Vous êtes sur la page 1sur 79

C.F.

Haeseler, Kiel, 1892

Le Mahbhrata et ses parties


de

Adolf Holtzmann
Professeur lUniversit de Fribourg

Traduit de lAllemand par Gilles Schaufelberger

http://www.utqueant.org

Volume I

Histoire et Critique du Mahbhrata

-2-

http://www.utqueant.org

Chapitre I, 1

Retard pris par les tudes sur la posie pique


En comparaison avec le travail srieux et couronn de succs consacr toutes les autres branches de la littrature sanskrite, la posie pique indienne et spcialement le Mahbhrata parat avoir t mise lcart et nglige

Chapitre I, 2

Le Mahbhrata: une uvre non homogne


Que le .Mahbhrata, sous la forme sous laquelle il nous est parvenu, ne puisse tre luvre dun seul pote par suite de son tendue et des diffrences entre ses partie, cela est incontest.

Chapitre I, 3

Anciens et nouveaux dieux


Le remaniement de luvre apparat clairement dans la conception du monde des dieux. Les dieux de lpope rcente sont Viu et iva, ceux de lancienne Indra et Brahman et aussi Agni.

-3-

http://www.utqueant.org

Chapitre I, 4

Un remaniement tendancieux
La proposition la plus importante pour la critique interne du Mahbhrata est celle qui a t formule en 1846 par Adolf Holtzmann, savoir que les sympathies de lancienne pope se trouvaient du ct de Duryodhana, alors que lpope plus rcente privilgie Yudhihira et ses frres et amis.

Chapitre I, 5

Traits anciens dans lpope


La version actuelle du Mahbhrata repose sur un brahmanisme strict; mais elle conserve suffisamment de traits qui laissent conclure une plus grande anciennet des bases de cette pope.

Chapitre I, 6

Lpope primitive indo-germanique


Il nest pas impossible que notre pope, dans ses parties les plus anciennes, remonte lpoque o les Indiens et les Germains, ainsi que dautres peuples du rameau indo-germanique, formaient un seul peuple, mais nous navons pu jusquici en apporter des preuves certaines.

-4-

http://www.utqueant.org

Chapitre I, 7

Lpope indienne avant la rdaction du Mahbhrata


La posie pique en Inde est aussi ancienne que toutes les autres; elle se forme et se dveloppe la cour des rois grce une classe spcialise de conteurs; et elle se rpand par tradition orale. Lpope na rien voir avec la littrature religieuse des brahmanes, telle quelle sexprime dan le Veda; elle appartient la caste des guerriers.

Chapitre I, 8

Le Mahbhrata: une nouvelle cration homogne


Un pote gnial a tir du matriel lgendaire existant un rcit unique et lui a donn la forme dune uvre dart indpendante, le Mahbhrata (dans sa version la plus ancienne).

Chapitre I, 9

La description des caractres


Malgr les efforts des rdacteurs plus tardifs pour privilgier un parti (les Pava) au dpens de lautre (les Kaurava), on reconnat facilement que lattitude des personnages principaux de lpope est traite de faon cohrente, et la peinture de leurs caractres de faon affirm.

-5-

http://www.utqueant.org

Chapitre I, 10

Unit du plan de l'pope


De mme que les caractristiques des principaux hros sont traites de faon cohrente, le plan homogne qui sous-tend toute lpope montre que nous avons affaire un seul pote particulirement remarquable.

Chapitre I, 11

Deux questions difficiles


La question de savoir quand a vcu le pote du Mahbhrata ne serait en soi pas plus difficile traiter que tous les autres problmes lis la chronologie de lInde ancienne, mais elle est rendue deux fois plus difficile par son rapport interne avec une deuxime question tout aussi complexe, les raison de son remaniement tendancieux.

Chapitre I, 12

Le bouddhisme et le Mahbhrata
Prenons pour hypothse que cette pope, sous sa forme la plus ancienne, ait t luvre dun pote bouddhiste, cela expliquerait que les rdacteurs postrieurs, fortement brahmaniques, aient rabaiss le parti de Duryodhana, et encore plus celui de Kara, le prfr de lauteur; dans la mme proportion, il fallait glorifier le parti de Ka, ds que lon et commenc le mettre en rapport avec Viu.

1.

Si, dans lpope primitive, le droit et la vertu taient du ct de

Duryodhana, et si dans lactuelle, ses adversaires sont dpeints comme reprsentant

-6-

http://www.utqueant.org les conceptions brahmaniques, il est clair que seul un puissant bouleversement pouvait conduire un tel rsultat. On serait dabord tent de penser une rvolution dynastique et politique. Le Ka de lancien Mahbhrata na rien voir avec celui du Hariivaa; ni ses actions, ni son caractre ne correspondent. Lenfance de Ka, telle quelle est raconte dans les Pura et dans le Harivaa, nous le montre comme le hros divinis dun peuple de bergers inculte et sensuel; comme son frre Rma et ses amis, il sadonne la bonne chre et aux femmes, au jeu et la boisson; mais dj le Ka de lancien Mahbhrata na plus ces dfauts, mme ses ennemis ne lui reprochent, en dehors de sa basse naissance, que son manque de franchise, ses mensonges et ses trahisons. Le Ka de lpope sest fondu avec un tout autre Ka, le hros dun peuple puissant et victorieux, auquel les reprsentations mythologiques de lancien panthon indien doivent sadapter, bon gr mal gr. Il se peut bien aussi quune nouvelle dynastie puissante ait surgi, faisant remonter sa gnalogie Arjuna, et quelle ait donc mis Ka en avant en mme temps que sa famille, aux dpens de ses adversaires. Toute dynastie cherche se rattacher de quelque manire aux anciennes lignes piques dominantes; comme les peuples grecs se devaient davoir des reprsentants dans la guerre de Troie, de mme les gnalogies royales indiennes voulaient se rattacher la guerre des Bhrata (Benfey T., Kleine Schriften, I, p. 48). Il nest pas inintressant de constater comment les poques moiti historiques se rattachent aux poques purement mythiques. Gnralement on ne trouve de hros que dans les temps lointains, comme sils avaient t emports ensuite par une grosse catastrophe; les lignes postrieures sy rattachent dune faon qui trahit la grossiret du mensonge. Pourquoi donc Penthilos, qui conduit les Doriens vers lest, doit-il tre un fils naturel dOreste ? Parce que la lgende savait que la ligne des Atrides tait teinte. La ligne lgendaire des Fabiens stait teinte, la famille historique des Fabiens sy rattache par lhistoire de la bataille de Crmre, dont seul un jeune Fabien a rchapp. De la mme faon, la dynastie dj presque historique de Janamejaya se rattache la dynastie pique dArjuna non pas simplement parce que Parikit est le fils dAbhimanyu et le pre de Janamejaya, mais parce quaprs la mort dAbhimanyu le fils mort-n dUttar a t ressuscit de manire surnaturelle par Ka. On rejoint ainsi la vieille tradition qui tait persuade que dans la grande bataille, toute la ligne des hros avait disparu. On claircira peut-tre plus tard de quelle ligne dominante il sagissait, qui se rattachait Arjuna, justifiant ainsi une rvision partisane du texte; quand nous connatrons mieux que maintenant lhistoire des familles royales indiennes et leurs rapports chronologiques et synchroniques, alors nous pourrons trouver une rponse cette question. Mais il y faudra certainement pas mal de temps; nous avons encore peu de certitudes sur lhistoire ancienne de lInde; les indiens nont pas seulement nglig leur histoire, mais ils lont intentionnellement obscurcie et falsifie. Un homme clbre crivait avec raison : Toutes les -7-

http://www.utqueant.org dformations historiques dues nos savants et nos curs, sont des jeux denfants au regard de la falsification et de la dformation systmatique de lhistoire entire par les brahmanes (Bunsen, daprs Max Mller dans ses essais, III, p. 472, dans ldition allemande). Mais des intrts politiques ou dynastiques ne peuvent, eux seuls, expliquer une falsification aussi singulire que celle qui se produit ici. La division politique du pays en de nombreux territoires indpendants, souvent ennemis les uns des autres, ne suffit pas expliquer que lon fabrique une telle falsification, systmatique et laborieuse, souvent malhabile et inconsquente, ni motiver une telle animosit envers les statures hroques des temps anciens, telles quelles se sont manifestes dans la transformation du Mahbhrata. Pour cela, chez un tel peuple en tout cas, un autre motif bien plus puissant doit en avoir t la cause: le fanatisme religieux. Car lhistoire indienne est avant tout une histoire religieuse, elle tourne autour des concepts et des questions de la mtaphysique et nous donne une des preuves les plus frappantes de la force et de lenracinement des besoins mtaphysiques dans le cur humain. Il est donc compltement erron de se reprsenter les indiens comme tromps uniquement par leurs prtres par intrt personnel. Bien au contraire, alors que les brahmanes essayaient de proposer au peuple un pur panthisme, tel quil sexprimait avec une beaut ingalable dans les strophes dune clart limpide et profonde du huitime chant de la Bhagavadgt, alors quils sefforaient de remplacer la mythologie par la philosophie, les gens se tournaient de prfrence vers iva ou Viu, ou vers des formes dgnres du bouddhisme; les brahmanes devaient, pour regagner le terrain perdu, introduire dans leur systme de nouvelles superstitions toujours plus nombreuses. Et, ce quil semble, leur domination spirituelle simposait dautant plus quils y avaient russi. Nous cherchons donc la raison des transformations du Mahbhrata dans un intrt religieux, commun aux brahmanes de tous les territoires et de tous les partis.

2.

Mais, parmi tous les bouleversements que prsente le dveloppement

religieux des indiens, aucun na t plus puissant et plus important que celui apport par le bouddhisme. Lenseignement du Bouddha sest rpandu trs rapidement pendant les premiers sicles aprs son apparition. Un royaume puissant, qui semble stre tendu sur la plus grosse moiti de la pninsule, a t dirig par un roi adonn au bouddhsme. Le fondateur de cette dynastie, Candragupta, avait rejet le joug des satrapes macdoniens peu aprs lexpdition dAlexandre; il semble avoir rgn sur toute lInde du nord; les grecs le connaissaient sous le nom de Sandrokottos; et son avnement constitue pour nous une des rares dates connues avec exactitude de lhistoire indienne (vers 320 avant J.-C.). Les bouddhistes racontent bien des choses sur son neveu Aoka, mais les textes grecs ne le mentionnent pas: cest pourquoi Talboys J. et Wheeler J. dans leur History, III, p. 476, supposaient que Candragupta -8-

http://www.utqueant.org et Aoka taient une seule et mme personne, dont les bouddhistes avaient rparti la personnalit et les actes sur deux rois. Un tel procd nest pas impensable en soi, mais la seule preuve de Wheeler, ex silentio des grecs, est cependant insuffisante. Les bouddhistes dautre part considrent Aoka comme un puissant dfenseur de leur foi, laquelle il stait ralli lui mme, aprs quelques hsitations. Dans ses clbres dits gravs, en partie encore conservs, il prne son peuple les fondements de la compassion religieuse, il les engage protger toutes les cratures et la tolrance envers les autres religions. On dit encore de lui quil a fait construire de splendides monuments et soigneusement encourag et dvelopp les arts et les sciences (voir Senart E., Un roi de lInde au troisime sicle avant notre re, in Revue des Deux-Mondes, 1889). Aux poques suivant Aoka (vers 250 avant J.-C.), le bouddhisme tait la religion dominante dans lInde du nord. Les rapports des plerins chinois, que les savants franais nous ont rendu abordables, nous montre un bouddhisme encore en pleine floraison vers 400 aprs J.-C., alors quil tait dj en dclin vers 629 aprs J.-C., et quaprs lan 1000, on ne trouvait plus trace du bouddhisme proprement dit en Inde. Le dur et sanglant combat semble avoir pris naissance vers le dbut de notre re, au cours duquel un brahmanisme rform a enfin pris le dessus sur son dangereux adversaire. On semble maintenant gnralement daccord de placer la priode de floraison du bouddhisme entre 300 avant J.-C. et 500 aprs J.-C., et la victoire finale du brahmanisme entre 800 et 1000. Malheureusement, nous navons encore aucune description valable de cette grande guerre de religion. Mais pour la caractriser, il suffira de nous en tenir la strophe connue: Qui, entre le pont (le pont de Rma qui conduit Ceylan) et les montagnes enneiges, ne tue pas les adeptes de Buddha, enfants et vieillards, doit tre mis mort, ainsi la ordonn le roi ses serviteurs . Cette strophe est tire du remarquable pome akaravijaya, cest dire la Victoire de iva (voir Gildemeister J., Chrestomathie, 1868, XII et p. 1892, V, p. 66) L, la cour du roi Sudhanvan, Kumrila, le porte-parole des brahmanes, dfait les bouddhistes, dabord dans une disputatio, puis en magie, et enfin avec laide de Viu. L-dessus, Sudhanvan ordonne de tuer tous les bouddhistes; car, ajoute-t-il, les hommes au grand cur ne doivent mme pas pargner leurs amis, sils sont coupables; Rma, le fils de Jamadagni, na-t-il pas tu sa propre mre ? En outre, le droulement de ce combat de gants peut nous tre indiffrent, puisque son rsultat est bien connu. Le bouddhisme a t radiqu par la force dans les contres o il avait fleuri pendant des sicles. Les causes en sont claires: dun ct des efforts vigoureux, une contrerforme des brahmanes qui ont regagn les masses par lintroduction de dieux populaires, particulirement Viu-Ka, et de nouvelles superstitions, de lautre un relchement du bouddhisme qui stait dj auparavant cart de ses positions originelles.

-9-

http://www.utqueant.org

3.

En effet le bouddhisme, que lon a compar ses dbuts avec le

protestantisme (Benfey T., Orient and Occident, I, p. 139; Kleine Schriften, I, p. 279), se dgrada bientt au contact de la magie confuse du shivasme, dont les racines sont chercher leur tour dans les cultes dmoniaques sauvages des indignes. En ce qui concerne les religions dravidiennes, il suffit de renvoyer lintressant article de Caldwell sur lancienne religion des Dravidiens, la fin de sa grammaire compare. Elle consiste dans le culte des esprits mauvais, les bhta, et en tire sa substance, au moyen de danses frntiques et de sacrifices rpugnants: pelures doignon, ongles, cheveux, sangsues, lzard sont encore offerts aujourdhui aux bhta au Malayala, raconte le missionnaire Karl Graul dans son Voyage dans lInde orientale, III, 1854, p. 228, et seulement le coq parmi les animaux suprieurs, ibid, III, p. 185; ces sacrifices sont pratiqus par des brahmanes dordre infrieur, qui se sont consacrs au service des dmons locaux, les durdevat, ibid, III, p. 228; 334, note 14. Les divinits locales, les grmadevat, sont presque toujours des dmons de cette sorte. Ce culte des dmons est pass des indignes aux envahisseurs, comme cela ressort clairement de lpope et des Puras. Les lments de dmonologie contenus dans le systme puranique, dit Robert Caldwell, ont t emprunts ces anciennes superstitions dravidiennes. Dans le Mahbhrata galement, nous trouvons des passages dmonologiques, dont le contenu na rien voir avec la mythologie indienne dominante. Ainsi, il est question de dmons (graha) qui enlvent et dvorent les nouveaux-ns, ou frappent de folie les personnes plus ges; cependant, sils sont apaiss par certaines crmonies, ils offriront sant et longue vie, III, 228, 1 =14387; 3, 230, 27 = 14480; 3, 230, 44 = 14498;11, 4, 6 = 109. cette catgorie appartiennent les inquitantes Mres qui habitent dans les arbres, les grottes, les cours des temples et les rochers 9, 46, 41 = 2659.

4.

Ce dmonisme est considr comme le prcurseur du shivasme,

spcialement par Kppen C.F. dans La religion de Buddha, (II, 1859, p. 29 sq), o il explique que la naissance du shivasme est jusqu prsent une nigme non rsolue; il nest vraisemblablement pas arien, mais descendrait des cultes dmoniaques sauvages des indignes. En effet, il semble que les cultes dmoniaques des indignes ait t lis au dbut avec la personne et le culte de Rudra, plus tard iva, et quils aient pntr ensemble le bouddhisme; dans le Mahbhrata, les dmons nomms plus haut (graha) et les Mres sont au service de Skanda, le fils de iva, et constituent sa suite (skandapriada, III, 228, 1 = 14387); lpouse de iva, Durg, est honore par les peuplades barbares du Vindhya (Vish., 3, 1 = 3268). Dans le Bhgavatapura, on appelle iva le seigneur des dmons, Bhtaraj (3, 4, 23), Bhtea (4, 6, 22), Bhtantha (4, 5, 4), le Seigneur des Pramatha et des Bhta (4, 2, 15), ses serviteurs sont les Bhta, les Preta, et les Pica (4, 5, 25). Le dmon tourmenteur Jvar, la - 10 -

http://www.utqueant.org vieillesse, doit iva sa naissance (XII, 283, 18 = 10226; cf. Muir J. IV, p. 273; Grohmann, Indische Studien, IX, 404). Robert Caldwell, dans sa Grammaire compare, p. 581, remarque quon trouve dj dans lAitareya Brhmaa des lments de dmonisme qui se rattachent la personne et au culte de Rudra, identifi plus tard avec iva; on trouverait une trace de lentre du dmonisme dans le systme brahmanique dans lhistoire du sacrifice de Daka. Karl Graul, sur place, en arrive la mme conclusion. Il dit que le shivasme est un rameau pris au culte indigne des dmons et greff sur le brahmanisme ((III, p. 187), un reliquat du culte tnbreux de la nature qui pntrait lInde avant la religion brahmanique (III, p. 69). Au Malayala, on offrait iva et Kali, mais aussi occasionnellement Viu, les mmes sacrifices rpugnants quaux bhta (III, p. 228) et les divinits locales, les grmadevat, auquel un brahmane orthodoxe noffrirait jamais un sacrifice, sont presque toutes des dmons de la famille ou de la suite de iva (III, p. 73).

5. Quun amalgame se soit fait entre le bouddhisme et le shivasme et par l


aussi avec la dmonologie des indignes, que le shivasme ait corrompu et dfigur le bouddhisme, Kppen C.F. (Buddha, II, p. 243) la suppos, de faon trs clairante. Le shivasme avait introduit dans le cercle des adeptes de Bouddha des lments trangers, magie et culte des dmons, incantations, cercles magiques, exorcismes, rsurrection des morts (I, p.558; II, p. 29), dont les monstrueuses idoles entrrent dans les temples bouddhiques (I, p. 505) o, ct des statues de Bouddha, iva trouvait place comme protecteur, dfenseur et vengeur de la religion et de lglise en compagnie de sa noire pouse Kl (II, p. 29; p. 260), la guirlande de crnes quil portait autour du cou sest transforme en rosaire chez les bouddhistes (II, p. 319). Nous ne savons pas quand cette liaison entre le bouddhisme et le shivasme a eu lieu; en tout cas ctait une poque o dominait encore lancienne reprsentation de iva, daprs laquelle il tait un dieu inquitant et terrible, alors que les poques suivantes ont connu un iva, bienveillant et serein. Son pouse, Kl, est toujours reste une dmone effrayante et perverse, mais notre pope dit de lui quil a deux aspects, dun ct il est terrible et effrayant, de lautre doux et favorable (VII, 202, 107 = 9599; VII, 202, 141 = 9632; XIII, 162, 3 = 7504; 19 Vi., 72, 31 = 7420). On peut en dire autant du iva de lhistoire. Le dieu dune culture repue, celui que prie Klidsa, celui pour lequel sont composs des hymnes pleins dune conception leve du divin et de dvotion fervente, na rien de commun avec le dmon sauvage de la magie et de la sorcellerie qui est honor dans les temples bouddhiques et avec lequel le bouddhisme a conclu une alliance funeste. Laspect dmoniaque de iva est son aspect ancien, son aspect nouveau est amical: Les premires r-critures brahmaniques du Mahbhrata le considrent avec malveillance, avec dgot mme, les plus rcentes avec vnration et adoration. - 11 -

http://www.utqueant.org Cest lancien shivasme qui a fourvoy lenseignement du Buddha dans ce fouillis inextricable que lon nomme chamanisme, qui se caractrise par la croyance aux esprits, les incantations et la magie. ct de ce bouddhisme corrompu, les concepts dun brahmanisme rnov pouvaient tre lancs avec succs, mais juste pour quensuite une alliance avec les superstitions populaires entrane les mmes concessions qui avaient dvoy le bouddhisme. Peut-tre cette alliance du bouddhisme avec la religion populaire de son temps avait-elle t une ncessit pour autant quil tait violemment attaqu et devait se dfendre; Pour une rsistance nergique, lenseignement de la patience et de la compassion ne donnait pas les bonnes bases, et iva fit son entre dans le panthon bouddhique comme le dfenseur de leur foi. Il est naturel que cet amalgame ne se fasse pas sans rsistance; les mendiants shivastes nus, les nirgrantha, qui rejoignirent plus tard le bouddhisme, doivent sy tre oppos au dbut (Kppen, 2, 29). Mais, comme nous lavons dit, les donnes manquent. Lassen (vol. IV) raconte que lditya, le roi de Kanykubja, qui a rgn entre 614 et 650 aprs J.-C. environ, tait un fervent bouddhiste, et en mme temps un adepte de iva, que le roi Sussala au Cachemire (1112 - 1126) tait un adorateur zl de iva, mais quil favorisait aussi les adeptes du Buddha, tandis que son prdcesseur, Kemagupta, (953 - 962) aurait t un ennemi acharn des bouddhistes, mais un adorateur de iva. Mme dans la lointaine le de Java, selon Friederich (ZDMG 19, p. 620), le bouddhisme et le shivasme se sont amalgams une certaine priode . Les monstres fantastiques de larme de iva, sont dcrits en Vi., 124, 19 = 10590. Son arme difforme capable de ramener sur la terre le soleil, la lune et les toiles (X, 4, 40 = 290), est la suite de Mra, qui tentait le Buddha, et qui tait encore considr dans les premiers temps du bouddhisme comme une force hostile, alors que plus tard ce serviteur de iva tait accueilli dans les temples bouddhiques (Kppen, I, p. 505).

