad de Challohuma colinda con la frontera de Bolivia
(frente al rea Natural de Manejo Integrado Apolobamba y el
Parque Nacional Madidi), donde Paisley y Garshelis (2005)
reportaron la presencia ms noroccidental del oso andino
en Pusupunko, Bolivia, dentro del Parque Nacional Madidi
(1440,82S, 6858,24W; a los 3100 m)(Fig. 1). Dndole a
nuestros registros una mayor relevancia dado que evidencian
una continuidad en la distribucin de esta especie en la vertiente
oriental de la cordillera andina, desde el sur del Per hasta el
noroeste de Bolivia.
Desafortunadamente, numerosos problemas y amenazas son
evidentes en las zonas evaluadas para la conservacin del oso de
anteojos. Siendo notable la deforestacin, la minera informal
y la construccin de una carretera que va a facilitar el acceso al
PNBS. Estas actividades implican una mayor presencia humana
en el lugar con sus consecuentes efectos de alteracin del hbitat.
Y si estas actividades prosiguen a un paso acelerado y sin ningn
control, podran representar una verdadera amenaza para las
poblaciones de osos de esta regin. Estas amenazas podran in-
ducir a las poblaciones de osos a desplazarse hacia el PNBS, para
continuar su ruta hacia el sur; o en su defecto, estas amenazas
podran actuar como una barrera, aislando parte de las pobla-
ciones de osos del sur del Per con las del noroeste boliviano.
Nuestros registros y la revisin de literatura indican al pare-
cer que la poblacin de osos en el departamento de Puno se ha
mantenido en buen estado a lo largo de estos ltimos 60 aos
prueba de ello son los actuales y numerosos registros hallados
en la regin, similar a lo reportado en otros lugares en el centro
y norte del Per (Grimwood 1969, Peyton 1980). Sin embargo
pocos son los esfuerzos de conservacin y estudios del oso en
este departamento, en comparacin al norte del pas.
Sugerimos por ello que el Estado peruano, y el gobierno
regional de Puno, realicen estudios sobre el estado de las pobla-
ciones de osos en esta regin, evalen su disponibilidad y uso
de hbitat, considerando las reas ya pobladas y aquellas que
manifestan diferentes niveles de degradacin y fragmentacin
379

El Oso Andino en las Yungas de Puno
Rev. peru. biol. 17(3): 377 - 380 (December 2010)
por uso humano. Para que de este modo sea posible conocer los
factores clave que podran afectar a los osos y as aproximarnos a
determinar su viabilidad a largo plazo en la regin. Tambin se
sugiere la extensin de la zona sur de la ZA del PNBS hasta los
bosques montanos de Yanacocha, ya que la ZA de este parque
nacional protege una muy pequea porcin de estos bosque
tropicales de altura (Ministerio de Agricultura 2003), los cuales
albergan un nmero alto de especies endmicas y son tan o ms
diversos que la selva baja (Pacheco 2002, Pacheco et al. 2009).
En conclusin estos nuevos registros brindan informacin
crtica con obvias implicancias de manejo y conservacin para
esta especie en el sur del Per, ya que estos registros demuestran
que los osos se desplazan fuera de reas protegidas y corredores
biolgicos, por lo que estrategias de conservacin deberan in-
cluir actividades tanto dentro como fuera de la ZA del PNBS.
Finalmente se sugiere realizar proyectos de manera binacional
(Per-Bolivia) para contribuir al desarrollo de planes de manejo
y conservacin del oso andino en zonas tan importantes para
Amrica del Sur, como lo son estas reas aledaas al Corredor
de Conservacin Vilcabamba-Ambor.
Agradecimientos
El presente trabajo fue fnanciado por el Vicerrectorado de
Investigacin de la Universidad Nacional Mayor de San Marcos
(N 091001011) y la Asociacin Peruana para la Conservacin
de la Naturaleza (N 72-2008-APECO-CI).
Un agradecimiento muy especial a Jessica Amanzo Alcntara
por confrmar la identifcacin de nuestros registros, y colaborar
con sus sugerencias y comentarios en la elaboracin de la presente
nota. Agradecer a Richard Cadenillas y a Sandra Velasco por
Figura 2. (A) Heces dispersas del oso andino con semillas perteneciente a la familia Lauraceae (fechas), a aproximadamente 2000 msnm,
en el bosque montano de Yanacocha. (B) Marcas de garras del oso andino sobre un rbol de aproximadamente 20 m de altura, a unos 1265
m de altitud en el bosque premontano de Challohuma.
(A)
(B)
380
Mrquez & Pacheco
Rev. peru. biol. 17(3): 377 - 380 (Diciembre 2010)
sus comentarios a la presente nota. Un sincero agradecimiento
a Oscar Centty por su valioso apoyo en el trabajo de campo y
tambin por su ayuda en el campo a Miryam Quevedo, Mnica
Aguilar, Jess Lescano y Edson Aguilar. A Judith Figueroa Pizarro
por confrmar la identifcacin de nuestros registros y motivar la
realizacin de la presente nota. Y fnalmente el agradecimiento al
Doctor Robert Wallace por el apoyo brindado para la obtencin
de informacin bibliogrfca.
Literatura citada
CITES2009.(enlnea).ApndicesI,IIyIII.<www.cites.org/esp/
app/appendices.shtml>. Acceso 14/04/10.
FigueroaJ.&M.Stucchi.2009.Elosoandino:alcancessobresu
historia natural. Asociacin para la Investigacin y Con-
servacin de la Biodiversidad-AICB. Primera edicin.
Lima-Per.Pp.13-18.
GBIF 2010. (en lnea). Global biodiversity information fa-
cility. <http://secretariat.mirror.gbif.org/occurrenc-
es/62030584/>. Acceso 15/05/2010.
GrimwoodI.R.1969.Notesonthedistributionandstatusofsome
peruvian mammals. American Comittee for International
WildLifeProtectionandNewYorkZoologicalSociety,
Special Publication 21: 43-45.
IUCN 2008. (en lnea). IUCN Red list of threatened species. Ver-
sion 2010.1. <www.iucnredlist.org>. Acceso 14/04/2010.
Ministerio de Agricultura. 2003. Plan Maestro del Parque Nacional
BahuajaSonene2003-2008.Lima-Per.Pp.24-42.
Ministerio de Agricultura. 2004. Decreto Supremo No. 034- 2004-
AG. El Peruano. Pp 276853-276855.
PachecoV.2002.MamferosdelPer.In:G.CeballosyJ.Simonetti,
eds. Diversidad y conservacin de los mamferos neo-
tropicales. Conabio-UNAM. Mxico, D.F. Pp. 503-550.
PachecoV.,R.Cadenillas.,E.Salas.,C.Tello&H.Zeballos.2009.
DiversidadyendemismodelosmamferosdelPer.Re-
vista Peruana de Biologa. 16(1): 005-032.
Paisley S. & D.L. Garshelis. 2005. Activity patterns and time budgets
of Andean bears (Tremarctos ornatus) in the Apolobamba
Range of Bolivia. Journal of Zoology 268: 2534.
PeytonB.1980.Ecology,distributionandfoodhabitsofspectacled
bears,Tremarctosornatus,inPer.JournalofMammal-
ogy.61:639652.
PeytonB.1999.Spectacledbearconservationactionplan.InBears:
status survey and conservation action plan: 157164.
Servheen, C., Herrero, S. & Peyton, B. (compilers). Gland:
IUCN/SSC Bear and Polar Bear Specialist Groups.
Ros-Uzeda B., H. Gmez & R.B. Wallace. 2005. Habitat prefer-
ences of the Andean bear (Tremarctos ornatus) in the
Bolivian Andes. Journal of Zoology 268: 271278.
Young K. 1992. Biogeography of the montane forest zone of the
Eastern slopes of Peru. Memorias del Museo de Historia
Natural,U.N.M.S.M.Lima-Per21:119-154.
381