6. La naissance, le dveloppement, le combat et la disparition de bouddhisme


ne peuvent pas avoir eu lieu sans laisser de traces dans lvolution du peuple indien: le bouddhisme et la littrature indienne en particulier doivent stre influencs mutuellement bien plus que cela napparat dans ltat actuel des recherches. Une catastrophe si importante que la disparition dune religion longtemps florissante, combattue avec tous les moyens de la politique et de la science, na pas pu rester sans les effets les plus considrables sur le dveloppement de la littrature indienne. Lart et la posie taient exercs avec ferveur dans les cours des souverains bouddhistes; Benfey T. tait enclin attribuer aussi au bouddhisme llaboration dune grammaire scientifique, un des domaines les plus brillants de la pense indienne: Lclosion de la vie intellectuelle des indiens est due principalement au bouddhisme. Jai bien des raisons de penser quun des domaines les plus brillants du - 12 -

http://www.utqueant.org dveloppement intellectuel indien, la grammaire, est une cration bouddhique (Pacatantra, I, p. XIII). Et dans les Kleinere Schrifte (I, p. 209), il crit: Il apparat toujours plus vident que presque toute la vie intellectuelle la plus intense des indiens provient principalement du bouddhisme, et que celui-ci, aussi longtemps quil a prospr en Inde, y a pris une part des plus dterminantes et des plus neuves . En I, p. 122, il ajoute que le bouddhisme a cr une vie artistique et scientifique active, qui a exerc une influence trs importante, mme en dehors des cercles religieux ; il tait port par une vie artistique de scientifique des plus intenses, et rempli delle (I, p. 244). On ne pourra parler dune histoire et dune histoire de la littrature indienne que lorsque lon aura russi redonner au bouddhisme sa position influente dans lvolution de la vie indienne. La littrature indienne, telle quelle se prsente aujourdhui, ne se pose pas en critique du bouddhisme, elle lignore plutt presque compltement. Dans le premier volume des Indischen Studien (1850, p. 436) dj, A. Weber constatait le fait frappant, quon ne trouvait presquaucune mention du Buddha dans la littrature brahmanique. Dans le Rmyaa, Schlegel nomme Buddha dans un passage (II, 109, 33) mais, dans son introduction (p. 55), il dclare que cest une insertion. Weber fait de mme (Rmyaa, p. 5). Les Pura voquent le Buddha ou ses adeptes dans quelques passages, cf. Wilson-Hall, Vi., III, 209-211; IV, 169; 186; V, 370; 378; Muir S., T II, p. 350; Aufrecht cat. Bodl., 70a; Lla, note V, p. 55. Dans le Padmapura, Buddha est faux professeur et cependant une incarnation de Viu (Garbe, Vijnabhiku, p. 8). Dans le Bhgavata Pura, 6, 8, 17, le Buddha est reprsent comme une incarnation de Viu et invoqu pour se protger de lhrsie. Dans la littrature sanskrite des brahmanes, nous ne trouvons que peu de traces parses dune influence du bouddhisme et E. Burnouf (Bhgavata Pura, T. I, introduction p. 84, note 4) expose que les brahmanes navaient plus une reprsentation claire du Buddha et de son enseignement, que pire encore, ils le confondaient souvent avec Jaina. Aprs que les prtres eurent obtenu une victoire complte, ils ne laissrent pas la littrature des bouddhistes disparatre compltement, mais retravaillrent fond ce quils estimaient valable de conserver et cartrent soigneusement tous les lments qui contredisaient leur systme. Ils atteignirent leur but: ctait comme si le Buddha navait jamais vcu, ni son enseignement jamais domin. Mais en agissant ainsi, les brahmanes extirprent totalement le sens de lhistoire dans leur peuple, tel point que le monde des chercheurs europens eut limpression quon pouvait peine parler en Inde dhistoire intrieure et dvolution, seulement de torpeur et de continuit. Beaucoup de choses se sont passes, mais nous nen savons aujourdhui que peu de choses , remarque ce sujet A. Weber (Ind. Stfn., II, p. 176).

- 13 -

http://www.utqueant.org

7.

Si nous revenons lpoque dun bouddhisme encore jeune, la cour

dAoka et de sa dynastie, nous y trouvons runies toutes les conditions qui rendent vraisemblable une riche closion de la posie. cette poque, le pays avait atteint un degr de dveloppement tatique et civil, comme jamais depuis, et ladministration des tats et des cits taient sous tout rapport aussi bien ordonne quelle ne lavait jamais t (Lassen, II, p. 713). La stature dAlexandre le Grand et limposante invasion des Grecs avaient fait une impression nouvelle et persistante sur le cur des Indiens; ils avaient peut-tre mme, comme le supposait Albrecht Weber (Ind. Stfn., II, p. 478), conserv le souvenir dAlexandre et son nom dans leur dieu de la guerre Skanda. Les Yavana son des hros omniscients , est-il dit dans un ancien passage (VIII, 45, 36 = 2107). Le nom de Yavana a plusieurs sens, il indique toutes les races hors-caste louest de lIndus, y compris les Arabes, les Grecs dAsie et les gyptiens , dit Rjendralla Mitra dans son essai On the supposed identity of the Greeks with the Yavanas of the sanskrit writers, in JAS of Bengal 43, pp. 246-279; cependant ce nom peut fort bien avoir dsign dabord, les Ioniens, cest--dire les Grecs, et stre tendu ensuite dautres peuples louest. Le combat avec les grecs a dur longtemps; Candragupta, que William Jones a identifi en premier avec Sandrakottos, a redonn la libert aux Indiens tout de suite aprs le retrait dAlexandre (Justinus, 15, 4), mais des rois grecs indpendants rgnrent en Inde jusque vers 85 avant J.-C. (Lassen II, p. 337). Le combat fut difficile et dura de longues annes. Lexpulsion des Macdoniens, la guerre heureuse contre les Sleucides, et leur libration finale du joug grec, dut influer sur le sentiment national des indiens de faon encore plus vivante. Et pourtant Max Mller (anc. lit., p. 30) crit: les Indiens nont jamais connu le sentiment de la nationalit , mais il semble quil avait tort. Le combat contre les grecs donna aux indiens la conscience de leur appartenance nationale et lessor du sentiment patriotique permit une famille royale solide de runir toute lInde du Nord sous un sceptre non tranger. Aprs de telles poques, o les guerres locales se terminent heureusement, o lessor national et le bien-tre grandissent, suit gnralement une closion de la littrature nationale dont lapparition ne dpend en aucun cas uniquement de la prsence de gnies potiques. Ainsi, aprs Thmistocle, Sophocle, aprs le vainqueur dHannibal, Ennius, aprs Frdric Barberousse, Walter der Vogelweide, aprs Cortez, Cervantes, aprs Albuquerque, Camons, aprs les hros qui dfirent lArmada de Philippe, Shakespeare, et de mme, pensons nous, aprs les vainqueurs des phalanges Macdoniens, les potes du Mahbhrata. Goethe crivait tranquillement des posies sous le tonnerre des canons dIna, mais on peut se demander si la priode classique de la nouvelle posie allemande est dj derrire nous, ou encore venir. Si nous ajoutons aux conditions pralables donnes ci-dessus la puissante impulsion que lenseignement du Buddha exera sur la vie intellectuelle - 14 -

http://www.utqueant.org des indiens dalors, nous pouvons considrer lpoque des Candragupta, des Aoka et de leur dynastie comme particulirement favorable lclosion dune littrature nationale. Si nous devons chercher le grand inconnu; le pote du Mahbhrata, la cour de ces rois bouddhistes de lInde du nord, dAoka ou de ses successeurs, il serait alors vraisemblable que le pote donne son hros les vues religieuse de son matre et bienfaiteur, et mme glorifie carrment le roi la cour duquel il vivait, en la personne de Duryodhana. La raison pour laquelle, plus tard, le brahmanisme vainqueur aurait compltement transform luvre et aurait d placer le parti de Kara du plus mauvais ct, serait alors claire. Il faudrait encore chercher si, dans le Mahbhrata actuel, le roi Duryodhana et ses amis sont reprsents comme des hrtiques, ou mme comme des bouddhistes (voir chapitre suivant).

8. Quil y ait entre Aoka et Duryodhana un lien cach ressort du fait que le
rcit de la naissance extraordinaire de Duryodhana et de ses cents frres, comme nous le donne le Mahbhrata, correspond de faon frappante avec des lgendes semblables sur Aoka et sa famille. La mre de Duryodhana, nous est-il dit en I, 115, 1 = 4483, met au monde une boule de chair. Elle sera spare en cent morceaux, conservs dans des cruches, et de l natront cents fils. En plus de ceux-ci, Dhtarra aura encore un fils illgitime, Yuyutsu. Aoka a lui aussi cent frres (Lassen II, p. 213), et son grand-pre, Candragupta (dont Tallboys et Wheeler ont prtendu quil tait identique Aoka), est n avec ses frres dune boule de chair que sa mre avait mise au monde (II, p. 197). Lassen fait remarquer expressment la ressemblance de cette lgende avec celle du Mahbhrata.

9. Essayons donc de placer la naissance du Mahbhrata sous Aoka ou tout de


suite aprs (250 - 200 avant J.-C.); cette datation ne contredit pas les valuations, faites partir des allusions aux Yavana dans les plus anciennes portions de lpope et considres jusqu prsent comme valables. Certes, Lassen II, p. 493, la place avant Candragupta; Wilson (notes sur le Sabhparvan, 1842) au contraire, la situe au milieu du IIme sicle (As. Soc. Journ., XIII, 142: une date que lon a toutes raisons de considrer comme celle de la rdaction de la plus grande partie du Mahbhrata). Albrecht Weber, dans sa Literaturgeschichte et en diffrents passages des Indischen Studien, se prononce sur cette question et rsume son point de vue dans Ind. Stfn., III, p. 478 par la phrase suivante: la partie du M a h b h r a t a qui traite particulirement du combat entre les Pava et les Kuru porte des indices directs quelle a t crite seulement longtemps aprs lpoque dAlexandre le Grand . Un moment important pour cette valuation est larrive des Yavana dans le combat des Pava et des Kuru; cf. Muir, metr. transl., Introduction p. 40. Weber (ind. Stud. V, p. 152), identifie Bhagadatta, le prince des Yavana, qui rgne louest comme un - 15 -

http://www.utqueant.org second Varua (II, 14, 13 = 577) au prince grec Apollodoros (env. 160 avant J.-C.); il renvoie V. Gutschmid, Beitrge zur Geschichte des alten Orients, p. 75; Wilson lui aussi (Vish., V, p. 55) trouve dans les passages cits plus haut une certaine connaissance de la puissance et de la position des princes grco-bactriens et de leurs successeurs scythes . Tod et Lassen (I, p. 656; II, p. 344) identifient le roi Sumitra ou Dattamitra (nomm en I, 139, 23 = 5537) au roi grec Demetrios que, daprs Lassen a rgn de 205 165 avant J.-C.; de mme Weber (Ind. Stud., V, p. 150, note: Ind Skizzen, p. 82; Malavika, introduction p. 47. Le mme Malavika (introduction p. 3738) parle de linfluence exerce par les grecs sur la vie intellectuelle indienne.

Chapitre I, 13

Traces du bouddhisme dans le Mahbhrata actuel

Dans les passages les plus tardifs de lpope, les chos bouddhiques ne sont pas rares; dans les parties les plus anciennes on trouve peu de relations avec le Buddha, ce qui sexplique suffisamment si lon admet une r-criture par les brahmanes.

1.

Tout au long de l'pope, telle que nous la possdons actuellement,

Duryodhana est reprsent comme mauvais. Ses propres partisans doivent le rprimander pour sa cupidit ou son impit, ainsi Avatthman (VII, 160, 10 = 7152), en contradiction totale avec des passages authentiques comme IX, 32, 2 = 1818: Jamais Duryodhana na d entendre jusquici un mot de reproche, sa nature royale le rend respectable pour le monde entier . Si, comme nous lavons suppos plus haut, on rend hommage au roi Aoka travers la personne de Duryodhana, il est naturel que les brahmanes aient plac limage de Duryodhana dans lombre. Quil ait t bouddhiste, cela ne nous est dit nulle part; ce mot mme est vit. Mais la raison de ce jugement brutal est clairement avoue: Duryodhana hait Ka, il nadmet pas son origine divine, ni son caractre, il sera pour cela dclar un sauvage Rkasa, mr pour le dclin (VI, 66,10 = 2982; 31 = 3003; VII, 11, 41 = 422). Les adeptes de Duryodhana, deviendront aprs leur mort, sur les chemins de la - 16 -

http://www.utqueant.org rincatrnation, des Rkasa (XVII, 5, 28 = 174). Comparer ce propos IX, 43, 22 = 2421: Qui, appartenant aux trois castes infrieures, hait les brahmanes, deviendra un Rkasa . Dans des passages comme VI, 23, 26 = 618: 67, 25 = 3035, on souligne que Duryodhana ne reconnat pas Viu, alors que Yudhihira est reprsent comme son fidle admirateur. En bref, Duryodhana, lennemi des fidles adorateurs de Viu, est un hrtique, et il est li aux ennemis des dieux. Les Dnava et les Daitya, relgus dans le monde infrieur, identifient clairement leurs affaires avec les siennes, III, 252, 25 = 15180, ils se disent ses partisans, III, 251, 22 = 15145, et lenlvent dans leur monde souterrain, le Rastala, pour le consoler et lui donner des forces. Il est mis en relation avec lesprit mauvais Kl, I, 67, 87 = 2722; XI, 8, 30 = 222; XIV, 53, 63 = 3023; XV, 31, 10 = 852. Son art de magicien repose aussi sur sa frquentation des esprits mauvais; il a le pouvoir de prendre nimporte quelle forme, kmarpin, VII, 102, 13 = 3817, il solidifie par magie, myay, leau de ltang, IX, 29,54 = 1621; 30, 8 = 1680; 31, 3 = 1744. Ainsi le Mahbhrata r-crit prsente les anciens hros comme des adversaires de Viu, des hrtiques et des magiciens, mais pas spcialement comme des bouddhistes. Quand on parle dincroyance et dathisme, on doit penser en premier lieu au bouddhisme, avec lequel les brahmanes ont men pendant des sicles une guerre si dure. Mais le non de buddha est vit, son souvenir doit tre extirp.

2.

Dans plusieurs passages, on nomme Crvka, un moine mendiant errant,

comme un conseiller et un ami de Duryodhana; il est reprsent comme un dmon impudent et il devra rendre ses esprits aprs la mort du roi, sous les coups des brahmanes et les sentences du Veda. Ce Crvka napparat nulle part dans le rcit proprement dit, il nest mentionn que dans les passages les plus rcents, il nappartient pas lancien rcit. Il existe une secte athe plus tardive de ce nom, dont les adeptes ne sont encore pas loin du Buddha; mais le Crvka du Mahbhrata ne me semble tre rien dautre quun symbole du bouddhisme corrompu; possibily intending the Bauddhas (Wilson specimens II, p. 342). Bien que nous nayons rien appris sur lui durant toute laction, comme nous lavons fait remarquer, Duryodhana le mentionne en IX, 64, 38 = 3619: il se console de sa fin prochaine par le fait que le mendiant errant (parivraj) Crvka deviendra une victime expiatoire pour lui. Aprs la mort de Duryodhana, apparat (XII, 38, 22 = 1414) Hastinpura, au milieu des brahmanes, son ami, et il un Rkasa du nom de Crvka, sous laspect dun moine mendiant, et il invective Yudhihira, laccusant dtre le meurtrier de son propre matre et parent. Mais les brahmanes le tuent et Ka explique que Brahman lui avait accord linvulnrabilit devant tous les tres, condition quil respecte les brahmanes, ce quil navait pas fait. John Muir commente deux passages (S. T. IV, p. 294) et remarque propos de Duryodhana: he was considered to be heretically - 17 -

http://www.utqueant.org disposed . De la mme manire, les brahmanes turent le roi Vena, au moyen de formules magiques (Bhgavata Pura, 4, 14, 34).

3.

Nous savons bien que lhabit rouge est le signe distinctif des matres

bouddhistes. Ainsi ce dtail en apparence insignifiant, que ses conseillers et ses prtres portaient des habits rouge clair ou rouge orang (IX, 62, 6 = 3465), peut donc montrer quil y avait un rapport entre Duryodhana et les bouddhistes. kya (ou Pali ksva) est le vtement orang des mendiants errants bouddhistes: il nest pas digne de lhabit rouge signifie, dans la littrature bouddhique, quelque chose comme: ce nest pas un vrai bouddhiste . La couleur kya est une couleur sainte pour les bouddhistes, ils la choisissent mme pour la reliure de leurs livres (Weber, Streifen, III, p. 64). Lhabit sappelle kya, la prise dhabit du prtre bouddhiste est dsigne par kye ghte (Weber, Malavika, introduction p. 8); Buddha est apparu au moine chinois Hiouen-Tsiang dans un habit dun rouge orang (Benley, Kl. Sch., I, p. 183) . Dans Wilson, Viu Pura, III, 210, Buddha nest pas nomm, mais dsign: the same deluder, putting on garments on a red colour . Comme rsum dun chapitre du Vrhapura, Aufrecht donne: rubris vestibus indutus ne quis deum colito (cat. Bodl, 60a), correspondant au raktavastraparidhnpardhapryacittam des notes de Lla, III, p. 294; le savoir transmis librement par les kya (kayavarjitam) est vant (XII, 217, 31 = 7873); mais kaya signifie aussi abrutissement, et Nlakaha lexplique par rgdhihnam; cela peut aussi tre une allusion lhabit des bouddhistes, comme le suppose le dictionnaire de St Petersbourg pour un passage similaire (Bhav. XIX, 4, 12 = 11182 et galement Langlois dans sa traduction de Harivaa, II, 281; Nlakaha explique kaya par kalua, impuret). Dans le dernier passage cit, dans une prophtie concernant lge Kali, cet ge funeste est appel Kaya (4, 12 et 47 = 11182 et 11219), et, juste avant, les adeptes du Buddha, les kyabuddhopajvina, sont caractriss par leur habit rouge, kayavsasa. Le roi Janaka, que le Livre XII montre partout en relation troite avec le bouddhisme (Weber Ind. Stud., I, p. 482: XVI, p. 259), doit tre mis en garde par son pouse envers les mendiants errants, en vtements jaunes, la tte rase; le mme dit (XIII, 320, 47 = 11898) quil nest pas ncessaire de porter des vtements rouge orang (kya) pour tre saint; daprs XIII, 91, 43 = 4369, celui qui porte un tel vtement ne doit pas admis au sacrifice pour les morts. Quand Manu, 4, 30, dit quun hrtique ne doit pas tre salu, un commentaire explique le mot pain, hrtique, par bouddhiste , un autre par ascte en habits rouges (Bhler, Manu, p. 133). Il est clair, daprs les passages cits, que kya et bouddhiste sont pris lun pour lautre, mais nous trouvons encore le mot kya employ l o il nest aucunement question de bouddhisme; par lpouse dAgastya (III, 87,19 = 8588), ou loccasion de la pnitence de Savitr (III, 295,18 = 16708) . Dans le Rmyaa, les conseillers de - 18 -

http://www.utqueant.org Daaratha sont appels kyina (II, 16,3). On peut ainsi penser que dans les passages les plus anciens, la liaison exclusive de ce mot avec le bouddhisme ntait pas encore acquise.

4. On trouve encore des traces de bouddhisme dans les sections consacres


Avatthman.. Son nom dj rappelle le figuier sacr des bouddhistes (avattha); son pre, Droa porte le mme nom quun disciple du Buddha, celui-l mme qui craignait la dispersion des membres de son matre aprs sa mort (Weber, III, p. 143); il a en commun avec Buddha le mme patronyme, Gautama. La vengeance nocturne dAvatthman, telle quelle est dpeinte dans la premire section du Sauptikaparvan, reprsente une des parties les plus anciennes et les plus importantes du Mahbhrata; elle a t considrablement raccourcie, mais remarquablement bien conserve dans son ensemble. Ce passage est considr comme un des plus favorables Avatthmn. Mais pour affaiblir cette impression favorable, un passage plus tardif, crit dans un style embrouill et peu clair, a t ajout en X, 10, 1 = 543, pour insister nouveau sur la valeur dArjuna. On nous dit ici quAvatthman tait n avec sur le front une pierre prcieuse, une amulette qui le protgeait de la maladie et des blessures. Aprs quAvatthman a exerc sa vengeance, Arjuna et Bhmasena le cherchent et lobligent (on ne nous dit pas comment) se sparer de cette pierre prcieuse et la leur remettre (X, 15, 27 = 713). En change, on lui laisserait la vie sauve; partir de ce moment, Yudhihira la portera. Il faut insister sur le fait que, bien que l''pope nous parle beaucoup dAvatthman, cette pierre prcieuse na jamais t dcrite, et quil nen a jamais t question, ni auparavant, ni plus tard; on nen parle que dans cet unique passage qui prend parti contre Avatthman. Maintenant, cet ornement frontal ne nous fait-il pas penser cette protubrance crnienne (Burnouf, Lotus, p. 616), considre comme le premier signe distinctif du Buddha, et dcrite comme une excroissance au milieu du crne, que lon retrouve sur toutes les images du Buddha (Kppen, II, p. 433) ? La partie suprieure de la tte est prolonge par un rehaussement cylindrique, lua, qui porte un ornement en forme de boule (ZDMG, 18, p. 363). Lauteur de ce passage tardif fait dAvatthman une personnification du bouddhisme vaincu: cet ornement frontal quon lui arrache, cette pierre prcieuse qui devait le protger de la mort et de la pourriture (des joyaux magiques de cette sorte ont t voqus par ailleurs, par exemple dans Viracaritra, Jacobi, Ind. Stud., XIV, p. 138) est un symbole de la domination de Yudhihira, le fervent dvot de Viu sur Avatthman, lincroyant. La maldiction que lui infligent les deux saint Nrada et Vysa, quil doit errer pendant mille ans, solitaire, sans parler quiconque, afflig de toutes les maladies et tranant avec lui dans les forts et les dserts une odeur de sang et de pus, cette maldiction, qui jusquici faisait seulement penser celle du Juif Errant aux liens - 19 -

http://www.utqueant.org pourtant lches avec lOrient (Kuhn, Rapport annuel, 1876-1877, p. 34) vaut aussi pour le bouddhisme lui-mme. La maldiction dAvatthman (X, 16, 17 = 739) est motive en particulier par le fait que, tout en tant brahmane de naissance, il mne la vie de guerrier: le bouddhisme est maudit et doit tre extirp, parce quil ne reconnat pas les castes. Tout de rcit est un ajout. Avatthman apparat de nouveau (XI, 11, 1 = 289), sans quil soit question de cette histoire.

5.

Notre hypothse que cette pope aurait dabord t compose par un

bouddhiste, et ensuite remanie dans un sens hostile au bouddhisme, repose sur la constatation que dans lpope elle-mme, particulirement dans son noyau le plus ancien, on ne trouve que peu de traces dinfluence bouddhique, et trs incertaines. Peu importe quon ait constat ces traces en nombre relativement important dans les livres plus tardifs; il sagit dajouts postrieurs, que les brahmanes ont introduits sans aucun inconvnient, aprs que le bouddhisme est devenu inoffensif. Llment bouddhique, qui donnait au peuple une impression agrable, a t conserv, mais revtu dun autre habit qui servait les prtentions brahmaniques (Weber sur le Rmyaa, p. 7). Weber (Ind. Stud., III, p. 361 dit de lhistoire si souvent conte de la mise lpreuve dUinara (III, 131, 19 = 10555) quelle a un parfum tout fait bouddhique et Ph.Foucaux (Onze pisodes, introduction p.31; p. 241 sq) est tout fait daccord l dessus; et ajoute une version bouddhique. De la lgende de Mudgala (III, 260, 3 = 15407) qui ne se satisfaisant pas de la flicit du ciel, provisoire et dangereuse, aspire un tat libre du changement, et atteint le nirva, Weber (Ind. Strf., III, 3 fait remarquer quelle est indiscutablement bouddhique . De XII, 168, 29 = 6293 jusqu XII, 173, 18 = 6447, nous est raconte lhistoire dun brahmane indigne qui arrive chez des Dasyu voleurs, prsents comme des cannibales, qui adopte leurs murs et leurs coutumes, qui va jusqu tuer des animaux et pouser une femme de la caste des dra, et se montre ingrat au plus haut point mme envers ses bienfaiteurs. la fin, il va naturellement en enfer, accompagn de la maldiction des dieux. Ce brahmane sappelle Gautama, et Weber (Ind. Stud., I, p. 436) envisage la possibilit que son nom ait t choisi intentionnellement, que peuttre mme quen racontant comment Gautama a t dpec en morceaux pour tre mang par les Dasyu, mais que ceux-ci nont pas voulu consomme la chair dun tel pcheur (XII, 172, 23 = 6425), on fasse allusion au culte des reliques que les adeptes de Buddha pratiquaient avec ses membres. Mais il est vrai que Gautama est un nom trs frquent chez les brahmanes. Daprs Thodor Benfey, des histoires comme celles de Brahmadatta et Pjan (XII, 172, 23 = 5133; Pacatantra, I, 573) et du chasseur avec le couple de pigeons (XII, 143, 10 = 5468) reposeraient sur des sources bouddhiques (et de mme I, 366; II 542, cf. Weber, Ind. Stud. II, p. 361). Srensen dit: in parte principali Mahabharati, nihil Buddhisticum invenitur, in - 20 -

http://www.utqueant.org partibus additis vero multa invenientur, quae fortasse a Buddhistica doctrina originem trahunt ; comme exemples, il donne lhistoire du chasseur juste, dharmavydha (III, 207, 10 = 13710), les rcits du Livre XIII, qui dcrivent la mchancet des hommes lge Kali, en faisant peut tre allusion aux reprsentations bouddhiques, la naissance du mot nirvna. Les rcits du Livre XII, et ses rcits secondaires bouddhiques, ont probablement leur source commune dans le atapathabrhmaa. Les rcits du Livre XIII, comme par exemple lhistoire dAvakra (III, 19, 11 = 1391), sont en partie des pices librement inventes, et non pas des restes danciennes lgendes. Parmi eux, peuvent se trouver beaucoup de paraboles bouddhiques Jattire particulirement lattention sur lhistoire du chasseur Arjunaka (XIII, 1, 18 = 18) qui est proprement identique celle que lon raconta au roi Aoka, pour le tranquilliser sur une vilenie commise par son ministre (Koppen, I, p. 182; Wheeler III, p. 479; cf. Lassen II, p. 232). Parmi les nombreuses sentences du Mahbhrata, beaucoup peuvent provenir de sources bouddhiques. Des phrases comme: je suis mon pre, je suis mon fils, je suis tout ce qui est et tout ce qui nest pas (V, 46, 28 = 1787) ramnent lide du tat tvam asi (XIII, 113, 6 = 5569), qui peut aussi venir directement des upaniad. Le mot nirva est devenu une sorte de Shiboleth du bouddhisme, mais le concept ntait pas encore aussi afft quil est devenu plus tard, le mot napparat pas dans les dits dAoka, mais par contre, il nest pas tranger au le brahmanisme. Dans la Bhagavadgt (VI, 30,15 = 1079, et plus souvent dans le mot compos brahmanirva), il ne dsigne pas encore le summum bonum du bouddhisme (Telang, Bhag., introduction, p. 27, note 1). La mention de nirva, en III, 261, 47 = 15487, repose sur la teneur bouddhique du passage entier. Les bouddhistes sont souvent appels nstika (ils disent nsti, ce nest pas , au contraire des positifs), et ils peuvent aussi avoir t dsigns sous ce nom dans le M a h b h r a t a , par exemple I, 62,18=2300: seul un anstika peut lire le Mahbhrata , ou I, 140, 59 = 5600: le roi ne doit pas laisser un nstika sinstaller dans son pays . Mais ces traces dune influence bouddhique dans les parties tardives du Mahbhrata ne nous aident pas plus dans nos recherches. Nous nous demandons si le noyau propre de lpope connaissait quelque chose du Buddha, ou si luvre dans son ensemble avait dcouvert un fil conducteur travers le bouddhisme.

6.

Il faut bien avouer ici quon na trouv aucune trace de bouddhisme dans

les parties les plu anciennes de lpope, telle quelle se prsente nous maintenant. Comme Srensen, un autre parfait connaisseur du Mahbhrata, John Muir dit (Metr. Transl., introduction, p. 21): I have not noticed any reference to Buddha in the Mahbhrata . Peut-tre, ajoute-t-il, peut-on trouver une allusion au Buddha en XII, 194, 59 = 7124; 249, 11 = 9034; 285, 32 = 10517; mais, outre le fait que le mot buddha apparat avec une signification appellative ( ainsi parlent les buddha , cest- 21 -

http://www.utqueant.org -dire les sages; par exemple III, 297, 23 = 16767), ces passages appartiennent galement au passages les plus tardifs du Mahbhrata. Mme les traces du bouddhisme dans lpope rassembles dans les paragraphes 2 - 4 ne sont pas sres. Et pourtant je crois quil faut essayer de donner sa place lapparition du Buddha dans lhistoire du Mahbhrata. Il me semble que lhistoire de la littrature indienne, et donc lhistoire de lpope indienne, ne peut pas tre comprise si nous ne librons pas du point de vue des brahmanes indiens, qui font comme si jamais Buddha navait exist, ni sa domination, ni lpanouissement culturel de son enseignement. Il est impossible quun des vnements les plus importants de lhistoire indienne nait laiss aucune trace dans le dveloppement de la littrature, quun systme, florissant en Inde pendant plus de mille ans, soit pass sans laisser de traces dans la littrature pique. La raison pour laquelle nous ne trouvons plus aucune rfrence au Buddha dans le Mahbhrata semble reposer sur trois circonstances. Dabord, la rdaction de l'pope sest faite au temps du bouddhisme le plus ancien, le plus modr, qui ntait pas encore si loign du brahmanisme, comme il le deviendra plus tard. Deuximement, tous les traits du bouddhisme ont t radicalement effacs par le remaniement effectu par les brahmanes. Troisimement, la polmique des brahmanes ntait pas dirige contre le Buddha, dont le nom ne devait pas tre prononc, mme une fois, mais contre iva, son alli.

7.

Lpoque o notre pope naquit tait celle du bouddhisme ancien et

modr. Notre pote ne peut pas tre un bouddhiste dans le sens plus rcent du terme; il montre bien trop de got quand il essaye de verser la matire ancienne, telle quelle lui tait parvenue, en la forant dans un moule tranger et contraignant. Le bouddhisme tolrait toute lancienne mythologie, nous trouvons Indra, et Brahman honors ct de Buddha (Benfey, Kl. Sch., I, p. 184; Holzmann, Thierkreis, pp. 26-27). et Aoka semble stre senti plus srieusement bouddhiste que Constantin, quon lui compare souvent, ne se sentait chrtien, et cependant ne mriter le nom dadepte de Buddha, quau sens plus large et plus exact avec lequel nous disons protestants Frdric le Grand et Gotthold Ephraim Lessing. La religion quAoka, comme plus tard le Grand Moghol Akbar, introduisit sa cour tait une religion mlange; il tait lui-mme plus homme que bouddhiste, et comme prince trop avis pour imposer les dogmes bouddhiques ses sujets; ainsi, dans ses dits, il mit bien plus laccent sur lhumain en gnral (Weber, Ind. Strf., III, p. 285). Ses dits gravs recommandent de pratiquer, par dessus tout rite crmoniel, une tolrance gnrale et de bonnes murs, ils prchaient la conciliation et la tolrance envers les autres croyances, mais nommaient rarement Buddha. Le bouddhisme semble avoir vcu longtemps librement ct du brahmanisme; et cest seulement au cours du temps quil devint clair que deux principes ennemis saffrontaient la vie - 22 -

http://www.utqueant.org et la mort. Tout dabord lenseignement du Buddha sembla ntre quun des nombreux aspects de lancien brahmanisme ( one aspect of the older Brahmanism , Tchang, Bhag., introduction, p. 25), une des nombreuses sectes qui fleurissaient en Inde au temps dAoka. Ainsi, Max Mller (anc. lit., p. 260): Buddhism, up to the time of Aoka, was but one of the many sects established in India ... There was as yet no Brahmans as opposed to Buddhists, in the later sense of the word. No separation had as yet taken place, and the greatest reformers at the time of Buddha were reforming Brahmans ... His (Buddhas) pupils were many of them Brahmans, and no hostile feeling against the Brahmans finds utterance in the Buddhist Canon ... Buddhism, in its original form, was only a modification of Brahmanism. It grew up slowly and imperceptibly, and its very founder could hardly have been aware of the final result of his doctrine . Srement le Buddha ne voulait enseigner rien dautre que ce quenseignaient dj les upaniad anciennes ou rcentes, qui rejetaient pareillement la saintet des uvres et les cultes crmoniels, et considraient les V e d a comme insuffisants pour obtenir le bien suprme (cf. Telang, Bhag., introduction, p. 214). La profession de foi propre, cette poque trs tolrante et trs cultive, tait bien plus le panthisme, comme cela est bien dit clairement dans les parties les plus anciennes de la Bhagavadgt.. Pour autant quelle mette clairement en garde contre les Veda, acerrima his verbis inest Vedorum vituperatio (Schlegel propos de Bhagav. 2, 42 ou IV, 26, 42 = 920; cf Muir S.T. III, 31; IV, 381), elle est cependant en relation avec le bouddhisme, comme le supposait Wilson, mais pas en relation aussi troite quavec les upaniad. Il semble que le bouddhisme na pas pris au dbut une position si dure contre les Veda et le systme des castes; le dveloppement de ses propres principes ly a contraint par la suite. La Bhagavadgt non plus, ne fait pas grand cas des Veda, elle vite juste de les surestimer, et ncarte pas le systme des castes, sil se fonde sur des devoirs moraux: tout fait comme le bouddhisme ses dbuts. Jusque l, la paix tait possible; ce nest que quand les adeptes du Buddha rejetrent lautorit des Veda et nirent le systme des castes, que les brahmanes se prparrent au combat pour rester ou tre dtruits. Sont-ce des questions thologiques ou philosophiques qui dclenchrent cette guerre ? Nest-ce point plutt linfluence que les bouddhistes avaient prise sur les peuples et les rois, de manire ruiner compltement linfluence des brahmanes ? (Foucaux, Onze pisodes, introduction p. 29).

8. Ensuite, nous devons supposer que, pendant le combat contre le bouddhisme, et


mme aprs sa dfaite totale, une limination complte et soigneuse des lments bouddhiques dans notre pope a t entreprise systmatiquement et que tout a t cart qui rappelait, mme de loin, lexistence du Buddha et de son enseignement. Ainsi, par exemple, le nom de la ville natale du Buddha, Kapilavastu, non seulement - 23 -

http://www.utqueant.org napparat nulle part dans le Mahbhrata, mais il semble jusquici ntre cit dans aucun texte non-bouddhique de la littrature indienne; pour cette raison Senart (1875) est enclin penser quil faut entendre ce nom de manire allgorique, bien que, daprs Kppen, des plerins chinois auraient dcrit les ruines de Kapilavastu. Il ne faut pas seulement extirper le bouddhisme, mais tout ce qui peut faire penser lui, daprs la phrase: Qui nhonore pas Ka, doit rester inconnu, mme aprs sa m o r t (II, 39, 9 = 1408). Cette haine de lhrtique se montre de faon suffisamment claire dans le Mahbhrata et les Pura actuels; pas une seule fois Ka ne permet Ghaotkaca de confier quil a ha les brahmanes et leurs sacrifices (VII, 181, 27 = 8239): tout pch peut tre rpar, seul qui frquente les bouddhistes et les hrtiques ne peut tre pardonn, dit le Bhannradyapura (Aufrecht cat. Bodl, 10a). Et encore plus, tout souvenir de cette poque .doit tre extirp de ces livres populaires qui sont destins visiblement tre lus par les laques: les brahmanes savaient quune polmique violente pouvaient veiller chez les lecteurs doute et curiosit, ils dcidrent de se taire compltement sur le Buddha et son uvre.

9.

Mais la vraie raison pour laquelle on ne peut plus trouver, en quantits

significatives, de traces bouddhiques dans le Mahbhrata, se trouve ailleurs. Comme nous lavons dj not, lorsque les brahmanes lancrent contre lui leur offensive principale, le bouddhisme tait dj corrompu par son alliance avec le shivasme. Quand, en r-crivant le Mahbhrata, les brahmanes voulaient qualifier de criminels tout le parti de Duryodhana, pouvaient-ils laisser percevoir quils avaient des liens troits avec le Buddha tant ha ? Ainsi ils sentendirent pour dsigner tous les adversaires dArjuna. comme des Shivastes. Dabord, en ce qui concerne la personne de Duryodhana, nous trouvons des passages dans lesquels il nest pas seulement question dune attitude inamicale et ngative envers le couple Ka-Viu, comme nous lavons dj dit, mais aussi dune relation avec iva et dune inclination envers lui. En 1850, Weber avait dj (Ind. Stud. I, p. 206) mis en lumire cette proposition importante, que les Kaurava avaient un penchant pour le Shivasme; et Muir (S. T. IV, p. 216-228) montre clairement Duryodhana comme adversaire de Ka-Viu. Dans un passage, Duryodhana est dit image de iva et de Dev (III, 252, 8 = 15162). Dans un autre, il est mis en relation avec les Rkasa: les rois ennemis de Ka sont des Daitya, des Dnava et des Rkasa qui ont pris forme humaine (VI, 66, 10 = 2982). les frres du Duryodhana sont des Rkasa (15, 31, 10 = 852); de mme, ses fidles (III, 252, 23 = 15178; XVIII, 5, 28 = 174). Mais Rmnuja et les disciples de cet aptre du vishnouisme ont donn le nom de Rkasa iva (Wheeler, History, IIIme partie, chapitre VIII). Avant que les vishnoustes ne se rconcilient avec les shivastes, iva, le dieu protecteur des bouddhistes, tait un esprit mauvais. Des - 24 -

http://www.utqueant.org Rkasa apparaissent sous laspect de brahmanes dans les descriptions du funeste ge Kali (19 Bhav. 4, 16 = 11180): sur IX, 64, 38 = 3619, Nlakaha remarque que Crvka tait un Rkasa qui avait pris laspect dun brahmane. Peut-tre les statues des dieux de Duryodhana en font-elles aussi partie, si nous devons comprendre par l les statues de Buddha et de iva. Lassen, le premier (I, p. 939), a attir lattention sur ce passage o les statues de dieux de Duryodhana pleurent et tremblent, dansent et rient (VI, 112, 11 = 5208). En VI, 2, 26 = 20, on nous dit quavant dbut de la grande bataille, les statues de dieux de Duryodhana tremblent, rient, transpirent, crachent du sang et se renversent. Il est remarquable que les idoles ne sont voques que pour le roi des Kaurava. It may be doubted if any image-worship occurs (dans le Mahbhrata et le Rmyaa) , dit Wilson (Vish. Pur. introduction p. 4). Dj pour Pini, le commerce et la vente didoles taient supposs tre tout fait habituel (Weber, Ind. Stud., V, p. 149). La partie la plus tardive du Mahbhrata, le Livre XIII, connat les vendeurs didoles, les devalaka (XIII, 90, 14 = 4283 sq), et en annexe, on mentionne parmi les prsages les plus terribles avant le dbut du combat entre les dieux et les anti-dieux le fait que les idoles ouvrent et ferment les yeux, rient et pleurent, gmissent et crachent des flammes (19 Bhag., 46, 18 = 12800). Mais certains des fidles et amis de Duryodhana sont encore plus nettement que lui en relation troite avec iva, et plus prcisment avec le iva bouddhiste; en premire ligne, Avatthman, le fils de Droa. Le rcit de la vengeance nocturne dAvatthman nous montre de faon vidente le foss profond qui spare lune de lautre, la plus ancienne de la plus rcente recension; le caractre du hros sacerdotal est saisi de faon totalement diffrente dans chacune dentre elles. Lannexe dj cite, partir de X, 10, 1 = 543, en fait le pcheur criminel que tout le monde connat (X, 16, 9 = 731); les rcits antrieurs le dpeignent comme un hros courageux qui, fidle son devoir, venge le meurtre dloyal de son pre, sans trouver un seul mot de blme pour ses actes. La description de lassaut nocturne sur le camp des Pava est trs vivante et beaucoup de traits sont conservs de lancien rcit: ainsi lattaque du hibou sur les corneilles, qui reprsente par un vnement extrieur le mrissement intrieur du sentiment de vengeance, de faon vraiment pique. La discussion dAvatthman avec ses deux compagnons, qui veulent sen tenir aux vieilles rgles de la guerre et considrent le meurtre dennemis endormis comme honteux, tandis quAvatthman indique que ce sont eux qui ont arrach derrire eux les ponts du devoir (X, 5, 1, 8 = 193 - encore un dbat sur les deux principes autour desquels tourne toute lhistoire de la bataille, dans sa version ancienne). Puis le trajet nocturne vers le camp des ennemis, que les deux compagnons suivent en hsitant; ensuite la description, comment il saute aisment au dessus de lenceinte du camp, comment il rveille coups de pied le meurtrier de son pre, et ltrangle de ses propres mains; la description trs vivante de leffroyable bain de sang quinflige le hros, pensant toujours son pre, tous les - 25 -

http://www.utqueant.org membres ensanglants, la poigne de son pe colle sa main par le sang ruisselant, ne ressemblant presque plus un tre humain; la description des cris pitoyables des assaillis qui ferment les yeux en tremblant et se laissent tuer sans combattre, ou, en totale confusion, tombent les uns sur les autres, aveugls par leffroi et les nuages de poussire qui montent de la terre sature de sang et obscurcissent tout. En plus de cela les lphants devenus fous de terreur pitinent leurs matres, des dmons assoiffs de sang se pressent, qui, la vue du sang vers, hurlent, dansent et crient: que cest bon, que cest bon ! Beaucoup fuient vers les portes, mais l, Kpa et Ktavarman les attendent et les abattent. Finalement tout le camp est incendi et beaucoup dennemis qui staient cachs, quittent leur refuge et sont tus impitoyablement, mme ceux qui se rendent et crient grce. Ainsi se termine la tuerie, et quand Avatthman quitte le camp laube, il est aussi silencieux que le soir avant, quand il y est entr. Jubilant, les trois hros se htent de rejoindre Duryoshna et le trouvent encore en vie, crachant du sang et se dfendant avec peine des btes sauvages qui attendent sa mort. En pleurant, ils essuient le sang de sa bouche et de ses mains et lui racontent leur vengeance couronne de succs. Va l o est mon pre, dit Avatthman, salue-le et embrasse-le de ma part, et annonce-lui quil est veng . Le roi se sent heureux, semblable aux dieux: adieu, nous nous reverrons au ciel ; et l-dessus; il meurt. Lancienne version devait se terminer de faon glorieuse par la mort et la monte au ciel de Duryodhana; de cette dernire, le Mahbhrata actuel a conserv trace: la fin, Yudhihira rencontre Duryodhana au ciel, parmi les lus, mais ses propres frres sont en enfer; ce que lon expliquera bien sr plus tard comme une illusion (image trompeuse, my). Cet ancien passage contient un pisode hautement remarquable. On observe quAvatthman a excut sa vengeance presque sans aide. On est pas loin de supposer que lancien rcit lui avait adjoint un des anciens dieux pour laider, dont lintervention a t dabord comme entirement efface, mais rintroduite plus tard sous le nom dun des nouveaux dieux. Pendant sa vengeance elle-mme, lhorrible desse de la mort, Kl, se glisse ses cts et lance des nuds coulants autour des pieds de ceux qui attaquent ou demandent grce (, 8, 69 = 387); mais Kl, lpouse de iva, est une des divinits les plus rcentes. On trouve une allusion la reprsentation la plus ancienne dans le fait quAvatthman, se tenant devant le camp de ses ennemis endormis, aurait senti la difficult de son entreprise et pens que le destin tait son seul recours (X, 6, 21 = 236). (pour autant que ce passage soit authentique; mais il faut remarquer en outre que, puisquil avait dj rejet les conseils de ses amis et dcid le meurtre de ses ennemis endormis, cest un ajout postrieur malhabile, car ce changement soudain de sa manire de penser nest pas motiv et reste sans consquence.) Aprs cette rflexion, que le destin tait son seul recours, Avatthman, dans lancien rcit, ne peut adresser ses demandes et ses prires qu Brahman, car Brahman est dans lancienne pope le destin personnifi. On peut - 26 -