Effects of origanum vulgarE on mouse embryo
Rev. peru. biol. 17(3): 381 - 384 (December 2010)
Rev. peru. biol. 17(3): 381 - 384 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Effects of aqueous extract of Origanum vulgare L. (Lamiaceae) on
the preimplantational mouse embryos
Vctor Benavides*, Guadalupe DArrigo and Jos Pino
Efecto del extracto acuoso de Origanum vulgare L. (Lamiaceae) en embrio-
nes preimplantacionales de ratn
Laboratorio de Reproduccin y
Biologa de Desarrollo. Facultad
de Ciencias Biolgicas. Univer-
sidad Nacional Mayor de San
Marcos, Ciudad Universitaria, Av.
Venezuela s/n. Apartado postal
11-058, Lima 11.
Email Victor Benavides:
vbenavides23@hotmail.com
* Direccin para correspondencias:
Jr. Lazareto 398, Urb. Miguel Grau,
Lima31, Lima - Per.
NOTA CIENTFICA
Presentado: 17/06/2010
Aceptado: 15/12/2010
Publicado online: 00/11/2010
Abstract
The use of medicinal plants for the treatment of illnesses is widely known. However, there are not many scientifc
reports about the properties of these plants and their side effects. In this study, the effect of the aqueous extract
of Origanum vulgare on the preimplantational mouse embryo development was investigated. The oregano
aqueous extract was given ad libitum to four separated groups (n= 10) of pregnant mice: O, 9, 18 y 36 mg/mL
respectively. When the embryos were evaluated, a slight delay in the embryo development was observed, but
only with the highest dose. With respect to embryo quality, an increase of degenerated embryos was observed
but this was not signifcant. These results showed that the aqueous extract of O. vulgare does not have a toxic
effect on preimplantational mouse embryo, and it only produces a slight delay in embryo development.
Key words: Preimplantational embryo, Traditional Medicine, Origanum vulgare, embryotoxicity.
Resumen
El uso de las plantas medicinales para el tratamiento de las enfermedades es ampliamente conocido. Sin em-
bargo, no hay muchos informes cientfcos sobre las propiedades de dichas plantas y sus efectos secundarios.
En este estudio, se ha investigado el efecto del extracto acuoso de Origanum vulgare en el desarrollo preim-
plantacional de embriones de ratn. El extracto acuoso fue administrado (0, 9, 18 y 36 mg/mL): va oral; ad
libitum, respectivamente a cuatro grupos de ratonas preadas (n= 10). Cuando los embriones fueron evaluados
slamente con la dosis ms alta se observ un ligero retraso en el desarrollo del embrin. Con respecto a la
calidad del embrin, se evidencio un aumento de embriones degenerados, pero esto no fue signifcativo. Estos
resultados mostraron que el extracto acuoso de O. vulgare no tiene un efecto txico en embriones de ratn
preimplantacional, y slo produce un ligero retraso en el desarrollo del embrin.
Palabras clave: Embrin preimplantacional, Medicina tradicional, Origanum vulgare, embriotoxicidad.
Introduction
Of the 250,000 species of fowering plants in the World, more
than 20,000 nearly 10% of the total are classifed as herbs.
Herbs picked by people from the wild have been an essential
factor in health care all over the World throughout the ages and
in all cultures. Nowadays, some 80% of the Worlds people rely
on traditional, plant-based medicines for their primary health
care (Cosge et al. 2009).
Actually, there exists a tendency to use natural products for
the treatment of several illnesses. With use of medicinal plants,
investigations have been performed all over the world in order
to fnd more productive and economical medicines (Goze et
al. 2010). Medications used to cure disorders require conti-
nuous changing to improve their efectiveness. However, few
of the many claims of therapeutic efcacy have been validated
adequately by clinical trials; Even though these claims have
been substantiated scientifcally, complementary medicines are
unlikely to secure a place in conventional healthcare (Hammer
et al. 1998).
Te Labiatae family (Lamiaceae) is one of the largest and
most distinctive families of fowering plants, with about 220
genera and almost 4000 species worldwide (Naghibi et al. 2005);
Labiatae are best known for the essential oils common to many
members of the family (Jones 1996, cited by Hammer et al.
1999). O. vulgare "oregano" is a herb widely used in cooking
and natural medicine (Fon Quer 1985, Naghibi et al. 2005)
that include many efective antioxidants, such as Rosmarinic
acid, cafeic acid and various favonoids (Yoshino et al. 2006).
In a study on the phenolic acids recovered in human urine after
single ingestion of Origanum onites extract, Nurmi et al. (2006)
identifed phenolic constituent in the extract was rosmarinic
acid, representing 75% of the identifed phenolic acids. Other
phenolic acids, including protocatechuic acid, p-coumaric acid,
ferulic acid, chlorogenic acid and gallic acid, were present in the
extract in notably lower amounts. Te extract also contained
minor amounts of the favonoids luteolin and eriodictyol. In
scientifc reports about the medicinal properties of oregano:
Origanum oil, mainly rich in carvacrol (Bakkali et al. 2008),
is used as a painkiller in rheumatism by rubbing externally on
painful limbs. Te aromatic oregano water, rich in carvacrol,
is consumed to check gastrointestinal disorders, reduce blood
cholesterol and glucose level and also for tumor suppressive
activities (Goze et al. 2010); against whooping and convulsive
coughs, digestive disorders and menstrual problems (Gurudatt
et al. 2010), also its calming (Lans et al. 2007), antimicrobial
(Nazia et al. 2007) and antifungal activity is emphasized (Ha-
mmer et al. 1998, 1999; Ultee et al. 1999). In Northern Peru,
leaves and stems, fresh or dried, of oregano are employed as
traditional remedies for menstrual cramps, menstruation and
lower stomach cramps related to premenstrual stages (Bussmann
& Glenn 2010).
It is known that during the early pregnancy, the mammal
embryo is susceptible to the toxic action of some drugs. Tese
harmful efects depend on the exposure time and its concentra-
tion. At the undiferentiated stage of zygote proliferation and
before implantation, exposure to a teratogen usually either kills
382
Benavides et al.
Rev. peru. biol. 17(3): 381 - 384 (Diciembre 2010)
the fertilized ovum which results in a spontaneous abortion, or
spares it completely (Stanley & Bower 1986). During the recent
years there have been reports on the toxic efects of some medi-
cinal plants on the mouse embryo development (Lemonica et
al. 1996, Gutierrez-Pajares et al. 2003). Although it is common
to evaluate xenobiotic efects on mammalian embryos during
organogenesis, the efects of these agents on preimplantation
development is less commonly studied. Toxic agents or an
unfavorable environment during preimplantation stages could
alter normal events to arrest embryos or invoke abnormalities
that afect subsequent stages of development. In a previous work,
Benavides et al. (2000) found 10% of abnormal embryos when
20% aqueous extract of oregano was orally provided to pregnant
mice in contrast to 14,29% of abnormal embryos found in the
control group.
For this reason, it is necessary to evaluate and rule out the
possible side or toxic efects that those plants could have (Be-
navides el al. 2001). Te aim of this study was to examine the
possible embryotoxicity of aqueous extract of O. vulgare on the
mouse preimplantational embryo development.
Material and methods
Botanical samples were obtained from marketplace suppliers
who had collected the plants from public lands. Tey were identi-
fed by Esther Cox, professor of Facultad de Ciencias Biolgicas,
Universidad Nacional Mayor de San Marcos. Voucher specimens
of species studied are deposited in our laboratory.
Swiss Rockefeller strain mice from our animal house were
maintained with a photoperiod of 14 h light/10 h dark, 22 24
C room temperature and free access to balanced diet pellets
(Purina, Peru). Females between six to eight weeks old were
mated with proved fertile males between 8 12 weeks old.
When a vaginal plug was observed, it was considered to be day
one of pregnancy.
Aqueous extract.- Leaves of O. vulgare were dried at 60 C
in a stove for 24 h. Te aqueous extract was prepared heating
300 g of oregano in 1500 mL of distillated water at 60 C for
15 minutes, and then the extract was decanted. After fltration,
a sample was separated for determination of the solid concen-
tration (36 mg/mL). From this extract we prepared doses of O,
9, 18 and 36 mg/mL.
Experimental procedure.- Pregnant females were randomly
assigned to four experimental groups: Group Control, Group
A, Group B and Group C, each group (n= 10) was orally treated
with 0, 9, 18 and 36 mg/mL ad libitum of aqueous extract of
oregano, respectively since day one to day four. Female mice were
euthanized by cervical dislocation 96 hours post copula (h.p.c.)
and oviducts and uterine horns were excised, preimplantational
embryos were collected by fushing oviducts and uterine horns
with phosphate bufer saline (PBS, Sigma) pH 7,4 supplemented
with 4 g/L bovine serum albumin (BSA. Sigma Chemical Co.)
(Hogan et al. 1986).
Evaluation of embryo morphology and transport.- Te
stage and embryo quality were evaluated under a phase contrast
microscopy and the grade of viability was determined by doing
a morphological evaluation following Dorn & Kramer (1987)
protocol with some of our own modifcations (Figure 1):
Grade 1: there are no extruded blastomeres and the embryo
has a rounded appearance.
Grade 2: there are extruded blastomeres and the embryo may
not have a rounded appearance.
Grade 3: there are several extruded blastomeres and the
embryo may be extremely malformed.
Degenerated: Te embryo may be fat or bowl shape and
most of the membranes are broken down.
Statistical analysis.- Data was evaluated by chi-square or
Fisher test and all results with p<0,05 were considered statisti-
cally signifcant.
Results
Tis is not the frst time that our laboratory demonstrated
that oral administration of an aqueous extract of an herb causes
damage to preimplantation mouse embryos (Gutierrez-Pajares
2003, Gonzales et al. 2007). In this time, this efect is not related
to a systemic toxicity since there was no sign of intoxication in
any of the doses in the pregnant mice.
Table 1 and 2 show the efects of treatment with aqueous
extract of oregano on the early development stages of mouse
embryo. Groups A and B did not show a signifcant diference
when they were compared with the group control. Tere was
Figure 1. Gradation of 96 hpc preimplantational embryos.
383

Effects of origanum vulgarE on mouse embryo
Rev. peru. biol. 17(3): 381 - 384 (December 2010)
not a similar results in group C where blastocyst stage decreased;
41,89% in comparison with the control, where it was 56,46%
(p< 0,05). A signifcant increase in the morulae stage was obser-
ved in the same group, demonstrating a slight delay in embryo
development with the highest dose.
When the embryo quality was examined, we found a sig-
nifcant increase in the occurrence of degenerated embryos in
all treated groups in comparison with group control (group A:
13,6%, group B: 9,72%, group C: 13,51% and group control:
5,06%). Also, a signifcant increase in the number of grade 1
embryos was observed in group B 65, 28% in comparison with
group control 46,84%. A signifcant decrease in grade 2 embryos
in groups A and B was observed. In the same way there was a
signifcant decrease in grade 3 embryos in group C (Table 2).
Discussion
Domarack et al. (2007) did not found infuence of essential
oil of O. vulgare (carvacrol, 65%) on mouse preimplantational
in vivo, however, the embryos was altered only minimally and
appeared as an increase of cell death. In our results, there was a
signifcant decrease in grade 3 embryos in group C (Table 2) as
well. Tere are not many scientifc reports about toxic activity
of O. vulgare. Many studies exist in which antimicrobial activity
from O. vulgare is confrmed. However plants oils and extracts
are to be used for food preservation or medicinal purposes, issues
of safety and toxicity will need to be addressed (Hammer et al.
1999). It has been reported that O. vulgare contains substances
that have progestin bioactivity (Zava et al. 1998, Arcila-Lozano
2004), these substances have an action similar to progesterone,
and they could act in favor of normal embryo development,
which is evidenced by the increase of grade 1 embryos in all
treated group, although this increase is only signifcative in group
B. Furthermore, there are reports that O. vulgare has antioxidant
efects (Yoshino et al. 2006, Jaloszysky et al. 2008) in front
to the DPPH action, this efect is attributed to the rosmarinic
acid (Yoshino et al. 2006) and its derivatives presents in this
plant, conferring to O. vulgare a protecting character against
cell damage by oxidation (Lamaison et al. 1990) or reducing
the expression of the proinammatory gene cyclooxygenase-2
(COX-2), which has been regarded as a risk factor in tumor
development (Scheckel et al. 2008). Arcila-Lozano (2004) afrm
that the essential oil from Origanum have the property to increase
the activity of the detoxicant enzyme, glutation S-transferase
when it is administered orally.
In conclusion; this study shows that aqueous extract of O.
vulgare does not have a toxic efects on development and mor-
phology of preimplantational mouse embryo; only with the
highest dose, a signifcant delay in the formation of blastocysts
was observed.
Literature cited
Arcila-LozanoC.,Loarca-PiaG.,Lecona-UribeS.,etal.2004.El
Organo: Propiedades, Composicin y Actividad Biol-
gica de sus Componentes. Archivos Latinoamericanos de
Nutricin 54(1): 100111.
Bakkali F., Averbeck S., Averbeck C. & M. Idaomar. 2008. Biological
effects of essential oils A Review. Food and Chemical
Toxicology 46 (2): 446-475.
Benavides V., D-Arrigo O & J. Pino. 2001. Efectos Embriotxicos
de Picrosia longifolia Don (ASTERACEAE). Revista
Peruana de Biologa 8 (1): 80-82.
Benavides,V.,Trujillo,G.,DArrigo,G.,etal.2000.Evaluacintoxi-
colgica preliminar de Ruta graveolens, Origanun vulgare
y Persea americana sobre embriones preimplantacionales
deratn.RevistaPeruanadeBiologa7(1):87-89.
Bussmann R.W. & A. Glenn. 2010. Medicinal plants used in Northern
Peru for reproductive problems and female health. Journal
of Ethnobiology and Ethnomedicine 6: 30-30.
Cosge B.,A. Turker, I. Ipek, et al. 2009. Chemical compositions
and antibacterial activities of the essential oils from aerial
parts and corollas of Origanum acutidens (Hand.-Mazz.)
Ietswaart, an endemic species to Turkey. Molecules
14:1702-1712.
Domarack M., P. Rehk, . Juhs & J. Koppel. 2007. Effects of
selected plant essential oils on the growth and development
of mouse preimplantation embryos in vivo. Physiol. Res.
56:97-104.
DornC.G.&D.C.Kramer.1987.BovinoEmbryoGrading.Texas
A & E University, USA.
FontQuerP.(1985).PlantasMedicinales.EditorialLaborS.A.I"
edicin.Barcelona,Espaa.
Gonzles J.,V. Benavides, R. Rojas & J. Pino. 2007. Efecto em-
briotxico y teratognico de Ruta chalepensis L. ruda
en ratn (Mus musculus). Revista Peruana de Biologa
(Nmeroespecial)13(3):223-225.
Goze I., A. Cetin & A. Goze. 2010. Investigation of effects of
essentialoilsofOriganumminutiforumOSchwarzPH
Davis and Cyclotrichium niveum (Labiatae) plants on
angiogenesis in shell-less Chick embryo culture. African
JournalofBiotechnology9(14):2156-2160.
Gurudatt P., V. Priti, S. Shweta, et al. 2010. Changes in the essential
oil content and composition of Origanum vulgare L. during
annual growth from Kumaon Himalaya. Current Science
98(8):1010-1012.
Gutierrez-PajaresJ.L.,ZigaL.&J.Pino.2003.Rutagraveolens
aqueous extract retards mouse preimplantation embryo
development. Reproductive Toxicology 17(6): 667-672.
1-8 cells Morulae Blastocysts
Control 13,93 (11) 29,11 (23) 56,96 (45)
Group A 12,35 (10) 19,75 (16) 67,9 (55)
Group B 9,72 (7) 34,72 (25) 55,56 (40)
Group C 6,76 (5) 51,35 (38)
*
41,89 (31)
*
Table 1. Number and percentage of embryos by stage obtained from
females treated with aqueous extract of oregano.
Numbers in parenthesis represent quantity of evaluated embryos. Asterisks des-
ignate signifcant differences between the control and treated groups (
*
p < 0,05).
Grade 1 Grade 2 Grade 3 Degenerate
Control 46,84 (37) 32,91 (26) 15,19 (12) 5,06 (4)
Group A 61,73 (50) 17,28 (14)
*
7,41 (6) 13,58 (11)
Group B 65,28 (47)
*
13,69 (10)
*
11,11 (8) 9,72 (7)
Group C 51,35 (38) 32,43 (24) 2,70 (2)
*
13,51 (10)
Table 2. Number and percentage of embryo quality obtained from females treated with aqueous extract of oregano. Control vs. treated groups.
Numbers in parenthesis represent quantity of evaluated embryos. Asterisks designate signifcant differences between the
control and treated groups (
*
p < 0.05).
384
Benavides et al.
Rev. peru. biol. 17(3): 381 - 384 (Diciembre 2010)
HammerK.A.,CarsonC.F.&T.V.Ri1ley.1998.In-vitroactivityof
essential oils in particular Melaleuca allemifolia (tea tree)
oil and tea tree oil products, against Candida spp. Journal
ofAntimicrobialChemotherapy42:591-595.
Hammer K.A., C.F. Carson & T.V. Rilley. 1999.Antimicrobial
activity of essential oils and other plant extracted. Journal
ofAppliedMicrobiology86:985-599.
HoganB.,F.Constantini&E.Lacy.1986.Manipulatingthemouse
embryo. A Laboratory Manual. USA Cold Spring Harbor
Laboratory.
Jaloszysky K., A. Figiel & A. Wojdylo. 2008. Drying kinetics
and antioxidant activity of oregano. Acta Agrophysica
11(1):81-90
LamaisonJ.,C.Petitjean-Freytget&A.Carnat.1990.Rosmarinic
acid, total hydroxycinnamic derivates and antioxidant acti-
vity of Apiaceae borraginaceae and Lamiaceae medicinais.
Annales Pharmaceutiques Franaises 48:103-8.
Lans C., N. Turner, T. Khan, et al. 2007. Ethno veterinary medicines
used for ruminants in British Columbia, Canada. Journal
of Ethnobiology and Ethnomedicine. 3:11.
Lemonica I.P, D.C. Damasceno & L.C. Di-Stac. 1996. Study of
the embryotoxic effects of an extract of Roseniary (Ros-
marinasoffcinalisL.).BrazilianJournalofMedicaland
BiologicalResearch29:223-227.
Naghibi F., M. Mosaddegh, S. Mohammadi & A. Ghorbani. 2005.
Labiatae Family in folk Medicine in Iran: from Ethnobo-
tany to Pharmacology. Iranian Journal of Pharmaceutical
Research2:63-79.
Nazia A., S. Sabahat & T. Perween. 2007. Antibacterial effects of
Oregano (Origanum vulgare) against Gram Negative Ba-
cilli.PakistanJournalofBotany.39(2):609-613.
Nurmi A., T. Nurmi, J. Mursu, et al. 2006. Ingestion of Oregano Ex-
tract Increases Excretion of Urinary Phenolic Metabolites
inHumans.J.Agric.FoodChem.54:6916-6923.
Scheckel K., S. Degner & R. Romagnolo. 2008. Rosmarinic Acid
Antagonizes Activator Protein-1Dependent Activation
of Cyclooxygenase-2 Expression in Human Cancer and
Nonmalignant Cell Lines. The Journal of Nutrition 138:
20982105.
StanleyF.&C.Bower.1986.Teratogenicdrugsinpregnancy.Me-
dicineJournalofAustralia.145:596-599.
UlteeA,E.Kets&E.Smid.1999.MechanismsofactionofCarva-
crol on me food-bome pathogen Bacillus cereus. Applied
Environmental Microbiology. 65:4606-4610.
Yoshino K., N. Higashi & K. Koga. 2006.Antioxidant andAnti-
infammatoryActivities of Oregano Extract. Journal of
HealthScience52(2):169173.
ZavaD.T.,C.M.Dollbaum&M.Blen.1998.Estrogenandprogestin
bioactivity of foods, herbs and spices. Proceeding Society
ExperimentalBiologyMedicine217:369-78.
385