http://www.utqueant.org comparer avec le passage trs semblable I, 38, 3 = 1624. Elpatra, le roi des serpents menacs dextinction, dit: le destin est maintenant notre seul recours . Mais sous ce destin vers lequel on doit se tourner, comme le montre la suite de lhistoire, il comprend Brahman, la Moira des grecs personnifie. Dans lancienne pope, Avatthman sest aussi tourn vers Brahman, et sur son ordre, un des anciens dieux, Agni, laccompagne et soutient son uvre de vengeance. Mais bien sr par la suite, lami des hrtiques, lennemi des adorateurs de Viu, ce brahmane combattant ne pouvait plus apparatre en relation avec Brahman, ni son uvre comme le compterendu dune punition dcide par Brahman. Un autre dieu, plus redoutable, devait prendre sa place. Cest iva quil invoque, et ce dieu lui apparat alors la porte, sous un aspect terrible, avec mille yeux, de longues dents et un collier de serpents, un regard de colre et rejetant du feu par tous ses pores. Autour de lui, sa suite difforme, une foule dtres tranges, sans tte, sans bras, laspect de chiens, de sangliers, de chameaux, de chacals avec des ttes dours, de chats, de corneilles, de perroquets, dans les mains des armes et des instruments de musique, chantant et dansant (X, 7, 13 = 263). Cette arme difforme de iva (dcrite aussi en VII, 202, 19 = 9511) procde de la dmonologie shivate, mais apparat aussi dans le bouddhisme, comme larme des dmons Mra qui tentait le Buddha (dpeinte par Kppen, I, p. 88; II, p. 136; par Lefmann, Gesch. d. alten Indiens, p. 607). Avatthman rcite les noms du dieu et soffre lui-mme comme offrande, si le dieu lui vient en aide; le dieu pourrait accepter favorablement le sacrifice, et rendre ses ennemis sans dfense: cela signifie donc, en langage daujourdhui, quil vend son me au diable. L-dessus, un autel slve devant iva, sur lequel se trouve un feu allum; Avatthman y pntre, les bras levs. iva explique alors que lheure de la mort des vainqueurs a sonn: il donne Avatthman un corps dune force extraordinaire, et une pe excellente. Ainsi cest iva, le dieu tellement ha par les anciens vishnoustes, le dfenseur du bouddhisme, qui hte la vengeance contre les P a v a restants. Dautres passages montrent clairement que cest i v a quAvatthman doit sa victoire; ses pnitences lui valent les grandes faveurs de iva (VII, 201, 91 = 9484; IX, 6, 14 = 306); il sappelle Rudraja (XV, 31, 10 = 852); parce quil a pris refuge en iva, sa vengeance est un succs (X, 17, 6 = 765); ce nest pas le fils de Droa, mais iva, qui a accompli cette action (X, 18, 26 = 811); il est une forme de iva (I, 67, 73 = 2709). La r-criture a t difficile, parce que le grand criminel Avatthman appartenait la caste des brahmanes, mais on laissa subsister ce fait comme exemple de la dtestable confusion des castes chez les bouddhistes. Labolition des diffrences de castes est attribue expressment au bouddhisme dans le pome cit plus haut, akaravijaya, V, 5 et 22. Buddha, un guerrier a dpass les devoirs de sa caste, il a enseign et reu des cadeaux , dit Kumrila Bhaa, daprs Muir S. T., p. 509. De plus, il est vrai que presque tous les passages du Mahbhrata qui prsentent une vue plus tolrante de la nature des castes sont en - 27 -

http://www.utqueant.org relation avec le nom de iva, qui est aussi un reprsentant du bouddhisme. iva veut galer les dras honntes aux brahmanes (XIII, 143, 48 = 6612), car ce ne sont pas la naissance ni lrudition qui font le brahmane, mais le comportement (vtta). Nous avons dj remarqu plus haut quil a t particulirement not quAvatthman avait des lves et des amis mme dans la troisime caste. En dehors de Duryodhna et dAvatthman, de nombreux autres ennemis des Pava ont un lien direct avec iva. Ainsi est-il dit de Jayadratha quil a d sa victoire sur ceux-ci grce la faveur de iva (III, 272, 29 = 15805; VII, 42, 14 = =1754). Un shivaste de lpoque de lalliance entre le bouddhisme et le shivasme, cest Jarsandha, le roi du Maghada. Albrecht Weber (Ind. Stud., I, p. 185) remarque que le Maghada semble tre dans les rcits piques un pays particulirement heureux et convenable, que cest peuttre l que sest forme la base de lpope, que les Mghada ou bardes du Behar du sud soccupaient des affaires des peuples voisins, que le quatrime V e d a prononce avec haine le nom de Maghada. Mais Maghada tait aussi un sige principal du bouddhisme, que son fondateur lui-mme aimait sy arrter (cf. Oldenberg, Buddha, p.8; 145). Lassen II, p. 79; Weber, Ind Stud., I, p. 186 remarquent que les noms des montagnes autour de Rjagha, la capitale du Maghada, sont en partie bouddhiques. Le Mahbhrata nous raconte que ce Jarsamdha avait fait faire Maghada une fte en lhonneur dune Rkas, du nom de Ghadev, qui, quand il tait jeune, lui avait sauv la vie (II, 18, 2 = 730). Que lon se souvienne que le nom de Rkasa dsignait les ennemis de Ka-Viu, et spcialement les shivastes, que le shivasme prenait ses racines dans le culte du dieu domestique et du genius loci, ainsi que les populations indignes avaient apport. On remarque aussi que Jarsamdha tait un ennemi acharn de Ka (II, 14, 18 = 582), quil stait attribu des noms qui nappartenaient qu Viu, comme Vsudeva et Puruottama (II, 19, 22 = 761). Toute sa force, et ses conqutes, il les doit iva, en lhonneur duquel il a fait pnitence (II, 14, 64 = 629). Avec laide de iva, il a captur de nombreux rois, quil veut offrir en offrandes son dieu. la porte de sa capitale, sont placs trois tambours (bheri), de nouveau une coutume bouddhique (II, 21, 16 = 812) Enfin, Jarsamdha sera tu par Arjuna, Bhmasena et Ka, tous trois dguiss en brahmanes. Ce rcit de la chute de Jarsamdha est confus et sans signification, mais, de manire tonnante, il a t conserv ainsi, de telle sorte que la sympathie du lecteur se tourne vers le noble et pacifique Jarsamdha qui apparat dans une lumire bien plus favorable que ses adversaires dguiss et menteurs; quand ses amis prtendent quil a t vaincu et tu de manire dloyale (II, 37, 23 = 1360; II, 42, 1 = 1474), le rcit lui mme leur donne raison mots couverts. Nous nous trouvons ici en prsence dune r-criture malhabile dune version bouddhique-shivate antrieure. - Concernant iupla, Lassen (I, p. 874; p. 822) a montr que son combat symbolisait la guerre entre le vishnouisme et le shivasme; cest le champion du shivasme, et il est tomb injustement et seulement par tratrise (II, 37, 23 = 1360); - 28 -

http://www.utqueant.org car il a injuri Ka, il la trait de tueur de vache, de tueur de femme (II, 41, 16 = 1448), de simple berger (II, 44, 26 = 1541), desclave, il a dit quil ntait pas un roi (II, 45,, 4 = 1564), quil avait, comme Jarsamdha usurp les noms de Viu, Vsudeva et Puruottama (II, 14, 18 = 582. Ka, cest--dire le brahmanisme rgnr li au vishnouisme, sest laiss infliger cent offenses de la part de iupla, cest--dire le shivasme bouddhique (II, 48, 24 = 1517). la cent-unime, il la tu car le compte tait atteint (II, 45, 24 = 1583)? Comme iva, iupla est n avec trois yeux (II, 43, 1 = 1494. cf. Weber, Ind. Stud., I, p. 482).

Chapitre I, 14

Lancien Mahbhrata du pote


Notre hypothse serait donc de fixer entre 250 et 200 avant J.-C. le dbut de la deuxime priode de lhistoire du Mahbhrata, celle de sa fixation artistique par un pote bouddhiste (dans lancien sens du terme) la cour du roi Aoka, et de sa diffusion progressive dans des cercles bouddhiques et ivates. _______________________________________

1.

Comme nous lavons dit, lancienne pope est, selon notre hypothse,

luvre dun pote indpendant, un gnie de premire grandeur, qui nen a pas invent la substance mais la trouve dans le domaine des anciens rcits. La maison dominante, laquelle il consacrait son service, se rattachait de quelque manire la dynastie mythique de Duryodhnana, quelle honorait peut-tre comme lanctre fondateur; en Orient, les dynasties nouvelles cherchent toujours se rattacher des dynasties plus anciennes. Les convictions religieuses du pote taient un bouddhisme modr; mais il a introduit dans son pope tout le panthon de lancienne posie pique. Le noyau de lpope tait le combat de Duryodhana, le hros principal tait Kara. Lpope commenait avec la partie de ds, et se terminait avec les lamentations, lattaque nocturne dAvatthman et la mort de Duryodhana. les nouveaux dieux, Viu et iva ntaient pas encore connus; seuls valaient les anciens dieux, Kara ne connat et nhonore que le soleil, III, 302, 4 = 16980, et, avant son dernier combat, ne fait appel qu Srya, VII, 36, 9 = 1678. Le parti ennemi, les Pava, ntaient pas encore dpeints comme des parents de Duryodhana; de leur ct, le rle principal est tenu pat Ka, riche en stratagmes. Le pome comprenait vraisemblablemement de nombreux pisodes: aujourdhui encore un grand nombre - 29 -

http://www.utqueant.org dentre eux donnent limpression dune trs haute antiquit (cf. Hopkins, Rul., C, p. 68: some of the latter bear the stamp of being older each as a whole than the time when they were inserted into the Epic (certains de ceux-ci, considrs comme un tout, portent la marque dune anciennet plus grande que lpoque o ils ont t insrs dans lpope). Jattribuerais sans autre la partie la plus ancienne de la Bhagavadgt lancienne pope.

2.

Est-ce que le pote pouvait rsister la tentation de dresser dans son pope

un monument sa propre personne, comme un peintre, dans un tableau historique, prte ses traits un modeste spectateur qui se tient dans un coin ? Personne ne pourrait se prter mieux cela que Vidura, le frre de basse naissance de Dhtarra et de Pu; Vidura est un personnage que le pote a faonn lui-mme; il nest pour le moins pas impossible quil se soit dpeint la postrit dans cet homme modeste et amical; Vidura signifie kavi, , 58, 15 = 2006, ce qui peut vouloir dire pote, mais pas obligatoirement; Entendez ma voix de pote , dit Vidura, II, 61, 4 = 2097; II, 63, 7 = 2117.

3.

On ne peut pas savoir si l''pope a subi des transformations et des ajouts

aprs la mort du pote, encore avant de tomber dans les mains des brahmanes, mais il est vraisemblable que le Mahbhrata, na pas chapp au sort traditionnel de la posie pique depuis ses dbuts. Il se peut que l''pope ait t rapidement pntre par des sympathies bouddhistes spcifiques, mais particulirement que, alors que la confusion se produisait entre le bouddhisme et un shivaisme populaire, iva lui-mme ait ft son introduction dans l''pope; cela serait dautant plus comprhensible que ceux qui ont plus tard remani les textes ont pris parti pour Arjuna et ses frres, mais devaient reprsenter Duryodhana et ses partisans comme des hrtiques et des criminels.

4.

Pour les deux premiers sicles avant J.-C. et pour un certain temps aprs le

dbut de notre re, nous devons nous tourner vers des mentions de notre pope sous sa forme ancienne. Il nous faut honntement constater labsence de toute mention un Mahbhata bouddhique. Seulement combien peu nous apprenons du Buddha et du bouddhisme dans la littrature brahmanique sanskrite ! Des fragments bouddhiques devraient tre contenus dans le Mahbhrata en langue tibtaine, Kppen, II, p. 281, mais nous ne savons rien de leur nature. Les courtes notes propos duvres sanskrites plus anciennes ne nous aident pas non plus. La mention du nom du Mahbhrata dans les stra dvalyana non plus; dans une autre version ce nom est omis; de plus lpoque o a vcu valyana est elle-mme trs - 30 -

http://www.utqueant.org incertaine. Les passages de Pini sur lesquels on pourrait sappuyer ici, ne permettent pas de dcider si il connaissait ou non notre pope sous sa forme la plus ancienne; mais cela ne serait certainement pas possible sil fallait placer Pini verrs 350 avant J.-C. et si la date de la rdaction de notre pope (250 - 200 avant J.-C.) tait juste. Mme la citation de Patajali, que lon situe vers 150 avant J.C., ne nous permet pas de dcider, un de ses exemples, dharmea sma Kuravo yudhyante, me semble signifier quil partageait le point de vue de lancienne pope: les Kuru combattaient avec loyaut, et jajoute: pas les Pava. Le rcit bien connu de Dion Chrystostomos place le parti des vainqueurs au premier plan.

Chapitre I, 15

Le premier remaniement brahmanique


Peu de temps aprs le dbut de la grande bataille entre le bouddhisme et le brahmanisme, les brahmanes remanirent l''pope pour la rendre conforme leurs buts et opposrent lancienne version une rdaction plus orthodoxe. Celle-ci se distingua surtout de lancienne par la glorification des Pava et le dnigrement des Kaurava, par la vogue de Viu et la dification de Ka, par laccentuation dun brahmanisme orthodoxe. Cette premire rdaction brahmanique tait encore hostile iva. ______________________________________

1.

Les Pava, (cest--dire les cinq frres, mais sans leur pre, Pu)

appartiennent dj lancien rcit et jouent un rle important dans le Mahbhrata dorigine. Dans le remaniement, ils apparaissent comme les cousins du chef du parti adverse. Dans lancienne pope, ils taient peine apparents avec leurs ennemis; ils nont t intgrs dans lancienne dynastie quau moment et lendroit o ils reprsentaient la maison royale dominante. Mon opinion quils nappartiennent pas lancienne dynastie vient incontestablement du fait des coutumes de polyandrie rgnant chez eux; cet gard, Yudhihira cite explicitement lexemple de ses anctres. Les Pava sappuient sur une ancienne tradition (ex populari fabula sumpti, Srensen, p. 361), celle de la polyandrie qui rgne chez eux et frappe lauteur de manire si drangeante et que par ailleurs, celui qui a remani le texte - 31 -

http://www.utqueant.org aurait facilement pu laisser de ct. Sur les Pava en tant que peuple, cf. Lassen, II, pp. 872; 879, et particulirement Weber, Ind. Stud.. II, pp. 402-404. De Weber, nous apprenions que les Pava sont apparus comme souverains dans diffrentes parties de lInde jusquau IIme sicle aprs J.-C., et quils taient dpeints par les bouddhistes du nord comme un peuple montagnard de brigands. Ensuite les bouddhistes virent dans les Pava des ennemis et des pillards, et tout cas, pas des bouddhistes; ils appartenaient plutt la secte des serviteurs de Ka-Vsudeva, qui se dveloppait alors; les bouddhistes du nord avaient sur les Pava le mme point de vue que lancienne pope. Les cinq frres, et leur appellation de Pava, faisaient partie de lancien rcit, mais il en va probablement autrement de leur pre Pu. Ce nom, et le personnage qui le portait, furent invents seulement lors du remaniement, nous sommes arriv la conclusion que les Pava existaient avant leur pre Pu (Ludwig, myth. Element, p. 9). Le nom de Pu (comme nom propre) nest mentionn nulle part dans les brhmaa, Weber, Ind. Stud. I p. 206; II, p. 402, sinon dans des uvres qui ont puis ostensiblement dans le Mahbhrata, comme le Mrkadeyapura (Monier Williams, Indian wisdom, p. 495); ce quil en est dit est copi daprs les indications sur Vicitravrya et Citrgada: ils meurent tous les deux jeunes et laissent deux veuves derrire eux. De mme laveugle Dhtarra nest peut-tre quune reproduction du lpreux Citrgada. On a introduit une gnration entire pour pouvoir faire entrer les Pava dans la gnalogie des anciens Kuru. Cela a d se produire une poque o les Pava taient la dynastie dominante dans une partie de lInde (cf. Weber, Ind. Stud. II, p; 402), et trs tt, peut-tre avant le remaniement du reste, car dj Patajali connat Nakula comme un Kaurava. Comme on ne pouvait rien dire de plus propos de Pu, on le fit mourir tt, juste aprs la naissance de ses fils. Mais leurs noms se trouvaient dj dans les versions les plus anciennes de l'pope, cependant non comme des fils de Pu, peut-tre mme pas comme des frres. On peut tenir pour certain que lpope, telle que nous la connaissons, a t remanie pour servir les intrts dune famille royale (Ludwig, op.. cit., p. 9); cette famille royale se serait compte parmi les Pava (sub rege quodam Panduida, Srensen, p. 361, qui ne parle cependant pas de lpope remanie, mais de l'pope ancienne) et aurait fait remonter son origine Arjuna. Car en effet on pensait que les familles royales staient teintes lors de la guerre des Bhrata, comme les dynasties grecques lors de la guerre de Troie; cette manire de voir sexprime encore dans le Matsyapura; l, Brahman nat sous forme humaine, pour fonder de nouvelles dynasties (Aufrecht, cat. Bodl. 39a). Notre pope dit aussi des Pava quils ont t presque compltement extermins, Droa et Avatthman auraient ananti toute la ligne et personne nexisterait plus de la famille royale, il nen resterait plus que le souvenir, XV, 36, 32 = 988; Il ,en va pas mieux avec les Cedi et les Matsya. De mme, dans le Mausalaparvan, les Ydava sont compltement liquids; mais comme plusieurs peuples le long du Gange et dans le Dekkan se donnent plus tard comme des descendants des anciens Ydava, il faut que Vajra, un arrire petit fils de Ka, - 32 -

http://www.utqueant.org conduise Indraprastha le reste des Yadava, XVII, 1, 9 = 9, cf. Wilson, Vish. P., V, p. 150. La destruction des Kaurava est annonce tout au long de l'pope, mais le remaniement ne peut laccepter; Yudhihira rgne comme auparavant, dans le antiparvan et dans les livres suivants, sur un royaume trs peupl, la ligne des Pava est conserve travers Parikit, le fils posthume mort-n dAhimanyu, ressuscit par la toute-puissance de Ka. Je suppose que les rois postrieurs des Pava tireront leur origine de ce Parikit, et ainsi ce sont des intrts politiques et religieux qui travailleront au remaniement du Mahbhrata.

2.

Les ides religieuses dominantes de l'pope souffrent un bouleversement

profond avec lintroduction du vishnousme. Les lignes des Andhaka, Vi, Stvata, honorent Vsudeva, probablement un hros de la ligne difi; perhaps it is possible that Vsudeva was a famous prince of the Stvata race and on his dead was deified and whorshipped by his clan (il est peut-tre possible que Vsudeva ait t un fameux prince des Stvata, difi aprs sa mort et vnr par son clan), R.G. Bhandakar, Report 1883-1884, p. 74. son culte, sest attache une religion, qui a pntr profondment lInde, une religion des guerriers, qui a su raconter bien des choses sur les actions de son dieu; ses aventures ne portent pas la marque des anciens rcits hroques, Vsudeva nest pas un preux chevalier, il fait preuve plus de ruse et de perfidie que de vritable courage, lui mme, comme ses parents et le peuple belliqueux de bergers qui lentoure, a plutt une tendance livresse et la bonne vie, au jeu et aux amours charnels. Nous navons pas devant nous ni un peuple ni une religion strictement brahmanique; les lignes qui vnrent Vsudeva, les Ydava, nappartiennent pas aux peuples du centre, leur anctre fondateur, Yadu, dans la trs ancienne lgende de Yayti, dshrit par son pre, en avait t exclu. Mais les brahmanes, quand ils cherchaient des allis pour le grand combat contre les bouddhistes, avaient d chercher gagner leur cause les adorateurs de Vsudeva. Ils russirent cela en faisant lamalgame entre Vsudeva et Nryaa, le dieu des eaux primordiales, des eaux de la cration, qui avait pris entre-temps une certaine importance dans le monde brahmanique (Weber, Ind. Stud. IX, p. 2), une forme plus ancienne de Viu. Dans le antiparvan, Nryaa nest pas encore tout fait Viu, le premier mane du dernier; comme dans la Nryaya-upaniad; lpoque de la rdaction de notre pope montre toute une floraison du culte de Nryaa les deux propositions sont de Weber, Lit., G. p. 184). Dans le Brahmavaivartapura, Nryaa est la premire crature de Brahman, Viu la dernire, Aufrecht, Bibl. Bodl, p. 21. Les deux Vsudeva et Nryaa, se confondent ensuite en Viu, un ancien dieu du soleil dont le rle tait dj significatif dans les Veda, mais qui, par sa liaison avec le populaire Vsudeva, et le panthiste Nryaa, a t lev au rang de dieu le plus important, comme les Grecs aussi ont essay au moins de le faire avec un de leurs dieux les plus insignifiants, Pan, au moyen dune tymologie fantaisiste; dans la littrature des brhmaa, Viu navait aucun droit cette position leve. Mais lidentification lourde de consquences du Ka pique avec le belliqueux - 33 -

http://www.utqueant.org Vsudeva des Pava, a t encore plus importante pour le faonnage de lpope. Une divinit du nom de Ka est encore totalement inconnue dans les quatre Veda. Lpope connaissait un Ka, auquel elle attribuait un rle trs significatif, le chef dun peuple de bergers allis aux Pava, qui cependant napparaissait pas comme un guerrier (il ne combat jamais, il se contente de conduire le char dArjuna), mais comme un politique rus, dont les conseils perfides en opposition avec les anciens concepts dhonneur chevaleresque sont mis en uvre par les Pava qui obtiennent ainsi la victoire. Mais Ka tait aussi un des noms du Vsudeva des Ydava, que les brahmanes, pour des raisons plus politiques que religieuses, ont identifi leur Viu, lgitim par les Veda. Et ainsi se dessina un pas important, lourd de consquences pour le Mahbhrata: lintrigant fut lev au statut de hros, voire de dieu, et Ka dclar identique Vsudeva et Viu. Il en rsulta un remaniement complet de l'pope qui mit compltement sens dessus dessous son ancien arrangement.