Efecto antitumoral de bomarEa cornigEra en sarcomas inducidos
Rev. peru. biol. 17(3): 385 - 388 (December 2010)
Rev. peru. biol. 17(3): 385 - 388 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Efecto antitumoral del extracto acuoso de Bomarea cornigera
(Alstroemeriaceae) en sarcomas inducidos en ratones
Jos Surez
1,2
*, Christian Villanueva
1, 2
, Claudia Rodrguez
1, 2
, Karito Lavado
1
,
Melissa Barbieri
2
, Luis Guzmn
1,2
, Ricardo Alfaro
1, 2
y Jos Pino
1
Antitumoral effect of the aqueous extracts of Bomarea cornigera (Alstroe-
meriaceae) on the sarcoma induced in mice
* Direccin para correspondencias
1 Laboratorio de Reproduccin y
Biologa de Desarrollo. Facultad
de Ciencias Biolgicas. Univer-
sidad Nacional Mayor de San
Marcos, Ciudad Universitaria, Av.
Venezuela s/n. Apartado postal
11-058, Lima 11.
2 Asociacin Presservaris. Calle
Felix Tello Mz K lot 2 Urb. Honor y
Lealtad, Surco. Lima, Per. Telfo-
no. 51 1 2577556.
Email Jos Suares:
jsuarez@presservaris.org
NOTA CIENTFICA
Presentado: 05/07/2010
Aceptado: 22/11/2010
Publicado online: 00/11/2010
Resumen
Se investig el efecto antitumoral del extracto acuoso del bejuco Bomarea cornigera. Ratones de la cepa Swiss
albina fueron inoculados con la lnea tumoral TG-180 por 15 das; luego del cual se separaron en 5 grupos
(n=5 por grupo). Se administro intraperitonealmente ciclofosfamida (control positivo), agua destilada (control
negativo) y el extracto en concentraciones de 1X, 2X y 4X; se evalu la morbilidad, mortalidad, el peso y la
longitud del sarcoma. Se encontr un efecto inhibidor del extracto de B. cornigera en el desarrollo del tumor
slido en ratones en los cuales se les transplanto el sarcoma TG-180. Las tasas de inhibicin fueron 87,44 y
8,52% despus de 17 das de tratamiento considerando la dosis 1X (ms baja) y 2X (intermedia), respectiva-
mente. Estos resultados sugieren que la administracin de extracto acuoso de B. cornigera va intraperitoneal
puede ser til como inhibidor del cncer.
Palabras clave: Bomarea cornigera, antitumor, planta medicinal, TG-180, cncer.
Abstract
We investigated antitumor effect of aqueous extract of Bomarea cornigera. Swiss albino mice strain were
inoculated with tumor cell line TG-180 for 15 days, after which they were separated into 5 groups (n= 5 per
group). Cyclophosphamide was administered intraperitoneally (positive control), distilled water (negative control)
and the aqueous extract at concentrations of 1X, 2X and 4X; the morbidity, mortality, weight and length of the
sarcoma were assessed. We found an inhibitory effect of extract of B. cornigera in the development of solid
tumor in mice where the TG-180 sarcoma was transplanted. The inhibition rates were 87.44 and 8.52% after
17 days of treatment, considering 1X dose (lowest) and 2X (intermediate), respectively. These results suggest
that administration of aqueous extract of B. cornigera intraperitoneally may be useful as a cancer inhibitor.
Keywords: Bomarea cornigera, antitumor, medicinal plant, TG-180, cancer.
Introduccin
Desde hace 3500 aos el hombre ha empleado las plantas
para el tratamiento del cncer y son ms de 3000 especies de
plantas las que se han reportado para el tratamiento de esta
enfermedad, las cuales inhiben, revierten o retardan la carcino-
gnesis multiestadio (Young-Joon et al. 2001). El periodo de
investigacin cientfca al respecto es mucho ms reciente, ya que
es en 1958 cuando se aisl la vinblastina, y como resultado de
ello, el Instituto Nacional del Cncer de los Estados Unidos de
Amrica (NCI) inici diversas investigaciones acerca de las plan-
tas con actividad anticancerosa, lo que condujo al aislamiento
y conocimiento del mecanismo de accin de sustancias como
las podoftoxinas, taxanos y camptotecinas. Posteriormente se
han aislado de plantas compuestos que se encuentran en fase
clnica como es el caso de la combretastatina A-4. (Vega-Avila
et al. 2006).
La medicina tradicional es una actividad mundialmente
reconocida y tiene una importancia econmica creciente. Sola-
mente en el ao 2007 se gastaron en todo el mundo 4 billones
de dlares por la venta de drogas anti cncer de origen vegetal
y es signifcativo que de los 141 medicamentos contra el cncer
que existen en el mercado de Estados Unidos de Amrica,
aproximadamente el 67% de stos son de origen natural (Vega-
Avila et al. 2006).
En los pases en desarrollo, la medicina tradicional es a
menudo el nico y valido tratamiento accesible (Bussmann &
Sharon 2006). Las investigaciones para encontrar una droga
anticncer efectiva han motivado a los cientfcos para investigar
la efcacia de los productos naturales en el tratamiento del cncer,
teniendo en cuenta que la literatura indica que mucha gente se
cura del cncer usando solo productos naturales las cuales en
su mayora tienen efecto antiproliferativos y mejorador de la
respuesta inmune entre otros. Segn Fabricant y Farnsworth
(2001), el 80% de 122 drogas derivadas de plantas estaban
relacionadas a su propsito etnofarmacolgico original, dichas
plantas eran originarias de los pases tropicales.
La familia Alstroemeriaceae est distribuida desde Venezuela
hasta Argentina especialmente en hbitats secos. En el Per, son
reconocidos dos gneros, Alstroemeria y Bomarea, y 85 espe-
cies bsicamente hierbas y enredaderas. El genero Bomarea se
distribuye desde Mxico hasta el norte de Argentina y Chile,
esta restringido a la cordillera (hasta los 5200 m de altitud). El
centro de diversidad es Ecuador y Per (Hofreiter & Rodr-
guez 2006) y la mayora de ellas son ornamentales. Bussmann
& Sharon (2006) publicaron un compendio de plantas me-
dicinales utilizadas en el norte del Per y sealaron a Bomarea
dulcis (Hook.) Beauv. como una planta usada para proteger y
prevenir enfermedades. Bomarea cornigera Herb. es un bejuco,
endmico del Per, conocido solo en el centro del pas, en unas
pocas localidades, en la cuenca del Tulumayo. Si bien el valle de
Chanchamayo ha sido extensamente alterado ecolgicamente,
esta especie ha sido registrada en diferentes aos desde el siglo
XIX. (Len & Salinas 2006).
386
Surez et al.
Rev. peru. biol. 17(3): 385 - 388 (Diciembre 2010)
La ciclofosfamida es una droga alquilante antineoplsica,
utilizada para desacelerar o detener el crecimiento de clulas
cancerosas (linfomas, mielomas mltiples, leucemias, neuro-
blastoma, carcinoma ovrico, retinoblastoma, cncer del seno,
etc.) (Pino et al. 2009).
Material y mtodos
Se utilizaron ratones machos (Mus musculus) de la cepa albina
Swiss de 6 a 8 semanas de edad y de 20 30 g de peso fueron
obtenidos del Bioterio del laboratorio de Reproduccin y Bi-
ologa del Desarrollo de la Facultad de Ciencias Biolgicas de la
Universidad Nacional Mayor de San Marcos. Todos los ratones
fueron mantenidos bajo un rgimen de 14 horas luz y 10 horas
oscuridad, 22 24 C, 75 85 % HR y alimentados con alimento
balanceado para animales (Purina, Per), y agua ad libitum.
Bejucos de Bomarea cornigera Herb. fueron obtenidos de
las comunidades indgenas Ashaninka de la provincia
de Chanchamayo, departamento de Junn, en el mes de
noviembre de 2005. En el laboratorio, fueron identifcados por
las claves vigentes (Hofreiter & Rodrguez 2006).
Se utilizaron una solucin R10 (RPMI 1640 Sigma-
Aldrich), suplementado con suero bovino fetal inactivado
(Gibco), solucin hepes 1M (Sigma) y L-Glutamine-
Pe-Streptomycin (Sigma), ciclofosfamida (CP) [N, N - bis
(2 - cloroetil) tetrahidro - 2H -1, 3, 2 oxazafosforin - 2 -
amino 2 - oxido] - Endoxan 200 mg, agua destilada, y Azul
de Trypan.
Para la preparacin del extracto acuoso, se hirvieron nudos
(8 10 g) del tronco del bejuco en agua destilada por cada
dosis, durante 30 min hasta obtener una infusin en re-
cipientes conteniendo: 2 nudos en 1000mL (1X), 2 nudos
en 500 mL (2X) y 2 nudos en 250 mL (4X) mL de agua,
las dosis se mantuvieron a una temperatura de -20 C en
condiciones de esterilidad para su uso diario.
Para formar los tumores slidos se trabajo con clulas de la
lnea TG180. Las clulas fueron descongeladas a bao mara
durante 1 minuto, luego se aadi al vial 1mL de solucin
R10 (RPMI 1640 - Sigma-Aldrich suplementado con Suero
Bovino Fetal inactivado Gibco, Solucin Hepes 1M Sigma
y L-Glutamine-Pe-Streptomycin Sigma) y se traslado todo el
contenido a un tubo Falcon de 15 mL con 8 mL de R10 a
4 C. Las clulas de sarcoma fueron lavadas 3 veces cen-
trifugndolas a 500 g por 10 min a 5 C. Las clulas fueron
estabilizadas en R10 (37 C, 5% de CO
2
) durante 4 h.
Para determinar la viabilidad y recuperacin, se determin
la concentracin clulas de sarcoma mediante el conteo de
clulas viables y no viables teidas con un colorante vital (Azul
de Trypan) y con ayuda de un microscopio compuesto. Con
esos datos se calculo la viabilidad con la formula (Clulas vivas/
clulas totales x100).
Cada ratn fue inyectado subcutneamente (dorso) con 105
clulas/100 L. Luego de la inoculacin los ratones fueron ob-
servados (comportamiento, respiracin e irritabilidad) a los 30,
60, 120, 360 y 720 minutos posteriores al inoculo y luego cada
24 h, a fn de evaluar cualquier cambio que nos indique alguna
reaccin secundaria durante el proceso de colonizacin del de
las clulas tumorales. Se espero 15 das para que el sarcoma se
desarrollara, luego de lo cual se inicio la fase del tratamiento.
Diseo experimental.- Los ratones fueron distribuidos
al azar en cinco grupos (n= 5, cada grupo) de tratamiento:
Al grupo control positivo (TI), se le inyect intraperitone-
almente (i.p.) Ciclofosfamida (0,3 mg/mL), a los Grupo TII
(1X), Grupo TIII (2X), Grupo TIV (4X) se les inyecto va i.p.
las dosis preparadas y guardadas; y al control negativo (TV),
se le inyecto i.p. agua destilada (Grochow & Ames 1997); Los
tratamientos fueron aplicados una vez al da, a la misma hora
(12:00 m) durante 17 das.
Evaluacin de los ratones.- Al fnalizar el periodo de
tratamiento los animales fueron eutanizados por dislocacin
cervical y se procedi a realizar la extraccin de los tumores
(Bezerra et al. 2006). Para ello se realiz una diseccin alrededor
del tumor, teniendo mucho cuidado de no comprometer
la integridad de este. Luego el tumor fue limpiado de grasa y
piel. Los parmetros evaluados en los tumores fueron: peso y
dimetro (balanza analtica y vernier, respectivamente). La
tasa de inhibicin (%) fue calculada por la siguiente formula:
Tasa de inhibicin (%) = [(A B)/A] x 100
Donde A es el peso promedio del tumor del control nega-
tivo, y B es el peso del tumor en el grupo tratado. Se reviso,
adems otros rganos como hgado, riones, pulmn,
estomago, pncreas, intestinos y corazn en busca de alguna
anomala morfolgica con ayuda de un microscopio de
diseccin.
Anlisis estadsticos.- Los resultados fueron expresados como
medias D.S. y analizados por la prueba de ANOVA para un
factor y el Test de Tukey (SPSS 15), p<0,05 fue considerado
estadsticamente signifcativo.
Resultados
El extracto acuoso de B. cornigera inhibi al sarcoma 180 (TG
180) en el ensayo in vivo en ratones (Tabla 1). El tamao del
tumor decreci y la tasa de inhibicin aumento con el tiempo
en el grupo tratamiento II (1X) comparado con el control, esto
fue ms evidente en los ltimos das de observacin.
Viabilidad de la lnea celular TG 180
El nmero de clulas TG180 iniciales en el vial fue 12,3 x 10
6
;
luego de realizar el primer recuento se obtuvo 9,5 x 10
6
clulas
vivas y 1,75 x 10
6
clulas muertas lo que signifca una viabilidad
del 84,49% y una recuperacin del 91,46%, mientras que
luego del establecimiento de las clulas en el segundo recuento
se consigui una viabilidad del 82,95% y una recuperacin
del 82,95%.
Estos resultados demuestran que las clulas se encontraban
en ptimas condiciones para ser inoculadas en los ratones.
Se logro formar tumores slidos a partir de clulas TG180
en el 100% de los ratones inoculados.
Peso y longitud del tumor
Al evaluar los datos de peso y longitud del tumor entre los
diferentes tratamientos se observ que el tratamiento II (1X)
tuvo efectos similares a los observados al grupo tratado con
ciclofosfamida. Sin embargo, al evaluar las otras dosis de Bejuco
se observo que stas no tuvieron efecto alguno sobre los tumores
tratados, siendo la respuesta similar a la del control negativo. Al
evaluar los rganos de los ratones no se observaron alteraciones
morfolgicas visibles.
387

Efecto antitumoral de bomarEa cornigEra en sarcomas inducidos
Rev. peru. biol. 17(3): 385 - 388 (December 2010)
Discusin
El presente trabajo reporta la actividad antitumoral del
extracto acuoso de Bomarea cornigera en ratones a los cuales
se les transplant subcutneamente clulas de Sarcoma 180.
El Sarcoma 180 es un tumor originario de ratones y uno de
las mas frecuentes lneas celulares utilizados en investigaciones
in vivo relacionados a los agentes antitumorales (Bezerra et al.
2006). Los resultados obtenidos muestran que la infusin de
B. cornigera a la concentracin 1X posee un efecto antitumoral,
tanto en trminos de peso como en longitud, similar al de la
Ciclofosfamida (Tabla 1), sin embargo la Ciclofosfamida posee
un ndice teraputico muy bajo y es frecuente encontrar efectos
txicos especialmente en pacientes que han recibido tratamiento
inmunosupresor, adems de ser potencialmente teratognico.
Dentro de las principales reacciones adversas de la ciclofosfamida
tenemos toxicidad hematologa, astenia, malestar general, infer-
tilidad y alopecia (Grochow & Ames 1998; Sallan et al. 2006).
Es por ello la importancia de encontrar tratamientos alternativos
con plantas medicinales que muestren una efcacia similar pero
sin presentar efectos adversos, lo que repercutira directamente
en mejorar la calidad de vida de los enfermos de cncer que
actualmente estn bajo tratamiento quimioteraputico (Natesan
et al. 2007, Xie et al. 2008, Xue et al. 2009).
Aunque se podra esperar una mayor efcacia como efecto
antitumoral a mayor concentracin de la infusin, esto no fue
as ya que se encontr a 1X la mayor reduccin y eliminacin
del tumor, debido a una sobresaturacin de los componentes
activos sobre el sustrato. Nuestra observaciones de los rganos
como hgado, estomago, rin, pulmones y cerebro no encon-
traron daos. Sin embargo es necesario realizar estudios sobre
los posibles efectos txicos de la infusin de B. cornigera en
los sistemas biolgicos. Segn Rao et al. (2008) cuando se ha
utilizado Withaferina A (obtenida de la solanacea Withania
somnifera) en ratones inoculados con sarcoma 180, se observ
un retardo signifcativo del crecimiento tumoral en dosis de 10,
12, 15 mg/kg de peso corporal, sin evidenciar ninguna toxicidad
sistmica notable.
En la mayora de los casos, los ftoqumicos contra el cncer,
aislados de plantas medicinales, actan como potentes antioxi-
dantes o antagonistas de los radicales libres y de esta manera
minimizan el dao al DNA previniendo el cncer (Madhuri &
Pandey 2009). Otros fotoqumicos son inhibidores de la lipo-
oxigenasa y de la urokinasa (Rao et al. 2008). Igualmente, los
favonoides tienen un rol quimo preventivo en el cncer a travs
de sus efectos en la transduccin de seales en la proliferacin
celular (Rajkapoor et al. 2004).
El mecanismo de accin responsable de la actividad antitu-
moral de la infusin de B. cornigera aun no est elucidado, sin
embargo actualmente se est estudiando a nivel mundial el rol
que tienen las sustancias naturales de diferentes plantas con
propiedades medicinales sobre los diferentes sistemas biolgicos
del organismo para demostrar su efecto antitumoral, entre el-
los tenemos los que buscan factores de inhibicin de la mitosis
(Bezerra et al. 2006), aquellos que estimulan al sistema inmune
(Malik et al. 1991, Ismaili et al. 2009) o los que actuaran sobre
el material gentico (Hu et al. 2007), es por ello la importancia
de disear pruebas posteriores como el ELISPOT con la cual
podramos medir el grado de expresin del INF- por parte de
los linfocitos T (Alzamora et al. 2007) y que permitiran escla-
recer a qu nivel estara actuando la infusin de B. cornigera;
adems de anlisis que permitan determinar la composicin
qumica de la infusin y establecer las fracciones que contienen
los principios activos.
El presente estudio in vivo puntualiza la potencial actividad
antitumoral de B. cornigera, sin embargo es importante sealar
que se requieren estudios posteriores a fn de caracterizar los
principios activos y elucidar los mecanismos biolgicos por los
cuales la infusin estara teniendo este efecto.
Literatura citada
AlzamoraL.,E.lvarez,D.Torres,H.Sols,ColonaE.etal.2007.
Efecto de cuatro ecotipos de Lepidium peruvianum Chacn
sobre la produccin de xido ntrico in vitro. Rev. peru.
biol.nmeroespecial13(3):215217.
Bezerra D., F. Castro, A. Alves, et al. 2006. In vivo growth-inhibition
of Sarcoma 180 by piplartine and piperine, two alkaloid
amides from Piper. Brazilian Journal of Medical and Bio-
logicalResearch39:801807.
Bussmann R. & D. Sharon. 2006. Traditional medicinal plant use
in Northern Peru: tracking two thousand years of healing
cultura. Journal of Ethnobiology and Ethnomedicine 2:47
[http://www.ethnobiomed.com/content/2/1/47].
Fabricant D.S., & N. R. Farnsworth. (2001). The value of plants
used in traditional medicine for drug discovery. Environ
HealthPerspect109:69-75.
GrochowL.&M.Ames.(Eds.).1998.AClinician'sGuidetoChe-
motherapy PharmacoKinetics and Pharmacodynamics.
Lippincott Williams & Wilkins Publishers.
Hofreiter A. & E. Rodriguez. 2006. The Alstroemeriaceae in Peru
andneighbouringareas.Rev.peru.biol.13(1):569.
Tratamiento Peso (g) Longitud (mm) Eliminacin tumor
Control Negativo
Tumor 0,92806
a
14,26
a
0/5
Inhibicin % - -
Control Positivo
Tumor 0,1752
b
5,28
b
3/5
Inhibicin % 81,12 62,97
Tratamiento 1X
Tumor 0,11652
b
3,98
b
3/5
Inhibicin % 87,44 72,09
Tratamiento 2X
Tumor 0,849
a
10,64
a
1/5
Inhibicin % 8,52 25,39
Tratamiento 4X
Tumor 0,77136
a
11,93
a
1/5
Inhibicin % 16,88 16,34
a y b indican diferencias estadsticamente signifcativas P<0,05.
Tabla 1. Efecto (en porcentaje) de la infusin de extracto acuoso de Bomarea cornigera sobre la inhibicin de tumores inducidos por clulas
de Sarcoma TG180 en ratones.
388
Surez et al.
Rev. peru. biol. 17(3): 385 - 388 (Diciembre 2010)
Hu S., S. Chen, X. Li, R. Qin, & Z. Mei. 2007. Antitumor effects of
Chi-Shen extract from Salvia miltiorrhiza and Paeoniae
radix on human hepatocellular carcinoma cells. Acta Phar-
macologica Sinica 28 (8): 12151223.
Ismaili N.Y. Bensouda, N. Mellas & H. Errihani. 2009. Role of
chemotherapy in the management of primary rectal lym-
phoma: a case report and review of the literatura. Cases
Journal2:9373
LenB.&N.Salinas.2006AlstroemeriaceaeendmicasdelPer.
Rev.peru.biol.Nmeroespecial13(2):685689.
MadhuriS.&G.Pandey.2009.Someanticancermedicinalplantsof
foreignorigin.CurrentScience96(6):779-783.
MalikS.,R.Knowles,N.East,etal.1991.AntitumorActivityof
-y-Interferon in Ascitic and Solid Tumor Models of Human
OvarianCancer.CancerResearch51:6643-6649.
Natesan S., S. Badami, S. Dongre & A. Godavarthi. 2007. Antitumor
Activity and Antioxidant Status of the Methanol Extract
of Careya arborea Bark Against Daltons Lymphoma
Ascites-Induced Ascitic and Solid Tumor in Mice. Journal
of Pharmacology Science 103:12 23.
PatelB.,D.Sattwik,R.Prakash&M.Yasir.2010.NaturalBioac-
tive Compound with Anticancer Potential. International
Journal of Advances in Pharmaceutical Sciences 1:32-41.
PinoJ.,M.Noblecilla,P.Daz,etal.2009.Efectodelextractoacuoso
de Uncaria Tomentosa Wiild D.C. sobre la calidad espe-
rmtica de ratones tratados con Ciclofosfamida. Revista
Cientfca6(3):244-249.
RajkapoorB.,B.Jayakar,&N.Murugesh.2004.Antitumoractivity
of Indigofera aspalathoides on Ehrlich Ascites carcinoma
on mice. Indian Journal of Pharmacology 36(1): 38-40.
Rao G., S. Kumar, M. Islamand & S. Mansour. 2008. Folk medicines
for anticancer therapy-a current Status. Cancer Therapy
6:913-922.
Sallan S., B. Camitta, D. Chan, D. Traggis, & N. Jaffe. 2006. Che-
motherapy with cyclophosphamide, vincristine, cytosine
arabinoside, and prednisone (COAP) in childhood acute
lymphoblastic leukemia (ALL). Medical and Pediatric
Oncology 3 (4):359364.
Vega-vila E., R. Velasco-Lezama & M. Jimnez-Estrada. 2006.
Las plantas como fuente de compuestos antineoplsicos.
Revisin.Bioquimia31(3):97-111.
XieY.,T.Morikawa,K.Nimomiya,etal.2008.MedicinalFlowers,
XXIII. New Taraxastane-Type Triterpene, Punicanolic
Acid, withTumor Necrosis Factor InhibitorActivity
from the Flowers of Punica granatum. Chemical Pharmacy
Bulletin 56(11):1628-1631.
XueZ.,W.Yu,M.Wu,&J.Wang.2009.InVivoAntitumorand
Antioxidative Effects of a Rapeseed Meal Protein Hydroly-
sate on an S180 Tumor-Bearing Murine Model. Bioscience
Biotechnology Biochemistry. 73 (11):2412-2415.
Young-JoonS.,Hye-KyungN.,Ji-YoonL.&Y.SamKeum.2001.
Molecular Mechanisms Underlying Anti-Tumor Promot-
ing Activities of Heat-Processed Panax ginseng C.A.
Meyer. Journal of Korean Medicine Science 16 (Suppl):
S38-41.
389