3.

Tandis que des ides compltement nouvelles pntraient l''pope, mais que,

dautre part, celle-ci se maintenait cependant fermement attache dans ses traits principaux conserver la mmoire de lancien rcit, laquelle elle aurait pourtant d renoncer, il ne pouvait pas manquer que divers aspects de Ka-Viu se trouvent lun aprs lautre ou lun ct de lautre dans notre pope. Tantt Ka nest quun homme, tantt il est une incarnation de Viu, tantt Viu lui-mme. Dans le plus grand nombre des passages ce dernier a dj atteint la suprmatie, dans dautres il est encore clairement subordonn aux anciens dieux Indra et Brahman. Cf. Wilson, Vish., intr., p. 15: In other places, the divine nature of Ka is less decidely affirmed; in some, it is disputed or denied; and, in most of the situations in which he is exhibited in action, it is a prince and a warrior, not a divinity. He exercises the superhuman faculties in the defence of himself or his friends, or in the defeat and destruction of his foes (dans dautres passages, la nature divine de Ka est affirme de faon moins dcide, dans quelques uns, elle est discute ou dnie, et dans la plupart des situations qui montrent Ka en action, il est un prince ou un guerrier, et non pas une divinit. Il nexerce aucune facult surnaturelle dans la dfense de lui-mme ou de ses amis, ou dans la dfaite et la destruction de ses ennemis). Dan la version actuelle de lpope encore, la divinisation de Ka est rendue peu peu plausible au lecteur, avec certaines prcautions; tout dabord, il apparat comme un simple homme, ensuite, partir de I, 224, 8 = 8160, il est dclar identique Nryaa (Brahman doit lexpliquer Agni, pour lequel cela est nouveau), ensuite Indra dcouvre, III, 47, 13 = 1891, que Nryaa est Viu. Les deux noms, Nryaa et Viu, seront employs indiffremment pour dsigner le mme dieu, III, 101, 9 = 8722 entre autres. Que la suprmatie de Viu ait t un ide neuve laquelle les contemporains se sont habitus lentement et avec hsitation, le discours des anciens dieux pour lintroduire et le prsenter, ainsi que les remarques sur les hommes mauvais qui ne veulent pas croire la divinit de Viu, le montrent assez. Ainsi, les dieux tonns demandent Brahman, VI, 66, 3 = 2975, - 34 -

http://www.utqueant.org quel tait ce dieu quil adorait, et Brahman les instruit en dtail sur la personne et la nature de Viu (cf. mon essai sur Brahman in ZDMG XXXVIII, pp. 200-203). On se plaint en maints passages des hommes qui dnient la divinit de Viu, notamment en VI, 66, 18 = 2990; ils sont menacs de ruine et de destruction, VII, 11, 41 = 422. Le Viu de lpope, ainsi lev en dieu suprme, na rien voir avec le Viu des anciennes hymnes, le Viu des Vedas nest en aucune manire le Viu des mythographes , Burnouf, Bh. P. III, intr. p. 22.

4.

La mise en valeur de Viu et du cercle de divinits sassemblant autour de lui,

rendait ncessaire un recul des anciens dieux, une indiffrence en partie intentionnelle, en partie fortuite, envers le contenu des anciennes lgendes. Devant lclat de Viu, les anciens dieux passaient larrire plan, leurs actions taient attribues Viu, qui joue avec Indra et Brahman comme un enfant avec une marionnette , III, 12, 54 = 314. Seul de tous les anciens dieux, Indra, dans le Mahbhrata, est trait avec attention et prcision, les autres presque seulement lorsquils agissent en rapport avec Indra, ou lorsque leur intervention appartient essentiellement lancienne ppope. Cest ainsi que nous rencontrons Srya, presque uniquement en rapport avec Kara, Agni, comme ami et compagnon darme dIndra; le nom de Varua est vit, avec une peur visible. Mais Indra aussi a eu souffrir de cette immixtion de Viu, qui a particulirement dnatur le rcit du combat entre Indra et Vtra et les autres Asura.

5.

Lpope a t dnature, dans sa premire rdaction brahmanique, par

limportance accorde aux Pava, non seulement Arjuna, lami fidle dun Ka difi, le pre rel de la dynastie orthodoxe des Pava, mais aussi ses frres, ses parents et ses amis. Les cinq frres furent prsents comme des modles idaux de rois brahmaniques et de serviteurs des prtres, Arjuna rendu aussi proche que possible de Rma (le fils de Daaratha), Ka, mme l o il napparaissait que comme un homme, comme un modle de vertu et sa mchancet embellie par des arguties puissantes. Le frre an, Yudhihira, particulirement, est un roi cher au cur des dieux, cest--dire des brahmanes. Sa connaissance des critures saintes, les Veda, est partout loue, et mme reconnue par ses ennemis, Duryodhana, V, 160, 43 = 5449, Kara, VIII, 49, 54 = 2354. Laccent est mis particulirement sur sa gnrosit envers les brahmanes, le premier des devoirs inculqus aux rois: il leur offre, quand loccasion sen prsente, des milliers de vaches, et mme quand elle ne se prsente pas, comme quand il vit dans une fort profonde comme un banni sans ressources, III, 23, 2 = 904. De plus on assure, en toute occasion, quil a agi dune faon parfaitement juste, bien quil ne donne aucune preuve de cette vertu; il sappelle mme Dharma, III, 23, 8 = 910. Sa rsolution est mise en avant (dans les textes jans, on dit encore dcid comme Yudhihira , Weber, Ind. St., XV, p. 442). il dcide ainsi sans autre raison de tuer Kara, VII, 184, 1 = 8362, ou - 35 -

http://www.utqueant.org Duryodhana, VIII, 29, 33 = 1201, et ny renonce que parce que ses amis, Vysa dans le premier cas, Bhmasena dans le second, le lui dconseillent. Dans lancienne pope, il est bien plus irrsolu et bien plus maladroit. Ceux qui ont remani le texte lont mis en relation avec un roi dj prsent dans les Upaniad, Ajtaatru, dont il reoit le nom, et cela bien sr dans lintention damliorer son image. Dans le rcit, tel quil nous est parvenu, les descriptions logieuses de lan des Pava ne correspondent pas aux actions qui lui sont attribues. Les brutalits de Bhmasena sont bien dcrites, mais excuses; lorsque, dans son combat la massue contre Duryodhana, il lui fracasse la cuisse au mpris des rgles, cela sera excus, car il devait bien accomplir le serment quil avait formul, II, 71, 14 = 2393, et ce serment, qui appartient lancienne pope, tait motiv par une bassesse impute Duryodhana. Arjuna galement a t honor autant que possible. Selon toute apparence, lancien rcit le prsentait dj comme un guerrier courageux, spcialement par rapport Yudhihira, dont il blme la lchet en termes durs; l''pope le reprsente comme un personnage noble, mais faible, qui se laisse entraner par les sophismes de Ka des actes qui lui-mme ne peut approuver. Comme ami du dieu Ka, il doit tre un hros brahmanique idal, il ne peut donc, par exemple, prendre sur lui la faute davoir tu son grand-pre et matre Bhma; mais dautre part, sa gloire ne doit pas tre diminue, davoir supprim lennemi le plus dangereux de son parti. De l, les contorsions et retournements comiques avec lesquels la version actuelle explique en un souffle, quArjuna na pas tu Bhma, et puis lui offre mille excuses pour lavoir tu (cf. mon Arjuna, pp. 28-30). La dification dArjuna commence ds ce premier remaniement. Lancien dieu Nryaa, une cration non brahmanique au dbut (car ses fidles nadoraient pas le crateur Brahman, , V, 49, 2 = 1918), fut ( relativement tt , Weber, Ind. St., IX, p. 2) identifi Viu, et donc plus tard Ka; puis on cra un double de Nryaa, Nara formant avec lui un tout partag en deux, V, 49, 5 = 1921) et on fit dArjuna une incarnation de ce Nara, III, 41, 18 = 1681. Si la figure humaine dArjuna est dnature par cette relation avec Ka, elle lest encore plus par sa mise en parallle avec Rma, le fils de Daaratha. Car le Rmyaa brahmanique semble vraiment tre plus ancien que le Mahbhrata remani. Lorsque les brahmanes, soucieux de la prminence de leur caste et de lautorit des Veda, qui contenaient leur magna charta (comme Ilaug, Brahma, p. 13, nomme le puruaskta), sarmaient contre le bouddhisme, la question se posa pour eux de savoir comment ils devaient se comporter vis vis de la littrature bouddhique existante. Sans aucun doute, une grande partie de celle-ci fut ds le dpart voue la destruction, et cette dcision fut excute, mme plus tard. dans le temps. Mais la posie pique, si en vogue, ne se laissa pas dtruire aussi vite. On peut donc penser, quavec laide dun pote croyant particulirement dou, on a essay de remplacer le Mahbhrata par un nouveau rcit hroque, purement brahmanique, mais reposant sur les base de lancienne version pique. Nous devons un tel essai au Rmyaa, le seul qui ne soit pas attribu Vysa, le diaskvaste, comme tout le reste de lancienne posie - 36 -

http://www.utqueant.org pique. Plus tard, on eut besoin de remanier galement le trs vivace Mahbhrata dans un sens plus brahmanique; certains traits et certaines actions de Rma furent attribus Arjuna, et cela permet dexpliquer la ressemblance frappante entre les deux hros, remarque par Ernst Windish (Lit. C. Bl., 1859, n 52, Sp. 1708). Ainsi, influence tantt par le lien avec Ka, tantt par la ressemblance avec Rma, la silhouette dArjuna devient quelque peu imprcise et floue (Weber: mlange total de rcits historiques et mythologiques , Ind.Stfn, II, p. 73, pas un personnage historique, mais un tre mythologique , Ind. Stud., I, p 12). Il est, et reste, dans toutes les tudes sur le Mahbhrata, une des manifestations les plus mal comprises. propos de ses jeunes frres, Nakula et Sahadeva, peu a t modifi, car il semble quils aient dj t mis au premier plan, avec une certaine prdilection. Et le remodelage auquel la reprsentation et linterprtation de Ka a d se soumettre a t dautant plus nergique. Bien des traits de lancienne pope sont rests ct de la dification postrieure. Que le Ka du Mahbhrata ne soit pas celui du Harivaa ni celui des Pura, Wilson lexplique aussi, Vish.P., intr. p. 109: He is conspicuously proeminent in the Mahbhrata, but very contradictorily described there .(Il est visiblement important dans le Mahbhrata, mais y est dcrit de faon trs contradictoire). There are, however, no descriptions, in the Mahbhrata, of his juvenile frolics, of his sports in Vavana, his passtimes with the cow-boys, or even of the destruction of the Asura sent to kill him (Il ny a cependant, dans le Mahbhrata, aucune description de ses bats juvniles, de ses batifolages Vavana, de ses passe-temps avec les bouviers, ou mme de la destruction des Asura envoys pour le tuer. Dans le Harivaa et dans le Viupura, son personnage na rien de divin. Rammohun Roy (Translation of several books of the Veds, Londres 1832, p. 187) se plaint de faon trs mouvante de the debauchery of Ka and his gross sensuality, and that of his fellow deities (la dbauche de Ka, sa sensualit grossire et celle de ses compagnons divins). Lenvie de sexe de Ka, livrognerie de son frre R m a (cf. Wilson, Vish. P., V, p. 66; dans Mahbhrata, I, 219, 7 = 7912, galement nomme kba, ce que Nlakaha explique par madhumatta) et de tout son peuple (cf. livre XVI) sont des traits bien communs qui proviennent dune poque ou Ka tait encore le hros divinis dun peuple de bergers nergique, mais rude et sensuel, mais ne stait pas encore hiss personnifier la grand me panthiste. Le Ka de lancien Mahbhrata ne montre pas ces dfauts, ses ennemis nauraient pas manqu de les lui reprocher; par contre, cest un sophiste et un politicien perfide, et il est difficile de dire qui a caus le plus grand dommage la morale du peuple indien, le Ka divin sophiste ou le Ka divin noceur. On ne doit pas se rclamer des aventures amoureuses de Ka, avertit rdharasvmin, car, quod licet Jovi, non licet bovi ( those who whithout such divine character act in the same way are to be considered sinners ; ceux qui, sans la nature divine, agissent de la mme faon, sont considrs comme des pcheurs, Muir, S. T. IV, p. 53). De plus Ka napparat nulle part comme roi dans lancien Mahbhrata, mais toujours dans des positions subalternes, ses ennemis le nomment dsam - 37 -

http://www.utqueant.org arjnam, II, 45, 9 = 1564. En tout cas, dans les Pura, il est le chef et le leader dun grand peuple, mme sil ne peut, par suite de la maldiction de Yayti, se prvaloir du titre de rjan (cf. Wilson, V, p. 45; p. 131); ce propos, dans le Harivaa, plus rcent, un chapitre est ajout sur la conscration royale de Ka. Dans le Brahmavaivartapura, daprs une version, il est encore, le fils de Vasudeva et Devak, daprs une autre le vrai fils du berger Nanda et de la bergre Yaod, Windisch, Legende von Ka, pp. 444-445. La position que Ka occupe dans son peuple nest pas la mme dans les deux textes. Dans le Mahbhrata, il se brouille avec ses gens; ils sont du ct de Duryodhana; mme son frre Rma se dtourne de lui; depuis lenlvement de Subhadr, il hait Arjuna. Mais dans le Pura et dans le Harivaa, il est la tte de son peuple, les Ydava; mais l encore, les dsaccords occasionnels avec Rma. ne manquent pas (cf. Wilson, Vish. P., IV, p. 246) De plus les agissements de Ka sont trs diffrents dans le Mahbhrata et dans le Pura. Lancienne pope ne le connat que dans ses rapports avec les Pava; les allusions semes a et l ses parents et ses enfants, sa ville Dvraka, etc, ont t insres plus tard, et plus tard encore sa dification (cf. Wilson, Vish. P., IV, p. 246). Dans le Mahbhrata, Ka napparat jamais comme guerrier ( part dans quelques passages plus tardifs), il est seulement guerrier et conseiller; dans le Pura, il combat, mais pas toujours loyalement et avec succs; ainsi, il fuit devant Jarsadha et devant Klayavana (le Viupura excuse sa sage prudence).

6.

Paralllement la mise en valeur des P a v a , nous assistons un

rabaissement systmatique des Kaurava. Duryodhana est particulirement maltrait. Les listes de ses mfaits sont trs frquentes, par exemple IX, 56, 30 = 3158 et IX, 61, 39 = 3427; part quelques enfantillages qui lui imputent toutes les histoires enfantines nouvellement inventes du premier livre, on lui reproche la tricherie au jeu, les mauvais traitements sur Ka, lexil des Pava, la razzia chez Vira, la captation de lhritage des Pava, la mort dAbhimanyu, et mme la mort de Bhma. Lui mme doit dire quil donnerait son royaume pour voir souffrir Arjuna et Bhmasena en mme temps que Ka, III, 238, 8 = 14803. Avec une mchancet calcule, des jugements dfavorables sur lui sont placs dans la bouche de ses parents et de ses amis, particulirement dans celle de son vieux pre aveugle Dhtarra, que lon fait sexprimer de manire trs mprisante envers son fils. Ainsi, dans son discours de conciliation, V, 22, 1 = 645, il parle uniquement en faveur de Yudhihira, le comble, lui et ses frres, de louanges, explique quil les a toujours trouvs justes, nomme Ka comme lennemi le plus dangereux de son fils, dit quil est vraiment Viu, et accable de reproches Duryodhana et Kara. Il sexprime de la mme manire en de nombreux autres passages. Dans dautres en revanche, cest exactement le contraire qui lui est reproch, une trop grande tendresse et une prfrence pour Duryodhana, par exemple V, 26,15 = 732; V, 32, 17; 29 = 955; 967; V, 72, 12 = 2592; et justement cause du personnage tellement contrast de Dhtarra, Telang, Bhag. p. 141, en vient se demander si lon ne pourrait pas - 38 -

http://www.utqueant.org distinguer chez lui un aspect plus ancien dun autre plus rcent; certes, non seulement chez lui, mais chez tous les personnages principaux des deux partis, on peut constater an earlier view (un aspect plus ancien), de la faon la plus frappante cependant chez Duryodhana lui-mme. Aprs ceux de Dhtarra, les reproches sur Duryodhana sont placs de prfrence dans la bouche de Bhma; il dit par exemple, XIII, 148, 61 = 6930; XIII, 168, 35 = 7740, que la ligne des Kuru a t mise mal par la mchancet de Duryodhana. Vidura prophtise la mme chose, IX, 2, 61 = 115. Son ancien nom de Suyodhana, qui est encore souvent rest (mme en des endroits inappropris comme V, 72, 12 = 2592), sera transform en Duryodhana (son frre Duala sappelle encore Suala en I, 117, 12 = 4541). Daprs I, 115, 28 = 4508, tout de suite aprs sa naissance, Duryodhana se serait mis braire comme un ne. Mais nous savons, daprs lhistoire de Contantin Copronyme, que la haine de lhrtique poursuit ses victimes jusque dans ses couches. Car Duryodhana est, comme nous lavons dj not, est un maudit hrtique (III, 10, 32 = 380, par Maitreya), un protg de iva et des ennemis des dieux, qui voient dans sa mort une dfaite de leur parti (svapakkaya, III, 251, 21 = 15144), tandis que dans un ancien passage, IX, 54, 13 = 3089, lors de son dernier combat, les anciens dieux lui souhaitent bonne chance. Notre texte actuel est peu loquace sur les frres de Duryodhana. Parmi eux, seul Dusana semble avoir quelque importance et il tait difficile de gter plus son personnage; dj dans lancienne pope, il tait dpeint comme hautement emport et brutal, les mauvais traitements infligs par lui Ka sont srement authentiques, et toute l''pope y fera sans cesse allusion. Les hros Bhma et Droa peuvent tre traits avec plus de mnagement, car dj dans lancienne pope, ils paraissent anims dune inclination de cur pour Arjuna, dommageable pour leur parti; on leur attribue des reproches sur les Kaurava, par suite de leur sentiment peu amical envers Kara. Le pacifique Vidura est aussi pargn. Par contre, Kara prend une mauvaise route. Les Pura voquent peine son nom, dans le Mahbhrata, les Asura lui souhaitent la victoire, VIII, 87, 40 = 4412, ou les Dnava, VIII, 87, 70 = 4442, Brahman prvoit sa mort car Arjuna est Nara, et lancienne version subsiste que le ciel a souhait la victoire de Kara, la terre celle dArjuna. Dans lancienne pope, les caractristiques de Kara sont le courage, une gnrosit illimite, un amour de la vrit sans retenue. En ce qui concerne le courage, le Mahbhrata actuel peut raconter de nombreux combats singuliers de Kara avec Bhma et avec Arjuna, qui se terminent rgulirement par la fuite du premier; mais tous ces rcits sont des interpolations postrieures; sa gnrosit, qui est prsente dans les inscriptions comme un modle pour les rois, lui est reproche comme une folie. Au lieu de parler de son amour de la vrit, on le dit menteur, anta, XII, 3, 32 = 106; son mensonge consiste, comme il le raconte lui-mme, VIII, 43,3 = 1964, en ce quil sest prsent comme un brahmane Rma, le fils de Jamadagni, pour pouvoir jouir de son enseignement (cela est un manquement grave aux Lois de Manu, 11, 56, mais Arjuna et Ka shabillent en brahmanes et se font passer pour tels, II, 20, 22 = - 39 -

http://www.utqueant.org 789, sans que lauteur ait pour eux un seul mot de reproche). Mais Rma dcouvre la supercherie et le maudit: il succombera au combat face son adversaire. Toute cette histoire est une interpolation, comme lindique la remarque nave quelle serait un secret des dieux. Elle devrait montrer quArjuna nest pas coupable de la mort de Kara, mais la maldiction de Rma, et en mme temps imputer Kara une transgression des saintes institutions des quatre castes et montrer que son art du combat lui a t inculqu par un brahmane. Dans le Goaytrparvan, qui est entirement une interpolation plus tardive, on place dans la bouche de Kara le mensonge suivant, quil voulait devenir berger avec Duryodhana. Dans les anciens passages, qui sont ncessaires au droulement de laction, la vracit de Kara ressort; sa promesse dpargner les frres dArjuna, faite de faon imprudente Kunt, sera tenue scrupuleusement; de mme, il donne Indra sa cuirasse impntrable, parce quil avait promis de satisfaire toutes ses demandes. La prudence nest pas sa vertu principale, il sappuie sur son courage et son droit, et les paroles quon lui attribue peu avant sa mort, VIII, 90, 85 = 4713, proviennent de lancienne pope; le droit succombe, sur lequel je me suis toujours appuy . Le remaniement le prsente comme le malveillant conseiller de Duryodhana, comme celui qui serait responsable de tous les malheurs, XI, 1, 27 = 28, cause de qui la ligne des Kaurava serait dtruite, XIII, 148, 61 = 6930. Dans lHarivaa, il combat contre les dieux dans larme des Nikumbha, 19 Vish., 84, 47 = 8096. Mais la renomme de ce hros na pas t amoindrie seulement par les remaniements et les suspicions, mais au moins autant par les omissions. On na conserv que les actions et les coups de sort de Kara qui sont ncessaires au droulement de laction principale; tout ce que lon disait de plus sur lui a t gomm (cf. A. Holtzmann, Untersuchungen ber das Niebelungslied, p. 198). Il faut remarquer que nous ne connaissons que par quelques strophes conserves par hasard le fait important que Duryodhana, grce laide de Kara, a vaincu ses rivaux lors de son voyage nuptial et sest gagn une femme, XII, 4, 2 = 109. Mais daprs VII, 11, 10 = 391, Ka a vaincu les princes lors du svayamvara de Gndhr, ce qui navait aucun sens, car cette princesse est devenue lpouse de Duryodhana1, et non pas dun Pava: et nulle part, dans lancien Mahbhrata au moins, Ka napparat comme un guerrier courageux. Dans le mme passage, XII, 5, 2 = 130, le meurtre de Jarsandha est attribu Kara, dans le Sabhparvan, Bhmasena en liaison avec Arjuna et Ka. Ainsi bien des actions de Kara peuvent avoir t attribues Ka ou dautres, et dautres avoir t compltement effaces: une perte qui ne peut plus tre rattrape. Il est question en VII, 1, 37 = 37 (mais seulement en C, en B ce passage est saut) dun combat de Kara avec le dieu des eaux, combat qui nest voqu nulle part ailleurs; daprs VII, 11, 19 = 400, Kna a combattu dans leau avec Varua et la vaincu (cf. XIX, Vish., 115, 10 = 9791: lminent Varua fit vaincu par Ka dans ltang Lohita .
1

NdT: Lauteur a probablement voulu dire Dhtarra.