Efecto citoprotector del camu-camu myrciaria Dubia
Rev. peru. biol. 17(3): 389 - 392 (December 2010)
Rev. peru. biol. 17(3): 389 - 392 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
Efecto citoprotector del camu-camu Myrciaria dubia en tres lneas
celulares de ratn expuestos in vivo a bromato de potasio
Alvis Rafael*, Pino Jos, Gonzles Jos, Francia Juan C., y Betty Shiga
Citoprotective effect of camu-camu Myrciaria dubia on three celular lines
of mouse exposed in vivo to potassium bromate
* Autor para correspondencias:
Laboratorio de Reproduccin y
Biologa de Desarrollo. Facultad
de Ciencias Biolgicas. Universidad
Nacional Mayor de San Marcos,
Casilla 11-058, Lima 11, Per. Tel.:
+51 6 197000 1529; fax: +51 6
197000 1509.
E-mail Alvis Rafael: ralvisd@gmail.
com
NOTA CIENTFICA
Presentado: 21/06/2010
Aceptado: 28/12/2010
Publicado online: 00/11/2010
Resumen
Se evalu in vivo la capacidad citoprotectora del fruto de Myrciaria dubia (Kunth) McVaugh Camu-camu frente
al dao mutagnico producido por bromato de potasio (68,5 mg/k) sobre tres lneas celulares de ratn (hgado,
rin y clulas sanguneas). Se utiliz ratones (n= 120) divididos en tres grupos los cuales bebieron ad libitum:
TI= control negativo (solo agua) y el grupo TIII (control positivo); El grupo TII bebi el extracto acuoso (2% p/v)
del fruto de camu-camu. A los diez das se inyect una dosis nica de KBr0
3
(68,5 mg/kg peso corporal) va
intraperitoneal, a los grupos TII y TIII. El tratamiento con camu-camu continuo 35 das ms, luego los ratones
fueron eutanizados para determinar la frecuencia del dao al DNA mediante el protocolo del ensayo cometa
alcalino. El grupo TII mostr en todas las lneas celulares el efecto citoprotector del camu-camu (p< 0,05). El
efecto daino al DNA por la accin oxidativa del KBrO
3
es inhibido por el extracto acuoso del fruto de camu
camu, probablemente por la presencia de los agentes antioxidantes como el Acido ascrbico y los favonoides.
Palabras clave: Camu-camu, Myrciaria dubia, Bromato de potasio, genotoxicidad, ensayo cometa.
Abstract
It was evaluated in vivo the cytoprotective capacity of the fruit of Myrciaria dubia H.B.K. MC VAUGH "Camu-
camu (Myrtacea) against mutagenic damage caused by potassium bromate (68.5 mg/k) on three mouse cell
lines (liver, kidney and blood cells). Mice (n = 120) were divided into three groups which drank ad libitum:
distilled water; TI (negative control) and TIII (positive control), the TII group (positive control) drank the aque-
ous extract (2 %) of the fruit of Camu-camu. After ten days, only the TII and TIII groups were intraperitoneally
injected with a single dose of KBr03(68.5 mg/k). The camu-camu treatment lasted 35 days more, where they
were euthanized to determine the frequency of DNA damage by means of the alkaline comet assay protocol.
It was observed in all cell lines a cytoprotective effect of camu-camu (p<0.05) with respect with the negative
control. The DNA-damaging effects of oxidative KBrO
3
action is inhibited by the 2% aqueous extract of camu-
camu fruit, probably by the presence of antioxidants such as ascorbic acid and favonoids.
Keywords: Camu-camu, Myrciaria dubia, Potassium bromate, genotoxicity, alkaline comet assay.
Introduccin
El Bromato de potasio (KBrO
3
) es una sustancia ampliamente
utilizada para mejorar la calidad de la harina en la industria
panifcadora. Este aditivo aumenta y mejora la consistencia de
la masa, adems acta como agente blanqueador favoreciendo
la presentacin del producto y reduciendo el costo del consumo
de energa en la coccin (Ribotta et al. 1999). Durante la coc-
cin, el KBrO
3
se reduce en un compuesto llamado Bromuro
de Potasio (BRK) (Cunningham & Anderson 1956); esta re-
duccin es a veces incompleta y el producto residual del KBrO
3

permanece en el gluten, por lo que es una fuente potencial de
dao oxidativo al ingerirla (Kasai et al. 1987). Desde 1992, la
Organizacin Mundial de la Salud (OMS) y la Organizacin
de las Naciones Unidas para Agricultura y Alimentacin (FAO)
consideran al KBrO
3
como sustancia nociva para los humanos,
debido a que su ingestin prolongada puede causar vmitos,
diarreas, metahemoglobinemia y daos renales (Watanabe
et al. 2004); adems, tiene efectos mutagnicos, destruye la
vitamina B
1
, inhibe la disponibilidad del hierro y degrada el
cido flico (Budavari et al. 1989). Las propiedades citotxicas,
mutagnicas y genotxicas del KBrO
3
radican en su capacidad
de generar especies reactivas de oxigeno (ROS) y especies oxido
de nitrgeno (NOS), que producen entre otras alteraciones la
peroxidacin lipdica y oxidacin del DNA (Nakae et al. 2002);
reportndose daos al rin (mesoteliomas) (Kaya & Topakta
2007), y el incremento signifcativo de la frecuencia de clulas
micronucleadas (Hayashi et al. 1988, Poul et al. 2004). Ha sido
reportado que una simple administracin de KBr0
3
tiene el po-
tencial para activar al 8-hidroxideoxiguanosina (8-OH-dG), un
marcador representativo del dao oxidativo al DNA en riones
en ratas machos. El 8-OH-dG es el promotor mas importante
de mutaciones y el inductor inicial de tumores provocado por el
KBrO
3
(Khan et al.2003). Teniendo en cuenta estos anteceden-
tes, algunos pases han prohibido el uso de bromato de potasio
en la produccin de pan. Sin embargo, el uso de KBrO
3
todava
se da en la panifcacin artesanal (Kaya & Topakta 2007).
El camu-camu, Myrciaria dubia (Kunth) McVaugh es una
especie frutal amaznica perteneciente a la familia de las Mir-
tceas. Posee un alto contenido de cido ascrbico (AsA) (entre
2780-4000 mg/100 g de pulpa) segn investigaciones realizadas
en Brasil (Justi 2000) y Per (Ascua et al. 1997). El AsA es un
potente antioxidante soluble en agua el cual elimina de manera
efcaz los radicales libres (Frei 1989). Adems se ha reportado
la presencia de favonoides en este fruto, los cuales optimizan la
accin del AsA (Ramberg 2003). Diversos estudios vienen dem-
ostrando las propiedades antimutagnicas (Ghaskadbi & Vaidya
1989, Khan & Sinha 1993, Kojima et al. 1992), antigenotxicas
(Hoda & Sinha 1993); anticlastognicas (Vijayalaxmi & Venu
1999) del cido ascrbico debido a su capacidad antioxidatva
frente a la accin de los radicales libres (Chatterjee et al. 1995,
Khan & Sinha 1993).
390
Rafael et al.
Rev. peru. biol. 17(3): 389 - 392 (Diciembre 2010)
El uso del ensayo cometa se ha incrementado en los ltimos
aos para evaluar dao oxidativo al DNA provocado por com-
puestos genotxicos (Poul et al. 2004, Olive & Banth 2006).
La popularidad de esta prueba se basa en su sensibilidad, relativo
bajo costo y simplicidad (Garca et al. 2007). La manera ms
comn para visualizar el efecto cometa es utilizando colorantes
fuorescentes como DAPI, bromuro de Etidio, naranja de ac-
ridina, etc.; estos colorantes no necesitan un tratamiento especial,
aunque el uso de un microscopio de fuorescencia es podra ser
un limitante; sin embargo los colorantes a base de plata ofrecen la
posibilidad de colorear los cometas (dao al DNA) y visualizarlo
a travs de un microscopio convencional.
El presente estudio se prueba el extracto acuoso del fruto de
Myrciaria dubia como un posible citoprotector del dao oxida-
tivo producido por KBrO
3
sobre el DNA de clulas polimorfo-
nucleares de sangre venosa y de dos tipos celulares procedentes
de hgado y rin.
Material y mtodos
Bromato de Potasio (KBrO
3
) (CAS: 7758-01-2), metanol
absoluto (Carlo Erba); Suero Albmina de Bovino (BSA), Bufer
Fosfato Salino (PBS) pH 7,2, y Giemsa (Sigma).
Se utilizaron 10 ratones machos Swiss albino Rockefeller de
6 a 8 semanas de edad, para cada tratamiento mantenidos bajo
condiciones de bioterio de 14 horas Luz y 10 horas oscuridad,
alimentados con alimento balanceado para animales (Purina,
Per), y agua ad libitum.
Frutos y muestras botnicas de camu-camu, Myrciaria dubia
(Kunth) McVaugh fueron colectados en la ciudad de Pucallpa
(Per), para su posterior identifcacin con claves y tratamiento
en el Laboratorio de Reproduccin y Biologa del Desarrollo
(UNMSM); la pulpa de los frutos de camu-camu fueron ex-
trados y secados a 60 C por 24 horas. Luego se prepar un
extracto acuoso al 10% (p/v) por 24 horas a 60 C. Despus
de las 24 horas el extracto es decantado, fltrado, cuantifcado
y guardado a -20 C, con este extracto se prepar otro extracto
acuoso fnal al 2% (p/v).
Tratamiento.- Se establecieron 3 tratamientos: TI= Control
Negativo, TII= camu-camu + KBrO
3
(68,5 mg/kg) y TIII=
Control Positivo (KBrO
3
;

68,5 mg/kg). Los tratamientos fueron
aplicados por un periodo de 35 das. Para el TI, se administro
agua ad libitum. En el TII se utiliz el extracto acuoso (50 mg/k)
de camu-camu, administrado ad libitum durante 10 das. A partir
del dcimo da de tratamiento se inyect intraperitonealmente
(i.p.) KBrO
3
. Simultneamente se continu administrando
el extracto acuoso de camu-camu. Se tomaron datos de peso
inicial y peso fnal.
Evaluacin.- Para cada tratamiento los ratones fueron euta-
nizados por dislocacin cervical. Se registr el peso del hgado
y del rin de cada ratn.
Ensayo cometa.- Se utiliz el protocolo de Singh et al. (1988)
modifcado por Tice et al. (2000) para tejidos animales.
Las clulas del tejido sanguneo fueron homogenizados en
una solucin salina suplementada con Na
2
EDTA; de inmediato
se mezclaron con agarosa de bajo punto de fusin a 37 C, luego
se verti la agarosa sobre un portaobjetos previamente recubierto
con agarosa de punto de fusin normal, despus de solidifcarse
la segunda capa se le cubri con otra de agarosa de bajo punto
de fusin. Las lminas fueron incubadas en solucin de lisis 2,5
M NaCl, 100 mM Na
2
EDTA, 10 mM Trizma, HCl, pH 12,1,
Triton X-100 a 4 C por 1 hora en una cubeta de electroforesis
horizontal. La corrida se efectu en el bufer 0,3 M NaOH 1
mM EDTA a 0,7 V/cm durante 30 minutos a 4 C.
Para la evaluacin de clulas de rin e hgado, porciones
de 0,01 g de tejidos procedentes de hgado y rin fueron
homogenizadas en una solucin de NaCl y Na
2
EDTA, obteni-
ndose un precipitado. Previamente se verti la agarosa sobre
un portaobjetos previamente recubierto con agarosa de punto
de fusin normal. Todos los tejidos animales fueron mezclados
con agarosa de bajo punto de fusin a 37 C; incubndose las
lminas en solucin de lisis 2,5 M NaCl, 100 mM Na
2
EDTA,
10 mM Trizma, HCl, pH 12,1 y Triton X-100 a 4 C por 1 h.
La corrida se realiz en una cubeta de electroforesis horizontal
durante 30 minutos a 4 C conteniendo bufer 0,3 M NaOH y
1mM EDTA. Todo el proceso se realiz con luz amortiguada.
La tincin fue realizada con una solucin de nitrato de plata
y se observ bajo un microscopio de campo claro. El grado de
dao al DNA sigui el patrn de clasifcacin descrito por Sotil
et al. (2007), el cual compara la cantidad observada en el ncleo
denominado cabeza con la extensin de DNA llamado cola;
se pueden considerar 5 niveles: Grado 0 o clulas no daadas, sin
cola; grado 1 o clulas ligeramente daadas, con cola menor al
tamao de la cabeza, grado 2 o clulas daadas, con cola igual al
tamao de la cabeza, grado 3 o clulas fuertemente daadas, con
cola mayor al tamao de la cabeza, y grado 4 o clulas en apoptosis.
Estadstica.- Los resultados obtenidos para todos los trata-
mientos fueron analizados por test de Kolmovorof-Smirnov
para comprobar si los resultados tenan una distribucin normal
(datos paramtricos). Una vez corroborados estos resultados
se aplico la Prueba Paramtrica de Tukey para la comparacion
de medias con diferencia signifcativa p<0,05; entre TI y cada
grupo de tratamiento.
Resultados
Segn el patrn de clasifcacin para determinar el dao en
el DNA no se observaron diferencias signifcativas (p<0,05)
entre TI y TII para las tres lneas celulares en estudio. Al com-
parar TI y TII con TIII respectivamente, se evidenci diferencias
signifcativas (p>0,05) con respecto al dao inducido por KBrO
3

(Tabla 1).

Discusin
Estudios in vivo e in vitro han demostrado el efecto citotxico,
genotxico y carcinognico del KBrO
3
en roedores (Perry &
Evans 1975, Carrano & Johnston 1977, Carrano et al. 1978).
Los resultados obtenidos en este estudio confrman el efecto
genotxico de KBrO
3
in vivo

para tres lneas celulares de ratn
(sangre, hgado y rin).
El hecho de no encontrar efecto sobre el peso corporal (dato
no publicado); ni alteracin clnica o en el comportamiento del
animal, sugiriere que los tratamientos no inducen a una toxicidad
sistmica en la dosis propuesta.
No se conoce el mecanismo especfco por el cual el bromato
de potasio induce los tumores. Se ha sugerido que el bromato
de potasio produce su respuesta toxica a travs de un dao
oxidativo como resultado del incremento de los niveles de
peroxido lipdico, la carcinognesis inducida por bromato sera
391

Efecto citoprotector del camu-camu myrciaria Dubia
Rev. peru. biol. 17(3): 389 - 392 (December 2010)
consecuencia de la peroxidacin lipdica y generacin de radicales
de oxigeno (ROS) que inducen el dao al DNA (Wolf et al.
1998) cambiando la expresin gnica por alteraciones en uno u
varios factores de transcripcin o mecanismos de transduccin
de seales (Suzuki et al. 1997).
El efecto protector de las sustancias antioxidantes contra la
genotoxicidad puede realizarse de tres maneras (O'Donoghue
et al. 1999): (1) disminuyendo la asimilacin de genotoxicantes
prooxidantes, (2) previniendo su formacin en la dieta misma;
como agente reductor en los lugares de accin de los prooxidante
e (3) induciendo enzimas de detoxicacin capaces de reducir a
los intermediarios activos de oxigeno.
Al analizar el efecto protector del extracto acuoso del fruto
de Myrciaria dubia mediante el ensayo cometa se evidenci que
no existen diferencias signifcativas entre TII y TI; este resul-
tado sugiere un efecto protector del extracto acuoso del fruto
del camu-camu frente al dao oxidativo de KBrO
3
. Levine et
al. (2001) encontr que el suplemento oral con vitamina C en
humanos disminuye el dao al DNA inducido por el peroxido
de hidrogeno (H
2
O
2
). Estudios in vivo en clulas humanas e
in vivo en roedores (Sai et al. 1992) demostraron que altas
concentraciones intracelulares de cido ascrbico reducen las
mutaciones causadas por el estrs oxidativo del KBrO
3
; es prob-
able que el alto contenido de AsA o vitamina C presente en el
fruto de camu-camu, sea la responsable del efecto protector
evidenciado en los resultados al encontrarse un nmero similar
de clulas de grado 0 entre TII y TI.
Segn Fenech et al. (1999, citado por Poul et al. 2004) el
bromato de potasio induce alteraciones permanentes a partir
de diferentes tipos de daos que pueden ser detectados en un
test de microncleo mediante el bloqueo de citocinesis. Estos
hallazgos indicaran que el bromato de potasio induce a un dao
del DNA por una serie de diferentes mecanismos adems del
estrs oxidativo.
Agradecimiento
Al Consejo Superior de Investigacin del Vicerrectorado de
Investigacin de la Universidad Nacional Mayor de San Marcos
por la ayuda econmica.
Literatura citada
AscuaY.M.,LiraJ.yP.C.Mouro.1997.Proyectodepre-factibili-
dad para la produccin de pulpa de camu-camu (Myrciaria
dubia H.B.K. Mc. Vaugh) en Pucallpa. [TESIS], UNAM.
BudavariS.,O'neilM.,SmithA.andP.E.Heckelman.1989.The
Merck Index: an Encyclopedia of Chemicals, drugs and
Biologicals. 11th ed. Rahway, NJ: Merck and Company,
Inc.
CarranoA.V.&G.R.Johnston.1977.Thedistributionofmitomycin
C-induced sister chromatid exchanges in the euchromatin
andheterochromatinoftheIndianmuntjac,Chromosoma
64:97107.
CarranoA.V.,ThompsonL.H.,LindiP.A.andJ.L.Minkler.1978.
Sister chromatid exchanges as an indicator of mutagenesis,
Nature 271: 551553.
ChatterjeeI.B,MukhopadhyayC.K.andM.K.Ghosh.1995.Vitamin
C: a potential savior against free radical induced oxidative
damage.CurrentScience;69(9):747751.
CunninghamD.andJ.Anderson.1956.Decompositionofbromate
in fermenting and nonfermenting doughs, Cereal Chem.
33:290299.
FreiB.1989.Ascorbateisanoutstandingantioxidantinhumanblood
plasma.PNASUSA;86:6377-381.
Garca O., Romero I., Gonzlez J. and T. Mandina. 2007. Measure- 2007. Measure-
ments of DNA damage on silver stained comets using
free Internet software. MutationResearch627:186190.
Ghaskadbi S. &V.Vaidya. 1989. In vivo antimutagenic effect of
ascorbic acid against the mutagenicity of the common
antiameobic drug diiodohydroxyquinoline. Mutation Res.
222:219222.
Hayashi M., Kishi M., Sofuni T., and M. Ishidate Jr. 1988. Mi-
cronucleus tests in mice on 39 food additives and eight
miscellaneous chemicals. Food Chemical Toxicology
26:487500.
HodaQ.andS.P.Sinha.1993.Vitamin C mediated minimisation
ofrogorinducedgenotoxicity.MutationRes.;229:29-36.
Justi K. 2000. Nutritional composition and vitamin C stability in
stored camu-camu (Myrciaria dubia) pulp. Arch. Lati-
noam. Nutr.Dec.;50(4):405-8.
Kasai H., Nishimura S., KurokawaY. andY. Hayashi.1987. Oral
administration of the renal carcinogen, potassium bromate,
specifcally produces 8-hydroxydeoxyguanosine in rat
targetorganDNA.Carcinogenesis8:19591961.
KayaF.&M.Topakta.2007.Genotoxiceffectsofpotassiumbro- Topakta.2007.Genotoxiceffectsofpotassiumbro-
mate on human peripheral lymphocytes in vitro. Mutation
Research 626: 4852.
Grado 0 Grado 1 Grado 2 Grado 3 Grado 4
Sangre
Control Negativo 93,60 1,32 3,40 1,28 0,80 0,37 1,20 0,48 0,60 0,24
Tratamiento 88,00 2,46* 5,80 0,86 * 3,40 1,43* 1,80 0,58 1,00 0,54
Control positivo 80,80 3,00 9,00 0,94 5,00 0,70 3,00 0,70 2,00 0,77
Rin
Control Negativo 96,40 0,81 1,60 0,24 0,60 0,24 0,80 0,97 0,80 0,37
Tratamiento 85,00 2,56* 9,00 2,02* 2,60 0,40* 1,60 0,40 1,60 0,24
Control positivo 86,00 2,02 6,80 1,01 3,40 0,74 1,60 0,50 3,00 1,04
Hgado
Control Negativo 94,00 0,54 3,20 0,58 1,60 2,44 0,80 0,20 0,50 0,28
Tratamiento 75,60 2,50* 12,80 1,39* 5,60 1,02 2,00 0,63 1,20 0,48
Control positivo 68,80 2,65 14,00 1,22 8,40 1,02 4,40 0,81 4,40 1,24
Tabla 1. Porcentajes promedio de clulas sanguneas observadas (en parentesis intervalo de confanza) segn los grado de dao al DNA
(Sotil et al. 2007) en la determinacion de la capacidad citoprotectora del fruto de Myrciaria dubia, Camu-camu, frente al dao mutagnico
producido por bromato de potasio sobre celulas de hgado, rin y sangre de ratn.
* Prueba de Tukey. Diferencia signifcativa p <0,05 comparando el tratamiento y los controles.
392
Rafael et al.
Rev. peru. biol. 17(3): 389 - 392 (Diciembre 2010)
Khan N., Sharma S. & S. Sultana. 2003. Nigella sativa (black cumin)
ameliorates potassium bromate-induced early events of
carcinogenesis: diminution of oxidative stress. Human &
ExperimentalToxicology22:193-203.
KhanP.&S.Sinha.1993.Antimutageniceffcacyofhigherdoses
ofvitaminC.MutationRes.;298:157161.
KojimaH,KonishiH,KurodaY.1992.EffectsofL-ascorbicacid
on the mutagenicity of ethlymethane sulfonate in cultured
mammaliancells.MutationRes.;266:8591.
LevineM.,WangY.,PadayattyS.J.,andJ.Morrow.2001.A new
recommended dietary allowance of vitamin C for healthy
young women Proc. National Academic Science U.S.A.
98:98429846.
Nakae D., Umemura T. andY. Kurokawa. (2002). Reactive oxy- Reactive oxy-
gen and nitrogen oxide species-induced stress, a mayor
intrinsic factor involved in carcinogenic processes and a
possibletargetforcancerprevention.AsianPacifcJournal
of Cancer Prevention 3:313-318.
O'DonoghueJ.,BarberE.D.,HillT.,AebiJ.andL.Fiorica.1999.
Hydroquinone: Genotoxicity and Prevention of Genotoxic-
ity Following Ingestion. Food and Chemical Toxicology
37:931-936.
Olive P. and J. Banth. 2006. The comet assay: a method to mea-
sure DNA damage in individual cells. Nature Protocols
1(1):2329.
Perry P. & H. Evans. 1975. Cytological detection of mutagen-
carcinogen exposure by sister chromatid exchange, Nature
258: 121125.
Poul J., Huet S., Godard T and P. Sanders. 2004. Lack of genotoxicity
of potassium iodate in the alkaline comet assay and in the
cytokinesis-block micronucleus test. Comparison to potas-
siumbromate.FoodandChemicalToxicology42:203209
Ramberg J. 2003. Why are Whole-Food Dietary Supplements Better
than Single-Nutrient Supplements? A Review Based in
theVitaminCLiterature.GlycoScience&Nutrition;Jul
Vol. 4, No. 4 : 1-8.
Ribotta,P.,MorcilloM.yA.Len.1999.Efectodedistintosoxi-
dantes sobre la calidad de panes elaborados por el mtodo
tradicional argentino. Agriscientia, Vol. XVI: 3-10.
SaiK.,UmemuraT.,TakagiA.,HasegawaR.andY.Kurokawa.1992.
The protective role of glutathione, cysteine and vitamin
C against oxidative DNA damage induced in rat kidney
by potassium bromate. Japan. J. Cancer Res., 83, 4551.
Singh N.P., Mccoy M.T., Tice R.R. and E.L. Scheider. (1988).A
simple technique for quantitation of low levels of DNA
damage in individual cells. Experimental Cell Research,
237: 123-130.
Sotil G., Alvis R., Francia J. y B. Shiga. 2007. Aplicacin de dos
biomarcadores para el anlisis de lesiones en el DNA
de bivalvos marinos. Rev. Per. Biol. Nmero especial
13(3):249-253.
SuzukiY.J.,FormanH.J.andA.Sevanian.1997.OxidantsasStimu- 1997.OxidantsasStimu-
lators of Signal Transduction. Free Radical Biology &
Medicine22,269-285.
Tice R.R., Agurell E., Anderson D., Burlinson B., Hartmann A.,
KobayashiH.,MiyamaeY.,RojasE.,RyuJ.C.andY.F.
Sasaki. 2000. Single cell gel/comet assay: guidelines for in
vitro and in vivo genetic toxicology testing. Environmental
and Molecular Mutagenesis 35, 206221.
VijayalaxmiK.K,andR.Venu.1999.Invivoanticlastogeniceffects
ofLascorbicacidinmice.MutationRes.;438:4751.
WatanabeS.,TajimaY.,YamaguchiTandT.Fukui.(2004).Potas- Potas-
sium Bromate-induced hyperuricemia stimulates acute
kidney damage and Oxidative Stress. Journal of Health
Science, 50(6): 647653.
WolfD.,CrosbyL.,GeorgeM.etal.1998.Timeanddose-dependent
development of Potasium bromate Induced tumors in
male Fischer 344 Rats. Toxicologic Pathology 26(6):724-
729.
393