- 40 -

http://www.utqueant.org De la mme manire les autres amis et compagnons de Duryodhana furent rabaisss. DAvatthman, nous avons dj parl; on lappelle dj simplement mauvais , ppa, et cela avant sa grande vengeance, IX, 30, 49 = 1722; Il est remarquable quil ait t introduit (et prcisment comme fils de Droa) dans une liste de saints muni, XIII, 151, 42 = 7121; XIX, 7, 47 = 453: cf. Wilson, Vish. P., III, pp. 23; 36: Devbhgavatapura, Aufrecht, Cat. Bodl., p. 80a; sagit-il ici dune tentative tardive pour rhabiliter sa mmoire ? Un autre fidle de Duryodhana galement, le prince Yavana Bhagadatta, qui rgnait louest et portait sur la tte une pierre prcieuse remarquable (divyamai, adbhutamai, II, 14, 13 = 577), comme Ka-Viu portait le Syamantaka, est appel ennemi des dieux (suradvi), VII, 29, 38 = 1291.

7.

Des remaniements ont galement t entrepris du droulement de lhistoire et

le plan entier a t retravaill en faveur des intrts vishoutes. Lhistoire initiale des hros, jusquau dbut de la partie de ds, et lhistoire de leurs ascendants a t place en tte; on y trouve en partie des aperus pisodiques de lancienne pope, en partie les restes encore prsents de la tradition pique, en partie une invention propre. Le personnage de Pu est nouvellement invent, et son insertion dans lancienne gnalogie; vraisemblablement aussi celui de Dhtarra qui prend ses traits, pour autant quils soient authentiques, lancien Bhma; la mme bienveillance envers les princes qui se combattent, le mme amour de la paix et de la conciliation. Les actions de Duryodhana et de Kara ont t lagues, celles des Pava multiplies. Dans le Sabhparvan, on a essay de reporter la faute de la partie de ds sur Duryodhana et ses amis. Une modification trs importante a t que les Pava ont vraiment accompli leurs douze ou treize annes dexil. On trouve encore des traces de la situation relle. Dj lors de leur dpart en exil, les Pava menacent de revenir bientt, II, 77, 45 = 2558. Ils se cherchent immdiatement des allis, comme Vidura le leur conseille, III, 6, 20 = 259, et nous rencontrons dj ces allis lors du conseil de guerre, III, 12, 1 = 461. Ka rclame trs ouvertement le sang de Duryodhana, et Bhmasena harangue ses frres, III, 35, 32 = 1407, de quitter la fort et de combattre pour reprendre la supriorit. Ce discours de Bhmasena, pour attnuer limpression dsavantageuse quil donne, est rparti sur plusieurs passages, III, 33, 1= 1264; III, 35, 1 = 1376; III, 35, 1 = 1376; III, 52, 6 = 2018. Le conseil similaire de Yuyudhna de combattre Duryodhana et de le tuer, se trouve dans un contexte compltement diffrent, III, 120, 5 = 10263; le plus important est le discours de Kara, V, 21, 9 = 631, abrg mais authentique; il se plaint que les cinq frres rclament leur royaume sans avoir respect leur contrat: ils devraient dabord rester dans la fort le temps convenu, ensuite ils seraient bienvenus; mais ils dsirent la guerre, le droit leur est bien gal. Mais le remaniement laisse les Pava vivre vraiment douze annes dans la fort. Pour remplir, au moins en apparence, cette longue dure, toutes sortes dinterpolations ont t ncessaires; ainsi de nombreux pisodes ont t insrs dans le Vanaparvan et, parmi eux, danciens fragments - 41 -

http://www.utqueant.org organiques, comme le rcit de la naissance de Kara et de ses nombreuses victoires au service de Duryodhana. Certains passages servent glorifier les Pava et rabaisser les Kaurava, comme ceux du Ghoaytr, franchement hostiles Duryodhana, o cependant on laisse Kara sa rputation de courage; lui seul, par deux fois, ne recourt pas la fuite devant les Gandharva. Le rcit des tractations entre les Kaurava et les Pava est compltement dnatur; au lieu de propositions concrtes et de dlibrations, nous nentendons que des considrations morales de porte gnrale et des discussions philosophiques qui nont quun faible rapport avec le cours du rcit; lhistoire elle-mme est peine reconnaissable partir de ces allusions isoles et parpilles. De tels passages, si brutalement insrs, ne le sont que pour masquer un vide. Quand un indien recopie un manuscrit, et quil le trouve incomplet, il insre un passage dune uvre apparente, pour sauver lapparence de la compltude (Roth, Katal., p.9, n 247); leaves taken from some other book precious mode of book making ( des pages tires dautres livres riche manire de faire des livres), se plaint Taylor, Kat. II, 607, cf. 609. Tout fait de la mme manire, ceux qui ont remani le Mahbhrata ont dplac des passages entiers la place dautres supprims; ainsi les interminables discussions abstraites de Vidura et dautres la place des tractations diplomatiques qui auraient mis trop en lumire les torts des Pava. De la mme faon, au troisime livre, le combat de Ka avec alva, insr la place du conseil de guerre brutalement interrompu, est un bouchetrou; au neuvime, le plerinage de Rma (le fils de Vasudeva) et au dixime lAikaparvan. Aprs une profonde discussion philosophique, qui montre, sur les bases dune vision panthiste, que la peur de la mort est une folie, le rcit du combat commence. Celui-ci, dans la version remanie, fait partout ressortir le courage des Pava, ils ne senfuient pas, ils sen vont , VIII, 55, 38 = 2689, ils quittent lennemi , VIII, 56, 3 = 2694. Les Kaurava tremblent continuellement; ds le premier combat, ils regardent anxieusement en arrire, les Pava courageusement vers lavant, VI, 20, 5 = 745. Dans le huitime livre, Kara senfuit huit fois de suite devant Bhmasena; en VIII, 84, 7 = 4267, galement, il a peur de lui. Le premier vnement dimportance dcisive dans lhistoire de la grande bataille est la mort de Bhma. Le seul fait que le vieux hros ait t tu de manire dloyale par Arjuna, cherche de cette manire contourner et obscurcir le remaniement. Cf. les passages cits dans mon Arjuna, pp. 29-30. Le noble guerrier (ajihmayodhin, XII, 37, 19 = 1362) est abattu par tromperie (chlena, aussi VIII, 32, 11 = 1334), et cela par Arjuna, comme aussi, en plus des passages cits, en IX, 2, 58 = 113 et en Viupura, V, 161-163, comme la tabli Wilson. La tromperie rside dans le fait de pousser en avant ikhain, avec lequel Bhma ne veut pas combattre parce quil le tient pou une femme; pourquoi, et dans quelles circonstances, Bhma a jur de ne jamais frapper une femme, mme sil tait en danger de mort, cela est expliqu en dtail dans lancienne pope. - 42 -

http://www.utqueant.org Aprs la mort de Bhma, Kara parcourt le champ de bataille et prend le commandement de larme des Kaurava, comme il rsulte encore maintenant de la comparaison de la fin du Bhmaparvan et du dbut du Droaparvan. Longtemps, Kara cherche Arjuna, qui se tient loign de lui sur le conseil de Ka; cf. mon Arjuna, pp. 51-52; les passages cits ici, VII, 147, 35 = 6331; VIII, 35, 16 = 1636, auraient galement pu avoir t insrs. Aprs la mort de Kara, la victoire des Pava est vidente. Comme Duryodhana arrive-t-il dans le lac aprs la bataille, nous ne le savons pas; le bhayt, par peur, IX, 29, 92 = 1659, ne suffit pas et est en contradiction avec le caractre du hros; nous avons de nouveau une lacune devant nous, qui doit tre masque par insertion du plerinage de Rma. Avec les lamentations des femmes, la vengeance nocturne dAvatthman et la mort de Duryodhana, dont lme rejoint le ciel, lancienne pope se termine; le nouveau, dans lequel les cinq frres et Ka restent en vie, ajoute des passages plus ou moins longs sur leurs actions postrieures, qui seront sans cesse multiplis au cours du temps, et grossirement gonfls.

8.

La premire organisation du rcit tout entier fait bien partie du premier

remaniement. Le Mahbhrata tout entier est racont au roi Janamejaya (par Vaiapyna, llve de Vysa) durant les pauses du grand sacrifice des serpents offert par ce roi. La grande pope nest quun pisode de ce rcit cadre. Daprs la reprsentation actuelle, Janamejaya est un roi assez jeune, la frontire des temps mythiques et historiques. Il y a cependant, dans la ligne des Kaurava, un Janamejaya plus ancien qui a les mmes trois frres, rutasena, Ugrasena et Bhmasena que le plus rcent; cf. Wilson, Vish. P., IV, pp. 152: 162. Cest sans aucun doute cet ancien Janamejaya, le fils de Kuru, qui offrit le sacrifice des serpents; son histoire formait un pisode de lancienne pope; Cet pisode a t pris pour former le rcit-cadre, tandis quen mme temps Janamejaya devenait le fils de Parikit et quainsi, lunit de lancienne dynastie lgendaire avec la nouvelle dynastie historique tait tablie. Weber, Ind. Stud., I, p. 204, remarque juste titre: Lintroduction du Mahbhrata a fait, pour mieux glorifier les Pava, du clbre roi Janamejaya leur descendant . Cela explique que les deux Janamejaya aient t rapidement confondus; Bhma parle Yudhihira, XII, 150, 3 = 5596, de Janamejaya, le fils de Parikit, et pourtant Parikit ne natra quaprs la mort de Bhma; les passages XII, 124, 16 = 4564 (et non pas 4567) et XII, 235, 24 = 8598, cits par Weber, Ind. St., I, p. 483, ne laissent pas voir de quel Janamejaya il sagit. Les anciens rcits remarquables en rapport avec le sacrifice des serpents forment un tout cohrent, comme le montre justement Oldenberg, ZMDG 37, p. 85, bien que chez lui aussi la thorie de la ballade montre le bout de son nez. Dans la mme revue, 32, pp. 237-240, Oldenberg prouve que

- 43 -

http://www.utqueant.org Parikit et Janamejaya reprsentent un fond lgendaire ancien, postrieur au gveda, mais antrieur aux Brhmaa.

9.

Il ny a pas que le droulement du rcit, le jugement sur les personnages

principaux, le systme mythologique dominant, qui doivent tre modifis par le remaniement, il faut aussi, si lon veut se conformer lesprit du brahmanisme, reprsenter en dtail les circonstances sociales et relationnelles qui correspondaient la faon de voir des prtres, telles quelles se prsentaient et taient justifies dans lantiquit naissante, oui, depuis le dbut de la socit humaine. Ainsi, par exemple, toutes les interventions actives des femmes dans le cours de laction ont t rduites un minimum, car daprs le nouveau point de vue brahmanique, ne revenaient aux femmes que soumission et rserve. Il en rsulte que nous savons peu de choses sur les desses et les Apsaras, sur la femme et les surs de Duryodhana trs peu, sur la femme de Kara rien. La partialit du remaniement en faveur des Pava a par contre conserv K par exemple, quelques uns des anciens traits. On se souvient avec quelle force elle se manifeste partout, comment, lors de son svayamvara, elle repousse delle-mme, schement, Kara, ( je ne veux pas dun fils de cocher , I, 187, 23 = 7027), comment elle jette terre le bandit Jayadratha, III, 268, 24 = 15662, comment elle sermonne copieusement ses cinq maris et en mme temps adresse la providence des dieux des critiques peu aimables, III, 12, 78 = 538; III, 27, 37 = 1025; III, 30, 19 = 1136; III, 30, 39 = 1155; V, 82, 31 = 2901 et comment elle est prompt menacer de se suicider quand tout ne va pas comme elle veut, IV, 21, 48 = 689; X, 12, 15 = 588 (les mmes menaces chez Damayant, III, 56, 4 = 2163; Amb se suicide vraiment, V, 187, 19 = 7388). Mais on peut comparer cela les autres descriptions de la mme K, o elle apparat comme une pouse servante et soumise, comme particulirement dans son entretien avec Satyabhm, III, 233, 19 = 14667, ou bien comparer K avec des femmes dune poque plus rcente, ou dune rdaction plus rcente, Gndhr, Subhadr, St, Mdri, Uttar, dont on a fait le tour en disant quelles sont des enfants bien levs sans volont propre. De plus, les rois donnent la prsance leurs chapelains (purohita); ils ne prennent aucune dcision importante sans leur conseil et sans leur accord, et rien nest omis pour prouver la position prpondrante quoccupaient dj les brahmanes lpoque de leurs anctres; plus grande est larrogance avec laquelle la premire caste se manifeste, plus rcent ou plus remani est le passage correspondant du Mahbhrata. Dans lintrt des prtres, des brahmanes ont t partout introduits dans le rcit, comme par exemple dans le Nalopakhyna, o le prtre Damana aide le roi avoir une descendance; comme dans le premier livre du Rmyaa, yaga et dautres aident Daaratha. ct des dieux terrestres, des brahmanes eux-mmes, et de - 44 -

http://www.utqueant.org Viu, les anciens dieux devenaient, vrai dire, superflus; de nombreux passages, qui rapportaient leur implication active dans le cours du rcit, ont t supprims, ou fortement abrgs: une perte trs sensible et irremplaable. Ainsi on peut conclure, daprs V, 60, 8 = 2366, que le dieu du feu Agni a fourni son appui Arjuna au cours de la grande bataille; on nen trouve pas trace dans la version actuelle. Le rationalisme des brahmanes, qui a altr lancienne mythologie, ne peut avoir agi sur l''pope que de faon pernicieuse; on trouve le merveilleux insipide, et remplace lintervention des anciens dieux dans le destin des hros par une explication naturelle. Cela, lancienne pope le racontait encore et encore, sans craindre des questions malicieuses et sans sen dfendre; dans le remaniement, tout doit tre expliqu. Ainsi, I, 50, 40, raconte un entretien entre Takaka et Kayapa. Qui a entendu ? Un bcheron tait assis sur une souche, il a surpris leur conversation, et la rpte plus tard (Ulysse justifie de mme ses rcits, et cite des tmoins, Homre, Od., 12, 389). Le dieu du soleil Srya visite Kunt, et engendre Kara avec elle; qui a clair le monde pendant ce temps-l ? Srya sest divis auparavant en deux manifestations, XV, 30, 10 = 828. Les discours subtils de Ka et de ses adeptes montrent combien le brahmanisme a endommag, par sa manire sophistique de traiter les choses, la morale simple, saine et susceptible de dveloppement des indiens et leur concept de justice et dinjustice. la place de la morale et de la religion, prennent place le culte crmonial et la saintet de laction, de lpoque de la restauration brahmanique jusqu nos jours. You have no reference to moral and religious qualities now, you have to do with ceremonies and acts (vous navez plus maintenant de rfrences des qualits morales ou religieuses, il faut vous contenter des crmonies et des actions), se plaint Telang, Bhag., intr. p. 22. La guerre avec le bouddhisme a t aussi funeste pour le vainqueur; cause des allis fidles, les vishnoutes, il a fallu retirer beaucoup au srieux de la morale, si lon voulait conserver les privilges des brahmanes et lautorit des Veda. Comme le remarque Weber, Ind. St., IX, p. 120, on rendait le joug aussi lger que possible; on ne demandait que la soumission; pour les sectaires de Viu, le sacrifice et ltude taient totalement superflus, la confession de sa foi en Viu suffisait.

10.

Ce qui permet de reconnatre le premier remaniement brahmanique par

rapport au second, est leur position vis--vis de iva. Dans le Mahbhrata de la premire rdaction, iva est avant tout un dieu hostile et mchant, le diable ha auquel Avatthman vend son me. On sait que les shivates et les vishnoutes se sont longtemps combattus, par crits, et mme les armes la main. En 1100 encore, un roi de lnde du sud exigeait de tous ses brahmanes quils signent une dclaration que iva prvalait sur Viu, Lassen, IV, p. 126; vers 1200, Rmnuja, qui tenait iva - 45 -

http://www.utqueant.org pour un esprit mauvais (Rkasa), fut considr comme laptre de Viu: Dans sa bont, Brahman a cr Viu, dans sa colre, iva , tel est le credo que les vishnoutes prennent au srieux, XII, 341, 12; 128 = 13140; 13287; mme Brahman est mis de ct, et la naissance de iva est attribue la colre de Viu, XII, 339, 51 = 12915; XII, 341, 18 = 13146; la nature de iva est la colre, on lappelle rotmaka, XII, 340, 37 = 13043. Le ntiparvan, lHarivaa, le Viupura, etc. nous prsente des rcits complets de combats entre les deux dieux, cest--dire entre leurs adeptes respectifs; cf. Wilson-Hall, Vish. P., V, pp. 115; 120: there can be little doubt that this legend describes a serious struggle between the aiva and the Vaishnava (il est certain que cette lgende dcrit un srieux combat entre les shivates et les vishnoutes). Caldwell, intr. p. 144, nous livre un exemple intressant venant de lInde du sud, montrant jusqu quel point les vishnoutes pouvaient se comporter compltement indpendamment des shivates. Le cercle des crivains shivates, dit il, est chez les Tamils tellement spar de celui des vishnoutes que des crivains mme contemporains, vitaient toute citation dcrivains de lautre parti. Dans le Bhgavata Pura, iva est encore plus mal trait; ses adeptes sont qualifis dhrtiques (paa), IV, 2, 32; des vishnoutes, il est dit quils quittent les ghorarpn bhtapatn, I, 2, 26. Dans quelques passages du Mahbhrata dorigine trs tardive, on voit encore apparatre la haine contre iva; En XIX, 53, 65 = 3031, il est reprsent dune manire trs mauvaise, ses adorateurs, qui renient tous les dieux lexception de iva et Skanda, sont sans vertu et sans loi; mais dans son ensemble, lpope actuelle est rconcilie avec iva, et les passages qui respirent la haine contre lui appartiennent au premier remaniement brahmanique. Dans ceux-ci, il apparat comme protecteur et vengeur de Duryodhana et de son parti, et il joue encore ce rle dans des interpolations plus tardives; En VII, 30, 19 = 1320, akuni fait apparatre par magie des singes, des lions, des ours, des chameaux, des Rkasa, qui courent en foule sur le char dAjuna en le menaant. Cet art de la magie, akuni, comme son neveu Duryodhana, la obtenu de iva, bien que son nom ne soit pas cit.

11.