Fe de errata
Rev. peru. biol. 17(3): 000- 000 (December 2010)
Rev. peru. biol. 17(3): 393 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
ISSN 1561-0837
FE DE ERRATA
La familia Conidae en el mar peruano
Carlos Paredes
1,2
, Franz Cardoso
1,2
, Katherine Altamirano, Paul Baltazar y
Leonardo Romero
1
The family Conidae from Peruvian Sea
1 Laboratorio de Biologa y Siste-
mtica de Invertebrados Marinos,
Facultad de Ciencias Biolgicas,
Universidad Nacional Mayor de
San Marcos, Apdo. 11-0058, Lima,
11, Per. Email Carlos Paredes:
cparedesq@unmsm.edu.pe
2 Departamento de Malacologa,
Museo de Historia Natural, Univer-
sidad Nacional Mayor de San Mar-
cos, Apdo. 14-0434, Lima 14, Per.
Comunicamos a nuetros lectores que en la leyenda de las Figuras 1 - 8, del trabajo La familia Conidae en el mar
peruano de Paredes et al., Rev. peru. biol. 17(1): 065- 073 (Abril 2010), debe considerarse el siguiente cambio:
Dice:
(5) Conus (Leptoconus) regularis
Debe decir:
(5) Conus (Leptoconus) recurvus
394
Fe de errata
Rev. peru. biol. 17(3): 000- 000 (Diciembre 2010)
A fortuitous ant-fern association in the Amazon lowlands of Peru
Blanca Len
1,2,3
and Kenneth R. Young
1
Una asociacin fortuita planta-hormiga en la Amazona baja del Per
FE DE ERRATA
1 Department of Geography & the
Environment, University of Texas
at Austin. Email Blanca Len:
blanca.leon@mail.utexas.edu
Email Kenneth R. Young:
kryoung@austin.utexas.edu
2 Plant Resources Center, Uni-
versity of Texas at Austin.
3 Museo de Historia Natural,
UNMSM, Av. Arenales 1256,
Lima-14, Peru.
Comunicamos a nuetros lectores que por error en la versin online fue omitida omitida la Tabla 1 en el trabajo
A fortuitous ant-fern association in the Amazon lowlands of Peru, de Len and Young, Rev. peru. biol. 17(2):
245 - 247 (Agosto 2010)
Plant species Tree Liana 1 Liana 2 Cordia nodosa
Asplenium pseudoangustum Stolze - - 8 -
Asplenium serratum L. 1 - - -
Microgramma reptans (Cav.) A.R. Sm. - 1 - -
Polytaenium cajenense (Desv.) Benedict - 2 1 2
Philodendron cf. heterophyllum Engl. - - - 1
Bryophytes +++ ++ + -
Table 1. Number of individuals and presence of epiphytes
Rev. peru. biol. 17(3): 394 (Diciembre 2010)
Facultad de Ciencias Biolgicas UNMSM
395
Rev. peru. biol. 17(2): 000- 000 (August 2010)
Colofn
396
Suscripciones y Canje
Subscriptions and Exchange programs
La Revista Peruana de Biologa aparece con una periodicidad semestral y esta dedicada a la publicacin de los resultados de
investigaciones originales e inditas en las reas de Biodiversidad, Biotecnologa, Manejo ambiental, Ecologa y Biomdicas. Los
trabajos recibidos son evaluados por rbitros segn criterios internacionales de calidad, creatividad, originalidad y contribucin
al conocimiento.
Te Revista Peruana de Biologa has a semester periodicity and publishes the results of original research in Biodiversity, Biotechnol-
ogy, Environmental management, Ecology and Biomedical areas. Papers in Spanish or English are peer-reviewed using international
criteria of quality, creativity, originality and the knowledge contribution.
Revista Peruana de Biologa
Suscripcin anual, costo incluye envo.
Annual subscription, mailing is included.
Per 150 nuevos soles
Other countries US$ 120
Nombre/name:..
Direccin postal/Full postal address:




Favor de extender Cheque certifcado u orden de pago a nombre de la Facultad de Ciencias Biolgicas-UNMSM.
Please make check or money order payable to Facultad de Ciencias Biolgicas-UNMSM.
Enviar a:
Send to:
Leonardo Romero
Editor, Revista Peruana de Biologa
Facultad de Ciencias Biolgicas-UNMSM
Casilla Postal: 11-0058
Lima-11,
Per
Mayor informacin dirigirse a:
For futher information contact:
Editor Jefe, Leonardo Romero
Telfono (511) 619-7000-1502/ Telefax (511) 619-7000-1509
email: editor.revperubiol@gmail.com
397
Rev. peru. biol. 17(2): 000- 000 (August 2010)
1. La Revista Peruana de Biologa es una publicacin cientfca arbitrada y es editada por el Instituto de Investigaciones de Ciencias
Biolgicas Antonio Raimondi, Facultad de Ciencias Biolgicas, Universidad Nacional Mayor de San Marcos, Lima, Per. Tiene una
periodicidad semestral y los nmeros aparecen en agosto y diciembre, tanto en su versin impresa como Online.
2. La Revista Peruana de Biologa recibe artculos completos, originales e inditos en los temas de biodiversidad, biotecnologa,
ecologa, manejo ambiental y biomedicina, elaborados segn las normas indicadas en las presentes pautas.
3. Los artculos pueden ser presentados en idioma ingls o castellano.
4. Los artculos sern evaluados por rbitros segn criterios internacionales de calidad, creatividad, originalidad y contribucin al
conocimiento. El artculo es aceptado luego del proceso de revisin por rbitros y las modifcaciones indicadas. El artculo aceptado
ser editado y una prueba enviada al autor para la aceptacin y consentimiento de publicacin.
5. El artculo deber ser presentado acompaado de una carta dirigida al Editor Jefe, frmada por el responsable del trabajo con quien
se tendr comunicacin, indicando adems el carcter indito, original y completo del artculo presentado y su disposicin para que
sea revisado y editado.
6. El artculo puede ser enviado por correo comn; en este caso por triplicado y adems los archivos digitales apropiados. El artculo
comprende el texto, con las pginas numeradas correlativamente. Las ilustraciones, en hojas aparte, comprenden las tablas y fguras.
7. El artculo tambin puede ser enviado por email al Editor Jefe. Los archivos deben ser enviados de acuerdo a las pautas indicadas
en el presente documento.
8. EL TEXTO del artculo debe ser escrito en tipo Courier 12 puntos, doble espacio, en A4. En general todos los artculos deben de
tener: Ttulo (en ingls y castellano), nombre y apellido de los autores, institucin de los autores, direccin postal y correo electrnico
de los autores, Resumen no mayor de 250 palabras (en ingls y castellano), 5 palabras clave (en ingls y castellano).
9. EL TTULO no debe de exceder de 20 palabras y debe expresar el contenido real del trabajo, si incluye un nombre genrico o
especfco se indicarn los taxa de referencia.
10. LOS AGRADECIMIENTOS deben dedicarse solamente a las personas e instituciones que colaboraron directamente en la realizacin
del trabajo.
11. La Revista cuenta con las siguientes secciones:
a. TRABAJOS ORIGINALES. Son artculos primarios, inditos que exponen los resultados de trabajos de investigacin y constituyen
aportes al conocimiento. Deben contener las siguientes partes: Ttulo, autores, Resumen (en ingls y castellano), palabras clave
(en ingls y castellano), Introduccin, Material y mtodos, Resultados, Discusin, Agradecimientos y Literatura citada. Todo el
artculo debe tener un texto promedio de 20 pginas, las ilustraciones deben ser slo las necesarias para una mejor exposicin de los
resultados.
b. NOTAS CIENTFICAS. Son artculos primarios, reportes de resultados cuya informacin es de inters para la comunidad cientfca. La
extensin del texto no ser mayor de 8 pginas. Esta seccin debe tener las siguientes partes: Ttulo, autores, Resumen (en ingls y
castellano), palabras clave (en ingls y castellano), cuerpo de la Nota, Agradecimientos y Literatura citada.
c. ARTCULOS DE REVISIN. Son artculos primarios, en esta seccin se incluyen trabajos que constituyen una exhaustiva revisin
del tema de investigacin del autor, se incluyen aqu tesis, revisiones taxonmicas y recapitulaciones. Deben contar las siguientes
partes: Ttulo, autores, Resumen (en ingls y castellano), palabras clave (en ingls y castellano), Introduccin, cuerpo de la revisin,
Agradecimientos y Literatura citada. Todo el artculo debe tener un texto promedio de 35 pginas. Las ilustraciones deben ser slo
las necesarias para una mejor exposicin de los resultados.
d. COMENTARIOS. Son artculos donde se discute y exponen temas o conceptos de inters para la comunidad cientfca. Se incluyen
aqu ensayos de opinin y monografas. Deben contar con las siguientes partes: Ttulo, autores, cuerpo del comentario, y Literatura
Citada. Todo el artculo debe tener un texto promedio de 10 pginas.
e. COMENTARIOS DE LIBROS. Son artculos que comentan recientes publicaciones de inters para la comunidad cientfca.
Puede solicitarse al Comit Editor la elaboracin de un comentario enviando dos copias del libro a la direccin postal de la Revista
Peruana de Biologa.
12. Cuando el artculo exponga sobre experimentos con humanos y animales, los procedimientos deben de ceirse a la Declaracin
de Helsinki de 1975 y a las leyes peruanas vigentes (Ley 27265). Deben ser presentadas las declaraciones pertinentes y mencionadas
en el texto.
13. Cuando el artculo exponga sobre nuevas especies, nuevos registros, ampliaciones biogeogrfcas o inventarios taxonmicos debe
indicarse el depsito de los ejemplares en un centro de referencia taxonmico.
14. Cuando los especmenes hallan sido colectados en reas protegidas, debe de indicarse los respectivos permisos.
15. Los nombres cientfcos del gnero y especie irn en cursivas. La primera vez que se cita un organismo deber hacerse con su
nombre cientfco completo (gnero, especie y autor); posteriormente podr citarse solamente la inicial del nombre genrico y el
nombre especfco completo.
16. Deben usarse los smbolos de las unidades del Sistema Internacional de Medidas. Si fuera necesario agregar medidas en otros
sistemas, las abreviaturas correspondientes deben ser defnidas en el texto. Decimales con coma, no punto (ejemplo correcto: 0,5;
incorrecto: 0.5).
17. LAS CITAS EN EL TEXTO deben incluir el apellido del autor y ao (ejemplo: (Carrillo 1988) o ... de acuerdo a Snchez (1976)
o (Chvez y Castro 1998, Rios 1999, Piedra 2001)). Si hay varios trabajos de un autor en un mismo ao, se citar con una letra
en secuencia adosada al ao (ejemplo: Castro 1952a). Cuando hay ms de dos autores se citar al primer autor y se colocar et al.
(Ejemplo: (Smith et al. 1981) o segn Smith et al. (1981)).
PAUTAS PARA LA PRESENTACIN DE LOS ARTCULOS EN LA REVISTA PERUANA DE BIOLOGA
Enero 2009
(Contina....)
398
18. La LITERATURA CITADA incluir todas las referencias citadas en el texto dispuestas solamente en orden alfabtico y sin numeracin.
La cita se inicia con el apellido del primer autor a continuacin, sin coma, las iniciales del nombre con puntos y sin espacio. El
segundo y tercer autor deben de tener las iniciales de los nombre y a continuacin el apellido. El ltimo autor se diferenciara por
que le antecede el smbolo &. Si hubiesen ms de tres autores pueden ser indicados con la abreviatura et al. En la literatura citada
solamente se usa letra tipo normal, no itlica, no versalita. Ejemplos:
a. Montgomery G.G., R.C. Best & M. Yamakoshi. 1981. A radio-tracking study of the American manatee Trichechus inunguis
(Mammalia: Sirenia). Biotropica 13: 81 -85.
b. Buhrnheim C.M. & L.R. Malabarba. 2006. Redescription of the type species of Odontostilbe Cope, 1870 (Teleostei: Characidae:
Cheirodontinae), and description of three new species from the Amazon basin. Neotrop. ichthyol. 4 (2): 167-196.
c. Nogueira R.M.R., M.P. Miagostovich, H. G. Schatzmayr, et al. 1995. Dengue type 2 outbreak in the south of the State of Bahia,
Brazil: laboratorial and epidemiological studies. Rev. Inst. Med. trop. S. Paulo 37 (6): 507-510.
d. McLachlan A. & A.C Brown. 2006. Te Ecology of Sandy Shores. Elsevier Science & Technology Books. 373pp.
e. Crawford D.J. 1983. Phylogenetic and systematic inferences from electrophoretic studies. In: S.D. Tanksley and T.J. Orton, eds.
Isozymes in plant genetics and breeding, Part A. Elsevier, Amsterdam. Pp. 257-287.
f. Pianka E.R. 1978. Evolutionary ecology. 2nd edn. New York: Harper & Row.
g. Carroll S.B. 2005. Evolution at Two Levels: On Genes and Form. PLoS Biol 3(7): e245. <http://biology. plosjournals.org/
archive/1545-7885/3/7/pdf /10.1371_journal.pbio.0030245-S.pdf >. Acceso 31/07/2005.
h. Food and Drug Administrations (FDA). 2001. Fish and Fishery Products Hazards and Controls Guidance. Tird Edition June
2001. <http://www.cfsan.fda.gov/~comm/haccp4.html> (acceso 24/12/07).
i. CONAM. 2005. (en lnea). Informe nacional del estado del ambiente 2001. <http://www.conam.gob.pe /sinia/INEA2001.
shtml>. Acceso 31/07/2005.
j. IMARPE. 2002. (en lnea). Segundo informe del BIC Jos Olaya Balandra. Paita Salaverry. 24 febrero- 05 Marzo 2002. <http://
www.imarpe.gob.pe /imarpe/informeolaya02-032002.php>. Acceso 01/07/2005.
k. Solari S.A. 2002. Sistemtica de Tylamys (mammalia: didelphimorphia: marmosidae). Un estudio de las poblaciones asignadas
a Tylamys elegans en Per. Tesis, Magster en Zoologa, mencin Sistemtica y Evolucin. Facultad de Ciencias Biolgicas
Universidad Nacional Mayor de San Marcos. <http://www.cybertesis.edu.pe/sisbib/2002/solari_ts /html/indexframes.html>.
Acceso 31/07/2005
19. Las citas de artculos en prensa deben incluir el volumen, el ao y el nombre de la revista donde saldrn publicados; de lo
contrario debern ser omitidos.
20. Deben evitarse las citas a resmenes de eventos acadmicos (congresos y otros) y las comunicaciones personales.
21. Las Figuras (mapas, esquemas, diagramas, dibujos, grfcos, fotos, etc.) sern numeradas correlativamente con nmeros arbigos;
de igual manera las Tablas. Las leyendas de las fguras deben presentarse en hoja separada del texto y deben ser sufcientemente
explicativas. Cada tabla debe llevar un ttulo descriptivo en la parte superior.
22. Cuando el trabajo es enviado por correo postal, las fguras sern presentadas en papel Canson y con tinta china, en un tamao
A4, montados sobre cartulina blanca. Los dibujos y fotos de estructuras y organismos deben llevar una escala grfca para facilitar
la determinacin del aumento. Los mapas deben llevar las respectivas coordenadas. Las fotografas deben tener 15x10 cm de tamao
como mnimo, en papel liso, con amplio espectro de tonos y buen contraste, montados sobre una cartulina blanca A4. Costos por
fotografas a color debern ser asumidos por el autor.
23. Si las fguras fuesen escaneadas, deben guardarse en un archivo TIFF, tamao natural, 600 dpi. Las grfcas de origen electrnico
deben de enviarse en formato nativo editable (achivo.xls, archivo.wmf, archivo.svg, archivo.eps). Los mapas en formatos SHP.
Fotos de cmaras digitales en formato JPGE mayor a 3Mpixel. Otros archivos independientes en formato TIFF, BMP, Ai, PSD.
Costos por ilustraciones a color sern asumidos por el autor.
24. Los archivos deben presentarse por separado, esto es, un archivo con el texto y leyendas en formato MS-Word. Otro archivo
para las tablas en MS-Excel o como tablas en MS-Word. Otros archivos en formatos nativos, no como imgenes insertadas
en otros archivos (por ejemplo no enviar imgenes pegadas en una hoja de MS-Word o Excel).
25. Slo se aceptan fotos e imgenes digitales de alta calidad.
26. El material enviado no ser devuelto, por lo que los autores deben tomar sus precauciones.
27. Una prueba del trabajo revisado, editado y diagramado adems del costo por impresin ser enviado al autor para su
aprobacin.
28. El autor principal podr solicitar cuatro ejemplares de la revista. Un nmero de separatas adicional podr ser solicitado antes
de la impresin teniendo en cuenta los costos respectivos.
Comit Editor
Email: editor.revperubiol@gmail.com
Correo postal: Leonardo Romero (Editor)
Revista Peruana de Biologa
UNMSM-FCB
Apartado 11-0058
Lima 11
Per
(continacin...)
Fe de errata
393 La familia Conidae en el mar peruano
Te family Conidae from Peruvian Sea
Carlos Paredes, Franz Cardoso, Katherine Altamirano, Paul Baltazar y Leonardo Romero
394 A fortuitous ant-fern association in the Amazon lowlands of Peru
Una asociacin fortuita planta-hormiga en la Amazona baja del Per
Blanca Len and Kenneth R. Young

(Contina...)
Revista PeRuana de Biologa
Volumen 17 Diciembre, 2010 Nmero 3
Rev. peru. biol. ISSN 1561-0837
Contenido
Editorial
273 Quiero ser citado
Leonardo Romero
Trabajos originales
277 Respuestas de los murcilagos a la fragmentacin del bosque en Pozuzo, Per
Responses of bats to forest fragmentation at Pozuzo, Peru
Jos Luis Mena
285 Caractersticas de una poblacin sobreexplotada de concha navaja, Ensis macha, en Baha Independencia, Per, durante el 2004
Overfshing population characteristics of razor clam, Ensis macha, from Independencia Bay, Peru, in 2004 year
Roberto Espinoza, Juan Tarazona y Jrgen Laudien
293 Varamientos y captura incidental de tortugas marinas en el litoral de Tumbes, Per
Stranding and incidental catch of sea turtles in the coastal Tumbes, Peru
Carlos A. Rosales, Manuel Vera y Jorge Llanos
303 Lista de cigarritas (Hemiptera: Cicadellidae) de Cusco, Per
Checklist of leafhoppers (Hemiptera: Cicadellidae) from Cusco, Peru
Juan F. Costa y Pedro W. Lozada
317 Anlisis numrico de las especies de Prosopis L. (Fabaceae) de las costas de Per y Ecuador
Numerical analysis of Prosopis L. (Fabaceae) species from the coasts of Peru and Ecuador
Alicia D. Burghardt, M. Magdalena Brizuela, M. Pa Mom, Luis Albn y Ramn A. Palacios
325 Diferenciacin morfolgica y por ISSR (Inter simple sequence repeats) de especies del gnero Plukenetia (Euphorbiaceae) de la Amazona
peruana: propuesta de una nueva especie
Diferentiation morphological and by Inter simple sequence repeats (ISSR) of species of genus Plukenetia (Euphorbiaceae) from Peruvian
Amazon: suggestion for a new species
ngel Rodrguez, Mike Corazon-Guivin, Danter Cachique, Kember Meja, Dennis Del Castillo, Jean-Franois Renno y Carmen
Garca-Dvila
331 Medicinal plants used in Peru for the treatment of respiratory disorders
Plantas medicinales utilizadas en Per para el tratamiento de enfermedades respiratorias
Rainer W. Bussmann and Ashley Glenn
347 Palmeras usadas por los indgenas Ashninkas en la Amazona Peruana
Palms used by Ashaninka indigenous people in Peruvian Amazon
Joanna Sosnowska, Damaso Ramirez y Betty Milln
353 Actividad inhibitoria de plantas in vitro de Drosera capillaris sobre Mycobacterium tuberculosis
Inhibitory activity of in vitro plants from Drosera capillaris against Mycobacterium tuberculosis
Jimmy Alvarado, Hilda Vsquez, Guillermo E. Delgado, Dalva Trevisan, Oscar Horna, Jurandir Pereira y Consuelo Rojas
359 Prevalencia y distribucin de los principales agentes etiolgicos que afectan los langostinos silvestres en Tumbes, Per
Prevalence and distribution of the principal etiologic agents that afecting wild shrimps from Tumbes, Peru
Rubn Alfaro Aguilera, Mervin Guevara Torres, Isaas Gonzales Chvez
365 Identifcacin molecular y actividad sobre sustratos cromognicos de la venombina A del veneno de la serpiente peruana Bothrops atrox
Molecular identifcation and activity upon chromogenic substrates of a venombin A from Bothrops atrox Peruvian snake venom
Gustavo A. Sandoval, Fanny Lazo, Edith Rodriguez, Armando Yarlequ y Russolina B. Zingali
Notas cientfcas
371 Toxicidad aguda y crnica del lindano sobre Ceriodaphnia cornuta (Cladocera: Daphniidae)
Acute and chronic toxicity of lindane on Ceriodaphnia cornuta (Cladocera: Daphniidae)
Jorgelina Jurez y Alcira Villagra de Gamundi
377 Nuevas evidencias de la presencia del Oso Andino (Tremarctos ornatus) en las Yungas de Puno, el registro ms austral de Per
Presence of the Andean Bears (Tremarctos ornatus) new evidences in the Yungas of Puno, Perus southernmost record
Gisella Mrquez y Vctor Pacheco
381 Efects of aqueous extract of Origanum vulgare L. (Lamiaceae) on the preimplantational mouse embryos
Efecto del extracto acuoso de Origanum vulgare L. (Lamiaceae) en embriones preimplantacionales de ratn
Vctor Benavides, Guadalupe DArrigo and Jos Pino
385 Efecto antitumoral del extracto acuoso de Bomarea cornigera (Alstroemeriaceae) en sarcomas inducidos en ratones
Antitumoral efect of the aqueous extracts of Bomarea cornigera (Alstroemeriaceae) on the sarcoma induced in mice
Jos Surez, Christian Villanueva, Claudia Rodrguez, Karito Lavado, Melissa Barbieri, Luis Guzmn, Ricardo Alfaro y Jos Pino
389 Efecto citoprotector del camu-camu Myrciaria dubia en tres lneas celulares de ratn expuestos in vivo a bromato de potasio
Citoprotective efect of camu-camu Myrciaria dubia on three celular lines of mouse exposed in vivo to potassium bromate
Alvis Rafael, Pino Jos, Gonzles Jos, Francia Juan C., y Betty Shiga