Avec ce premier remaniement brahmanique, commence la troisime priode

de lhistoire du Mahbhrata, marque par un effort conscient de mettre en accord l''pope avec le systme strictement brahmanique, mais dj altr par des concessions la religion populaire, et aussi par la prminence quelle accorde aux Pava et la haine envers Duryodhana. Comme ce deuxime remaniement avait souvent devant lui des textes que se contredisaient dans les dtails, textes quil essayait plus ou moins heureusement de runir en un tout, on peut supposer que durant cette troisime priode circulaient diffrentes recensions de lpope brahmanique dans diffrentes rgion de lInde. Il est trs vraisemblable, daprs le - 46 -

http://www.utqueant.org sujet et le contenu de luvre, que ce remaniement a t fait spcialement pour la caste des guerriers, qui tait depuis longtemps charme par lpope. La lecture des Itihsa et des Pura est autorise mme aux dra, mais pas celle des Veda, Deussen, Systme 64, Sutra 192. Daprs le Bhgavata Pura, le Mahbhrata a t rdig pour les femmes et les dra en remplacement des Veda qui leur taient interdits (le Mahbhrata lui-mme se donna tantt comme un kvya, I, 1, 72 = 72, cf. Mller, Anc. Lit., p. 41, tantt comme un itihsa ( le titre ditihsa sapplique trs exactement au Mahbhrata , Burnouf, Bh. P., I, intr. p. 24. De mme Kullka propos de Manu, 3, 232. Bharata, Commentar zum Amarakosha, Burnouf, I, intr. p. 23). Le Brahmavaivartapura dit que le Mahbhrata est un itihsa, en concdant cependant que le Rmyaa, dsign pourtant comme un kvya bien que tirant son sujet de la lgende, reprsente une posie libre, ibid., p. 24), ou bien un pura, dont le nom peut tre considr comme un synonyme, Burnouf, Stellen, p. 15, ou encore un khyna, par exemple I, 59, 5 = 2202 Il est impossible de prciser quelle poque sest produit notre premier remaniement, peine pouvons-nous lestimer. Une posie malveillante envers Kara, correspondant en gros aux onze premiers livres de notre texte actuel, doit avoir exist longtemps dj avant lan 1000 aprs J.C.; il semble que les brahmanes, dj au dbut du grand combat contre les bouddhistes, au moment de la reconstitution des dynasties brahmaniques (vers 300 aprs J.-C., daprs le mmoire de Bhandarkar, 1883-1884, p. 74), apportaient sur le champ de bataille, en plus dautres armes, un Mahbhrata remani. Lacceptation du combat contre les bouddhistes avait t prpare par un complet remaniement des trsors littraires existants, absolument ncessaire si on ne voulait pas y renoncer. Le Mahbhrata y fut galement soumis: sous-tendant ce travail, un point de vue strictement brahmanique, permettant seulement le mpris envers les lignes non brahmaniques, capable de ne voir en Bouddha quun illusionniste sducteur ( the deluder by illusion , Wilson, Vish. P., III, p. 206), un ennemi des Veda et de lordre des castes, conduisant la corruption ternelle. Aprs leur victoire complte sur le bouddhisme, les brahmanes ont cherch effacer tout ce qui rappelait Bouddha; nous ne trouvons pas son nom dans le Mahbhrata; ce qui pouvait faire penser lui et ne pouvait tre tout simplement supprim, resta sous lappellation iva. Les romains disaient: Carthaginem esse delendam , les brahmanes, Buddham nunquam fuisse . Mais nous ne pouvons croire quun nom qui avait jou un des premiers rles durant quinze sicles dans lhistoire de lInde et dans le dveloppement de sa littrature, ait disparu sans laisser de traces, comme une goutte deau scoulant dune feuille de lotus; particulirement pas dans une uvre comme le Mahbhrata, qui ntait pas faite exclusivement pour les cercles spculatifs brahmanique, mais reprsentait plutt la lecture prfre des guerriers et des bourgeois. Dans cette optique, nous nous en tenons lopinion de Foucaux, Onze

- 47 -

http://www.utqueant.org pisodes, 1862, intr. p. 5: lantagonisme qui dj existait entre (les brahmanes) et les bouddhistes nest pas tranger la manire dont le Mahbhrata a t rdig .

Chapitre I, 16

La deuxime rdaction puranique


Aprs leur victoire dfinitive sur le bouddhisme, les brahmanes soumirent lensemble de la littrature pique une rvision gnrale; Le Mahbhrata fut rendu aussi proche que possible des Pura et un rdacteur commun, Vysa, attribu aussi bien celui-ci qu ceux-l. Les indices de cette deuxime rdaction sont: rconciliation avec iva; extension du rcit proprement dit par des passages didactiques; accroissement gigantesque du volume de luvre; arrogance des brahmanes pousse lextrme; monte du sectarisme vishnoute et du parti pris en faveur des Pava. En mme temps que e contenu, la langue et la mtrique furent aussi dfinitivement fixes. _______________________________________

1.

Peu avant et pendant lexpulsion des bouddhistes, une rvision gnrale de la

littrature pique dans son ensemble eut lieu, dont le but principal tait de rendre conformes autant que possible le Mahbhrata, le Rmyaa et les Pura. Cette rvision avait une tendance nivellatrice; les lecteurs devaient avoir limpression quon trouvait partout la mme chose. le plus grand ennemi des brahmanes est lesprit historique. Les brahmanes expliquent que le monde a toujours t le mme, et restera le mme. Depuis le dbut, les indiens ont rvr les brahmanes et Viu; la dification des brahmanes et ladoration de Viu devaient aussi ressortir de la mme manire partout dans la posie pique. On fixa le nombre des Pura dix-huit; le Mahbhrata compte autant de livres, et la grande bataille fut allonge pour compter autant de jours. Les dix-huit Pura et le Mahbhrata ont le mme auteur, Vysa; et bien que certaines contradictions soient apparentes dans ces uvres, elles ont toutes le mme contenu. Il est clair que Vysa nest et ne signifie rien dautre que la personnification de la rvision gnrale de lensemble de la littrature pique (nous cartons compltement ici les Veda). Ce qui est important et significatif dans un des Pura, doit se retrouver aussi dans le Mahbhrata et vice versa. Ainsi toutes ces uvres contiennent une section avec une description de la terre, avec une liste des montagnes, des rivires et des peuples, et ces sections semblent toutes avoir une - 48 -

http://www.utqueant.org source commune, maintenant perdue. Une des lacunes principales du Mahbhrata, cest quil parle trop peu de Ka; Pour cela, des rcits, pris des sources puraniques, de ses actions et de sa divinit ont t insrs tout au long de l'pope, et comme si cela ne suffisait pas, le Harivaa a t annex en appendice luvre. Bien des passages des diffrents Pura ont t introduits, sous une forme abrge, dans le Mahbhrata; ainsi dans le troisime livre le passage sur Skanda; le catalogue des lieux de plerinage dans le troisime et le neuvime; des tas dlments sur le devoir et la justice, le sacrifice et les castes, dans le treizime. Lintention des brahmanes a t accomplie, on trouve la mme chose dans le Mahbhrata que dans les Pura, et dans de longs passages du premier rgne le mme ton dennui, la mme platitude et le mme manque dides que dans le dernier. _ Le Rmyaa aussi, dont le dernier remaniement vishnoute eut lieu la mme poque, fut amen autant que possible concorder avec le Mahbhrata et les deux se prtrent mutuellement des pisodes et des passages pars.

2.

Le nom de Vysa dsigne toute une poque, celle de la fixation dfinitive des

Veda, de la philosophie et de lpope, dans laquelle toute lancienne littrature a t rvise et marque du sceau du brahmanisme. Une heureuse superstition empcha les Veda dtre trop malmens; avec les livres sculiers des guerriers et des bourgeois, on avana selon son gr. Le morceau le plus difficile auquel le remaniement sattaqua fut que Vysa se prsentait dune part comme le grand-pre des hros de l'pope, dautre part comme lauteur de l'pope lui-mme; lui, le grand-pre dArjuna, fait rciter son pome sur Arjuna par son lve Vaiapyana devant Janamejaya, le petit-fils dArjuna. Les brahmanes devaient tre assez srs de la crdulit de leurs fidles pour pouvoir se dcider leur servir de telles normits. Que Vysa soit leur grand-pre, ce nest naturellement pas le cas; Dhtarra et Pu taient, dans le premier remaniement, les fils de Bhma, qui, aprs la mort de ses frres Vicitravrya et Citrgada, les avait engendrs avec leurs veuves Ambik et Amblik, comme il y tait oblig selon les anciens usages; car la ligne ne devait steindre sous aucun prtexte. Yudhihira dit avec raison Bhma, V, 31, 9 = 924: Tu as rtabli la maison de ntanu, fais que nous, tes petits-fils, vivions en paix ; avec raison Arjuna dit que Bhma est le pre de son pre Pu, VI, 107, 13 = 4979; avec raison, on reproche Arjuna davoir tu son grand-pre Bhma, VII, 197, 40 = 9121, etc. Dans le Viupura galement, Bhma est le grand-pre des Pava, Wilson, Vish. P., III, p. 74. Et cela, bien quil soit dit expressment dans ldiparvan que Vysa, aprs la mort de Vicitravrya, a engendr Dhtarra avec Ambik, Pu avec Amblik et Vidura avec une servante. La raison de cette innovation honte est double: dabord, Bhma ne devait pas tre le grand-pre dArjuna car il tait impossible que lami, le compagnon de ltre Suprme, de Viu, lme du - 49 -

http://www.utqueant.org monde, puisse avoir commis un tel manquement: ensuite il ne fallait pas laisser passer loccasion de faire comprendre au lecteur que, dj dans les temps anciens, les brahmanes taient des htes frquents des gynces royaux. Les brahmanes navaient plus rien craindre, plus rien redouter; dans la partie de lInde o leur systme a pu se dvelopper le plus largement, au Malayala, les femmes sont encore aujourdhui toutes, sans exception, accessibles aux dsirs des brahmanes non clibataires, et cela ne les dgrade pas, mais cela est plutt considr comme un grand honneur , Graul, III, p. 230. Mais Vysa, comme auteur du Mahbhrata, est une invention du deuxime remaniement. Il expose clairement dans lintroduction comment il a rdig lpope, comment il la dicte Gaea et apprise son disciple Vaiapyana. Cest pourquoi Vysa est une incarnation de Nryaa ou de Viu, for who else on this earth could have composed the Mahbhrata ? (car qui dautre ici-bas pourrait avoir compos le Mahbhrata), Wilson, Vish. P., III, p. 41, ko hy anya Pundarikkn Mahbhratakd bhavet , nandatrtha in Gtbhya (avec iti, donc une citation) dans Burnell, Class. ind., 103a, et dans notre Mahbhrata, XII, 346, 13 = 13438: Kadvaipyana Vysa viddhi Nryaa bhuvi ko hy anya puruavyghra Mahbhrayakd bhavet ? . Mais, encore dans le Viupura, Vysa nest pas lauteur de lpope et des Pura, mais seulement l arranger or compiler , Wilson, intr. p. 98. Le rcitant est, comme nous lavons vu, Vaiapyana.

3.

Le rcit-cadre du remaniement le plus ancien, le sacrifice des serpents du roi

Janamejaya, devait maintenant tre introduit dans une autre histoire, afin quil puisse aussi tre racont par Vysa dans sa version du Mahbhrata, et ainsi un second embotement en dcoula. La version actuelle raconte comment Ugraravas, le fils de Lomaharaa, prit part une session sacrificielle de douze annes dans la fort Naimia, et raconta aux prtres et aux participants lhistoire du sacrifice des serpents; dans cette histoire, Vaiapyana prend de nouveau la parole pour rciter le Mahbhrata. Cet habillage, avec Ugraravas comme conteur, est srement puranique, car beaucoup de Pura sont raconts loccasion de cette session de la fort de Naimia, et leur introduction reprend, presque mot pour mot, les premires strophes de notre Mahbhrata actuel. Mais Ugraravas, le conteur du second remaniement, est lui-mme, daprs les donnes des indiens, dune gnration plus jeune que le conteur du premier; ce nest pas lui llve direct de Vysa, mais son pre Lomaharaa, en mme temps que Vaiapyana (cf. Muir S. T., III, pp. 39; 41; 42). De plus, le commentateur de la aguruiya (chez Weber, Katal., I, p. 13; Max Mller, Anc. Lit., p. 231), raconte quUgraravas, celui qui a rcit dans la fort Naimia tout le Mahbhrata et le Harivaa, tait un contemporain de atnka, le fils de Janamejaya; ainsi le Mahbhrata rcit du temps du fils tait plus rcent que - 50 -

http://www.utqueant.org celui rcit du temps du pre. Quand il sagit dhistoire, un indien ne peut pas sexprimer plus clairement. Pourquoi serait-il judicieux de faire remarquer que le Mahbhrata a t rcit deux fois, dabord pendant le sacrifice des serpents, puis dans la fort Naimia, si lon ne voulait par l mme accrditer lide quil sagissait, les deux fois, xactement de la mme pope ? Ne veut-on pas par l signifier, et excuser, le fait que la recension actuelle, celle dUgraravas, est un remaniement de celle, plus ancienne, de Vaiapyana ? Ce que le dernier raconte est notre premier remaniement brahmanique, ce qui est racont dans la fort Naimia, notre second, qui place ainsi lpope sur la mme ligne que les Pura raconts prcdemment dans la mme fort et dans les mmes circonstances. Il faut noter en plus la diffrence des auditoires lors des deux rcitations. Vaiapyana rcite le premier Mahbhrata au roi, ses prtres et ses ministres; Ugraravas rcite le deuxime, non pas la cour de atnka, mais devant des sages qui vivent dans la fort, dont le chef est aunaka, celui que le aguruiya nomme le matre des valyana, Weber, Katal., I, p. 11. Mais le nom de aunaka ne nous aide pas beaucoup, il y a en effet, comme le rappelle Weber, Ind. Stud., IV, p. 126, beaucoup de aunaka, cest--dire des hommes qui portent ce nom ct dun deuxime. De plus, on sait quil y a peu tirer des listes de matres et dlves. Max Mller, Anc. lit., p. 444, note, renvoie au passage XII, 150, 2 = 5595, dans lequel un Indrota aunaka, un ascte, officie pour le sacrifice du cheval du roi Janamejaya, le fils de Parikit. _ Il faut encore se rappeler que dans la partie principale de notre pope, dans la description de la grande bataille, Vaiapyana cde la parole Sajaya, lami de Dhtarra. Tous les soirs, au retour du champ de bataille, Sajaya raconte au roi aveugle les vnements du jour, dabord brivement, ensuite en dtail. Au Magadha, Buddha convertit Sajaya, Oldenberg, Buddha, p. 138, une homonymie qui peut tre le fruit du hasard. Nous avons donc trois conteurs: Sajaya, Vaiapyana et Ugraravas, et trois auditeurs: Dhtarra, Janamejaya et aunaka, ce qui confirmerait notre hypothse dune pope primitive et de deux remaniements.

4.

Lajustement du Mahbhrata aux Pura, ne porte pas seulement sur le

contenu, mais aussi sur la forme. La langue du Mahbhrata dans sa morphologie et sa syntaxe, le style auquel il se tient, le traitement des strophes, concordent avec lusage quen font les Pura, nous pouvons mme admettre que le second remaniement a cr sous ce rapport une norme stable. La langue pique tait depuis le dbut fluide, sujette modifications. Chaque rhapsode remplace involontairement les anciennes formes de langage par celles qui ont cours son poque, et ce rajeunissement du langage peut aussi se poursuivre dans la retranscription de l'pope , Lassen, Ind. Bibl., III, p. 73, note. Cette remarque de Lassen est trs juste, mais ncessite une certaine limitation dans le temps. Les - 51 -

http://www.utqueant.org diffrentes ditions et manuscrits du Mahbhrata appartenant aux rgions les plus varies de lInde diffrent remarquablement peu les uns des autres dans leur ensemble, tant dans leur contenu et lordre de leurs sections que dans leur langue et leur grammaire; ils diffrent seulement dans des dtails, et mme alors, pas dune manire continue et suivie, mais plutt accidentelle. Cela semble venir du fait que presque tous ces manuscrits et ditions proviennent dun texte rvis, mme du point de vue grammatical, et bien tabli. Dans le deuxime remaniement, le texte a t galement corrig du point de vue du langage. Mais cette rvision ne prit pas cela trop exactement; elle laissa des restes de formes grammaticales plus anciennes, et lon ne peut donc pas mesurer la langue pique daprs les strictes lois de la grammaire. Le Mahbhrata dit Burnouf, Bh. P., II, intr. p. 4 sest souvent cart des rgles de lcole classique de Pini . Pour le Mahbhrata, il est difficile dans certains cas de juger si les formes incorrectes selon Pini sont prendre comme des archasmes, ou bien comme des formes nouvelles consciemment archasantes. Et surtout, une langue archaque nest pas, sans autre preuve, le signe dune rdaction ancienne; le Bhgavata Pura prsente de forts archasmes, contrairement lAitareya Brhmaa, plus ancien mais correctement rdig grammaticalement, Telang, Bhg., 1875, intr. pp. 106-107. En gnral, la langue du Mahbhrata montre une plus grande tendance se librer des rgles complexes de la grammaire, et une plus grande rpugnance envers les formations difficiles et irrgulires quemploiera la langue du thtre et de lpope potique. Dans des cas isols, les rgles du sadhi sont observes sans aucune apprhension; dans la dclinaison des noms propres, nous observons des doubles formes, comme chez Homre; les participes en ant forment leur fminin en ant ou at, suivant les besoins de la mtrique; de mme, lemploi de lactif ou du moyen est conditionn plus par des raisons mtriques que par des raisons grammaticales, de faon libre et arbitraire. Il est remarquable que, pour autant que jen sache, les formes de la premire personne du singulier de limpratif, de limparfait et de loptatif moyens sont compltement absentes ( part dans un passage de la Bhagavadgt). La premire personne de limpratif actif est encore assez frquente; laugment manque parfois, le redoublement presque jamais. Le passif, contrairement la rgle, prend souvent la terminaison active au lieu de la terminaison passive. Le parfait redoublement est encore trs courant, loptatif nest pas rare. Trs souvent, contrairement la rgle, qui veut que le suffixe de labsolutif ya napparaisse que pour des verbes composs, on le trouve aussi sur des verbes simples. Nous trouvons souvent la forme causative employe au lieu de la racine simple, et vice versa. Le parfait priphrastique en babhva est rare, encore plus rare limpratif en tt et le passif en i. La formation des mots composs reste dans des limites raisonnables; les sesquipedalia verba de la posie plus tardive nont pas cours; Friedrich Rckert, dans sa traduction de Nala, forme souvent des mots composs en allemand des endroits o le texte sanskrit - 52 -

http://www.utqueant.org nen a pas. La syntaxe est simple et lgre (cf. Lassen, Ind. Bibl., III, p. 12), la diffrence de style ( archaic in its simplicity , Telang, Bhag., 1875, intr. p. 103) avec la posie classique plus tardive, est plus importante que dans laccentuation et les formes du langage (Lassen, III, p. 17). Le remaniement a laiss de ct des mots et des formes inusites, mais il nest que rarement possible de montrer ce toilettage des archasmes. Ainsi lancienne particule u a disparu; la place de ki v ktv, I, 27, 15 = 1318, lancien Suparkhyna a encore, dans un passage exactement parallle, kim u ktv (H. Oldenberg in ZDMG XXXVII, p. 74). Le dieu du feu Bharata sappelle ainsi, III, 221, 1 = 14177, parce quil porte les cratures: bharaty ea praj sarv tato Bharata ucyate. Cette remarque est tire du Brmana, cf. les deux passages cits par Muir, S. T., IV, p. 28 bas et note 74: Bharata sarva bibharti et praj bibharti tasmd ea Bharata. On peut aussi vrifier que la forme plus ancienne, ou en tout cas plus lourde, bibharti, a t remplace par bharati, plus lger. Les anciennes liberts du style pique ont t conserves dans certains passages, dans dautres effaces. Ainsi les racines en as reviennent volontiers loccasion une dclinaison vocalique, et ces anomalies furent annules plus tard, souvent de faon maladroite. Ainsi, dans un passage dont on a rcemment beaucoup parl, II, 66, 8 = 2193, puis-je lire irasasya au lieu de irassya: quand le couteau se fut tourn dans la base de la tte, cest--dire dans le cou. (Ou irasa ca). Le nom. sing. masc. du participe en ant, peut aussi tre utilis de faon absolue; ainsi en III, 296, 32 = 16745, smaran; XIV, 81, 5 = 2406, hasan; XV, 38, 17 = 1079, krandan (dit de femmes); X, 1, 4 = 4, cintayan, (de plusieurs hommes, seulement B). Parmi les moyens de sduction des Apsaras, la danse ne devait pas manquer, et en effet lancien manuscrit de Paris porte ntyan, au lieu du nityam sans signification de B et C. La grammaire du Mahbhrata na pas encore t dcrite et tudie, les ditions, sous ce rapport, ne sont pas trs exactes, et devraient dabord tre corriges daprs de bons manuscrits. Les grammairiens indiens suivent les exemples de Pini, qui ne tient pas compte du dialecte pique. Chez nous, Franz Bopp, dans sa grammaire, a attir lattention sur les nombreuses particularits de la langue pique. On trouve des indications partielles dans la grammaire complte de Theodor Benfey (1852); Les rfrences du Mahbhrata sont, ici et l, inexactes (sur rehatara, p. 234, 605: MBh, IV, 11295, au lieu de: MBh, IV, 11, 295; p.313, 754, note 1, il faut lire: livre III, au lieu de livre II), dautres carrment fausses (sur duhitram, p. 315, remarque 1, je ne peux pas la trouver en MBh, III, 10304; sur jahiyati, p. 403, note 1, en MBh, III, 840); accetss, suppos tre une faute dimpression, p. 388, note 1, se trouve aussi dans ldition de Bombay. La page 389, note 4, indique que la forme inexistante avost, est seulement une mauvaise lecture de evst (ou tait-ce lancienne lecture de avst ? Dans le Vracaritra, on trouve mgaymavast, Jacobi, Ind. Stud., XIV, p. 144). Cf. aussi Benfey, Kleinere Schriften, I, pp. 286; 329; II, p. 149. On trouve de courtes remarques sur lemploi de la langue dans le Mahbhrata - 53 -

http://www.utqueant.org chez Lassen, Ind. Bibl., III, pp. 12; 16-17; 73; 107, chez Westergaard, z w e i Abhandlungen bers. v. Stenzler, p. 72, note, chez Francis Johnson, Selections from the Mahbhrata, intr. p. 1, chez Telang, Bhag., intr. p. 106, etc. Ferdinand de Saussure est celui qui emprunte le plus grand nombre dexemples notre pope dans son essai: De lemploi du gnitif absolu en sanskrit, Genve, 1881. On trouve aussi des digressions occasionnelles sur lemploi de la langue dans le Mahbhrata dissmines dans dautres travaux, par exemple Richard Pischel dans le Gttinger Anzeigen, 1884, n 13, pp. 501, 520. On trouve rfrenc dans Kuhn, Litteraturblatt, III, p. 95, note 1575, un essai dArrowsmith, On the compounded verbs in the Nala (sur les verbes composs dans Nala). John Avery, Contributions to the history of verb-inflection in sanskrit, s. Am. Or. Soc. proc. Nov. 1875, p. 11, a compil les formes verbales de la B h a g a v a d g t et du Nalopakhyna. Cf. mon essai: Grammatisches aus Mahbhrata, Leipzig, 1884. On voit quil y a encore beaucoup faire pour la grammaire de lpope. Avec le temps, on mettra en lumire de grosses diffrences sous ce rapport entre les livres. Les sept derniers livres, partir du douzime, qui contiennent extraordinairement peu dlments anciens et authentiques, tranchent aussi singulirement, en ce qui concerne la langue, avec la diction simple et sre des passages plus anciens; on y trouve aussi des paragraphes trs difficiles au niveau de la langue, dont le caractre insolite vient peut-tre de ce quils proviennent duvres totalement diffrentes; et, beaucoup de compilateurs de ces derniers livres du Mahbhrata ne parlaient plus couramment le sanskrit. Dans le treizime livre, nous trouvons des barbarismes indniables; cf. mon Grammatisches, Whitney, p. 285. Franz Bopp commena en 1830 lexploitation grammaticale du Mahbhrata; dans son Glossarium Sanscritum, il tablissait un glossaire pour les pisodes quil avait traduit et le compltait par des extraits dautres parties de l'pope. Le dictionnaire de Saint Petersbourg a rendu les plus grands services pour notre pope, comme aussi pour bien des domaines de la littrature indienne. Chaque volume (le premier parut en 1855, le septime en 1875) tient compte du Mahbhrata en proportion croissante, grce lappui que les travaux de Bhtlingk trouvrent auprs de Weber et dautres. Les complments et les supplments qui sajoutrent au SanskritWrterbuch in krzerer Fassung (Dictionnaire sanscrit lmentaire), 1879-1889, firent pratiquement de cette uvre un lexique spcialis du Mahbhrata. On ne pourrait trouver que peu de mots rajouter qui ne sy trouvent pas, comme antitara plus prs, III, 269, 10 = 15676; antoha, lvre, XI, 15, 16 = 396 (seulement B); aikntitva, exclusivit (monothisme ?), XII, 346, 1 = 13427; kvel pour kve, cri de guerre, VIII, 49, 24 = 2324 (B et C); paraata, VIII, 90, 61 = 4689 et paraata, VIII, 78, 55 = 3993, plus que cent; manoharat (abstrait de manohara), ravissement, III, 277, 5 = 15949; yogtmaka, concordant (?), XIX, 22, 2 = 1227; kula, relatif aux poissons, sous-titre XII, 137; sarvagamy, amante, VIII, 94, 27 = 4920. En plus de - 54 -

http://www.utqueant.org cela, quelques mots composs, comme kar, verser, avec praty, VI, 82, 39 = 3615 (C seulement); s avec prati, VIII, 90, 96 = 4725 (pratyasyat, que Nlakaha explique par pratiprkipat); har avec sam, VIII, 61, 39 = 1846. Beaucoup de mots cits dans ce dictionnaire peuvent aussi tre avoir un autre sens; avairas, III, 79, 21 = 3083, est, daprs Nlakaha, comme avavidy: utkarin, XI, 24, 19 = 693, veut dire partant. En IX, 11, 53 = 581, le mot rsana, marqu dun astrisque, est donn par Nlakaha comme une varia lectio la place de vsava, et il lexplique par abdavant. En I, 487, avalepa est not daa, une faute dimpression , et effectivement Nlakaha pour I, 167, 37 = 6391, explique avalepa par daa (sous lautorit de Medhin) et avalipta par dita. En I, 307, pthivym api, (cf XI, 27, 10 = 809: yasya nsti samo vrye pthivym api kacana) galement par sur toute la terre ; cf. II, 49, 38 = 1763. En IV, 773, punarvasu: ici (VIII, 49, 28 = 2328) on aurait pu sattendre au duel : B a juste titre punarvas. La signification: voiture, propose pour vadh, IV, 663, note 3 (pas reprise dans le petit dictionnaire) peut tre accepte en XV, 15, 10 = 437. En V, 1093, cf. XII, 179, 2 = 6654, jagara, vivant comme un serpent gigantesque. Lexactitude avec laquelle les deux ditions ont t imprimes est tonnante; on sen rend compte quand parmi tant de milliers de colonnes, on lit une fois un datif en place dun instrumental (III, 386, ttya, dernire ligne) ou on rencontre une citation qui nest pas situe correctement (I, 837, k avec ava, n 3, ligne 6: Draup., 5, 36 1.

5.

En ce qui concerne la mtrique du Mahbhrata, il est bien connu que la plus

grosse partie de l'pope, et de loin, est crite en mtre pique, le loka; des variantes assez frquentes sont les mtres choriambiques, lupajti (appartenant la famille des triubh) et le vaastha. Dans ce dernier mtre, sont rdiges quelques unes des parties les plus importantes et les plus belles de l'pope, comme le svayavara de K et la mort de Bhma ou de Kara; je tiens pour faux le point de vue que Srensen cherche soutenir, que ces passages seraient dorigine plus tardive ( longiore metro compositum, quod per se suspicionem habet , p. 369: loci longioribus versibus compositi in loco antiquorum lokorum successerunt , p. 370 entre autres). Peut-tre pourrait-on dmontrer le contraire, que les mtres choriambiques sont les plus anciens; ce nest pas sans raisons que le mtre upajti est aussi appel khynaki, dkhyna, rcit pique. La premire priode ne connaissait que les mtres choriambiques et la prose; les premiers traitaient les discours insrs dans laction et les points principaux du rcit; le reste est en prose. Oldenberg, ZDMG 37, p. 80, dsigne comme un reste conserv de cette prose les uvca et les ucu, qui restent en dehors des parties versifies. Comme de tels fragments piques
1

NdT: Suivent une srie de remarques, du mme type que les prcdentes, quil ne semble pas utile de reproduire ici.

- 55 -

http://www.utqueant.org conservs dans la littrature vdique et rapportant des dialogues ne peuvent tre compris quen supposant que, dans le traitement propre du mythe, ces fragments sont rapports avec une introduction, un enchanement et une conclusion entre chaque dialogue (Oldenberg, ibid., p. 81), comme dans certains cas, pour les parties en prose, la teneur concrte de ces fragments na peut-tre jamais t fixe (p. 82), nous pouvons donc concevoir que le rcit du Mahbhrata tait aussi long sous sa forme choriambique, ou dautres formes avec des strophes longues, son contenu alternant juste avec certains passages en prose, conservs ou reproduits. Mais la place de cette prose, apparut plus tard le loka plus lger et plus agrable. Ce fut peut-tre le pote du premier Mahbhrata bouddhique qui poursuivit cette transformation dj commence avant lui. Par le remaniement, le loka, quon stait habitu considrer comme la vraie strophe pique en opposition avec la littrature vdique (Max Mller, Anc. lit., p. 69) prit une extension significative, et les mtres choriambiques furent traduits partiellement en loka. Le mtre pique se dveloppa nettement plus librement que ne laurait permis la mtrique de la posie artistique plus tardive. CF. Telang, Bhag., 1875, intr. p. 101. Dans un nombre assez grand de passages, nous remarquons encore neuf syllabes dans le premier quart de la strophe, qui prend alors la forme x x, par exemple Aditir Ditir Danu Kl, I, 65, 12 = 252; anugamyamn Vysena, XIII, 169, 19 = 7778; abhivdayta vddhaca, XIII, 104, 65 = 5020; upanyamna yuktam, II, 36, 26 = 1331; daarotriyasamo rj, I, 41, 31 = 1722; varada namasva Kaunteya, XII, 341, 33 = 13161: caragata ca tyaceta, III, 131, 6 = 10566, mais on trouve encore dautres variantes, par exemple Aparcita Sarvasaha, XIII, 149, 102 = 7041; parcito Jyotikaca, I, 35, 13 = 1558, abhiektukma npatim, I, 85, 19=3518 entre autres. Un remaniement mtrique, qui cherchait viter les anciennes rgles contraignantes, au mme titre quil cherchait liminer les archasmes grammaticaux, ne peut se constater, par comparaison avec des passages parallles, que dans un nombre rduit de cas. Ainsi, en I, 25,4 = 1282, on trouve ngnm laya bhadre, dans le Suparkhyna, le passage parallle dit: samudre ramanyakam; mais daprs la prosodie plus tardive, le premier quart de la strophe ne devrait pas se terminer en , do la modification de notre texte, avec mise lcart du heurt mtrique (Oldenberg, ZDMG XXXVII, p. 74).. Ainsi on a en III, 190, 93 = 13101 et en XIX, 41, 64, Kalki Viuya nma, donnant Viuyaas comme deuxime nom Kalkin; mais daprs le Brahmavaivartapura (Aufrecht, cod. Bodl., 23b), Viuyaas est le pre, daprs le Viupura (Wilson, IV, p. 229), le pre ou laeul de Kalkin; ceci a t modifi dans le Mahbhrata,, pour viter le heurt mtrique Kalk Viuyaaa putra. Le mot bhavati est lu quelquefois comme ayant deux syllabes: na tena sthaviro bhavati, III, 133, 11 = 10631; rutena rotriyo bhavati, III, 313, 48 = 17333, et dans la mme strophe dhtya dvityavn bhavati, dans le mme adhyya: 47 =

- 56 -

http://www.utqueant.org 17332; 77 = 17362; 78 = 17363. Cf. Manu, II, 201; Rmyaa, Schlegel, II, 103, 30 et 104, 13. Pour les autres comparaisons sur les mtres du Mahbhrata: Antoine Lonard de Chzy, lokaviracanavidhi, Thorie du loka ou mtre hroque sanscrit, Paris, 1827; Johann Gildemeister, zur Theorie des loka (de la thorie des loka), dans Zeitschrift fr die Kunde des Morgenlandes, V, 1843, p. 260-280; ici aussi galement, un recueil de pada de neuf syllabes; Otto Bthlingk, Sanskritchrestomathie, 1845, pp. 443-448: Der epische loka (le loka pique); Hermann Brockhaus, die sechzeilige Strophen in Sanskrit-Gedichten (Les strophes de six vers dans la posie sanskrite), ZDMG XIX, 1865, pp. 594-599; il traite aussi des strophes de six vers qui ne seraient pas carter (avec A.W. v. Schlegel); Gildemeister, Anthologia Sanscritica, seconde ed., Bonn 1868, metrorum explicatio, pp. 117-124; E. Teza, Laghucakya, Pise 1878, parle en pp. 47 et 48 des loka iambiques dans le antiparvan; Ernst Kuhn dans les annales 1879, p. 46; Hermann Oldenberg, Bemerkungen zur Theorie des loka (remarques sur la thorie du loka), ZDMG XXXV, 1881, pp. 181-188; le mme, ber das altindische akhyna (sur lancien akhyna indien), ZDMG XXXVII, 1883 parle de lemploi du t r i u b h dans le M a h b h r a t a , p. 59: mit grosser Regelmssigkeit durchgefhrt (utilis avec une grande rgularit) et sur le loka dans lpope, pp. 62-67; Hermann Jacobi, in ber die Entwicklung der indischen Metrik in nachvedischer Zeit (sur le dveloppement de la mtrique indienne aux poques post-vdiques), parle en p. 608 des remarques dOldenberg sur la triubh dans le Mahbhrata et revient sur la rgularit quil affirme dans la construction des strophes; Hermann Jacobi, zur Lehre vom loka (enseignement du loka) in Ind. Stud., XVII, 1885, pp. 442-451; Une uvre trs complte et fondamentale est celle de Joseph Zubaty, der Bau der Triubh- und Jagazt-Zeile im Mahbhrata (la construction des vers triubh et Jagat dans le Mahbhrata), ZDMG XLIII, pp. 619652. Quelques passages des livres di, Vana et nti sont en prose; il ont t insrs trs tardivement, bien que, par exemple, la section Pauykhyna donne limpression dtre ancienne et tire dautres uvres plus anciennes.

6.

La caractristique principale du second remaniement par rapport au premier

me semble tre la rhabilitation de iva. La longue bataille avec le bouddhisme a contraint les brahmanes se chercher des allis dans leur peuple, et, comme prcdemment avec le vishnousme, conclure un compromis avec le shivasme. Dans le sillage de iva, tout lappareil des religions populaires indiennes plus tardives fit son entre dans la mythologie indienne et lui donna ce caractre insipide que Goethe a trait avec une rpugnance justifie. Les Pura et le Mahbhrata sont bien rsolument vishnoutes, mais ils honorent aussi pleinement ce iva, auparavant si - 57 -

http://www.utqueant.org dcri. Aprs lexpulsion des bouddhistes, les anciens allis des shivates, les brahmanes, aviss comme ils taient, sen sont tenus au principal, tout en tant prts toutes les concessions possibles sur les aspects secondaires; ils ne se sont pas levs contre un dieu populaire, iva, puisque ses adeptes ne portaient pas atteinte lautorit des Veda ni la suprmatie des brahmanes; ils tenaient ces deux points et ne plaisantaient absolument pas l-dessus. Parmi les Pura existants, certains montrent une prfrence pour iva, certains (la majorit) pour Viu; mais mme dans les premiers, iva adore Viu et explique les mystres de ses incarnations, et dans les derniers, the fullest justice is done to the divinity of iva (toute justice est faite la divinit de iva), Vans Kennedy 1840, Viupura, Wilson-Hall V, p. 341. Fitzedward Hall, Vi. P, V, p. 340, dit la mme chose sur les rapports rciproques des deux dieux dans les Pura, savoir quils expressely inculate that Viu and iva ought, both, to be worshipped (ils inculquent expressment que Viu et iva doivent tre adors tous les deux) et que, dans ces livres, ibid, p. 341, the terms Vaiava and aiva denote the preferential, but not the exclusive, worshipper of either Viu or iva (les termes vishnoute ou shivate dnotent ladorateur prfrentiel, mais non exclusif de Viu ou de iva). Le Bhgavata-Pura est entirement vishnoute, mais iva galement est le crateur du monde, IV, 6, 43, et Brahman seulement un de ses aspects, IV, 7, 14; 43; le sanglier qui a retir la terre des abmes est iva, IV, 7, 46. Habituellement, cest Viu, dans le Rmyaa, II, 110, 4, Schlegel, et mme encore Brahman. Ce point de vue des Pura est totalement celui de notre actuel Mahbhrata. Nous y trouvons les deux dieux en paix lun avec lautre; iva, auparavant ha et considr comme le diable, est ici, pour ainsi dire, rentr en grce, et mme Arjuna et ses frres sont mis en rapport avec lui; ainsi dans le Kairtaparvan, III, 38, 1 = 1516, Arjuna jene pour honorer iva, combat avec lui qui se prsente sous laspect dun Kitta, un homme de la fort, et le prie. Avant la Bhagavadgt, totalement vishnoute sous son aspect actuel, une prire dArjuna Durg, lpouse de iva, est insre, VI, 23, 4 = 796. Pour pouvoir se venger de Jayadratha, Arjuna, sur le conseil de Ka, accompagn par lui et avec son aide, va chercher auprs de iva son arc, Pupata, VII, 80, 19 = 2838; un passage nettement insr car la poursuite du rcit principal ( pendant que Ka et Druka parlent ainsi, le jour se lve , VII, 82, 1 = 2911) saccroche directement VII, 79, 44 = 2819, o Druka rpond au discours de Ka. Dans la guerre galement, iva protge Arjuna, il chemine devant lui pendant la bataille; un homme de feu, un trident en main, ne touchant pas la terre de ses pieds, tue les ennemis dArjuna; cest iva, VII, 202, 9 = 9502; XII, 342, 138 = 13299. Le compilateur du Droaparvan a emprunt cette description lancienne pope, dans lequel, au ntiparvan, iva, ou Agni encore plus tt, il est prsent de la mme manire comme dfenseur dAvatthman. Ainsi Arjuna honore bien Viu, mais aussi iva; il vainc avec laide de Viu, mais aussi de iva. Ce trait, conciliant les deux partis - 58 -

http://www.utqueant.org religieux autrefois si opposs lun lautre, se voit partout dans notre pope, telle quelle est aujourdhui. Il se rclame ouvertement de Viu et de iva (comme le dit Bharthari, 3, 30: ko deva Keava v iva v) et rclame dhonorer les deux: Dans cette pope, Viu est honor comme iva , I, 62, 34 = 2315. Honore iva qui se montre sous lapparence de Viu, de mme que iva, qui apparat sous la forme de iva , III, 39, 73 = 1626. Muir, S. T., IV, p. 280, cite dautres passages semblables. Des hymnes sont placs dans la bouche de ces deux dieux dans lesquels lun deux reconnat en vers enthousiastes la majest et la suprmatie de lautre et le loue; ainsi iva, III, 272, 28 = 15805, chante les louanges de Viu et raconte ses incarnations, parmi lesquelles se trouverait Ka; il nomme Viu avec le nom qui est habituellement celui de iva, Devadeva, 31 = 15808. Dans le Bhgavata Pura, IV, 24, 33, iva loue Viu dans un trs long hymne. Dautre part, dans tout le treizime livre, Viu glorifie iva. La louange des actions dun des plus grands dieux alterne avec celle de lautre, les plus de mille noms des deux dieux sont construits compltement sur le mme registre. Comme dans lhistoire des aptres les rcits des actions merveilleuses de Pierre et de Paul. psent exactement le mme poids, ainsi dans le Mahbhrata on a veill soigneusement ce que iva ne soit pas dfavoris par rapport Viu et que chaque passage vishnoute reoive son pendant shivate. Qui est familier avec le Mahbhrata, sattend, lorsque lpope a beaucoup parl de Viu, ce que iva entre en scne, et il entre en scne. Le Mahbhrata voulait videmment tre quitable envers les lecteurs shivates, la souplesse desprit bien connue des brahmanes voulait fondamentalement rconcilier les contraires: the spirit of conciliation or comprehension has always characterized the Brahmans, and is perhaps the main cause of their success , (lesprit de conciliation et de comprhension a toujours caractris les Brahmanes, et cest peut-tre la raison de leur succs) dit avec raison Talboys Wheeler, Hist., III, p. 79, mais je limiterais le always (toujours) aux priodes o cela leur semblait politiquement utile de laisser prvaloir cet esprit; ils ne montrrent aucune sympathie envers les bouddhistes et ne les pargnrent pas, bien quil semble que des essais de nivellement aient t faits dans ce sens; une inscription du Maghada, date de 948, nomme cte cte Brahman, Viu, iva et Buddha (Lassen, IV, p. 475) et chez Amarasiha, le nom de Buddha se trouve pacifiquement au ct de celui de Brahman et dautres anciens dieux. Que lon puisse attribuer la rconciliation entre le vishnousme et le shivasme au second remaniement puranique du Mahbhrata personnifi sous le nom de Vysa, cela me semble dcouler de la manire dont Vysa et iva sont mis en relation. En effet Vysa, VII, 201, 91 = 9484, prche le sivasme Avatthman et Arjuna; il raconte comment iva se procure par la force une part du sacrifice et comment il se montre, enfant, dans le giron dUm. dans le Skandapura, Aufrecht, Cat. Bodl., 72a, on raconte que Vysa avait reconnu dabord Viu comme dieu suprme; alors - 59 -

http://www.utqueant.org sa main gauche stait dessche, et Viu lui-mme lui avait conseill dhonorer iva dun pome. Vysa suivit ce conseil, et sa main fut gurie; depuis ce moment, il est devenu un adepte de iva et a aussi instruit ses lves dans ce sens. Mais lacceptation de iva par les diaskvastes nalla pas sans rsistance. Dans le Bhgavata Pura, on se plaint de ceux qui ne reconnaissent pas iva, parce quils se sont laisss sduire par les paroles fleuries (gira pupiya) des Veda, IV, 2, 25. Mais aujourdhui encore, les purs vishnoutes du pays Tamoul ne pardonnent pas aux diaskvastes ce compromis avec les shivates. Un ouvrage en vers tamil, Agastyajna, polmique contre les passages shivates dans le Mahbhrata et explique que cette uvre est une trahison de Vysa au profit des adeptes de iva, H.H Wilson, Mackenzie Collection, I, p. 228, note 53. Il est naturel que cette rconciliation ait eu lieu aprs de durs combats, et lhistoire, souvent raconte, du sacrifice de Daka est une rminiscence de ces combats; cf. en particulier XII, 283, 26 = 10234; XII, 284, 20 = 10292 et leur description dans le Harivaa. Ce dernier est rdig dans un sens vishnoute; iva y reoit sa part du sacrifice seulement quand, vaincu par Viu, il demande grce, XIX, Bhav., 32, 48 = 12260: Langlois, II, p. 363, remarque propos de cette lgende: elle ne me parat faire allusion qu lhistoire du ciel, et nullement lhistoire des hommes ; Je pense exactement le contraire. Dans la description du Harivaa, XIX, Vish., 125, 13 = 10643, cest le fait que Pthiv, la desse de la terre (cest--dire le peuple) qui a le plus souffrir du combat de ces deux dieux (cest--dire les vishnoutes et les shivates) et que Brahman (cest-dire les brahmanes) vient son aide et ensuite rtablit vraiment la paix. Au sujet du passage correspondant du Viu Pura, Wilson, V, p. 120, remarque: there can be little doubt that this legend describes a serious struggle between the aivas and the Vaiavas (il est presque certain que cette lgende dcrit un srieux affrontement entre les shivates et les vishnoutes); et plus loin, V, p. 128: in this legend (von Ka and Pauraka) again, we have a contest between the followers of Viu and iva intimated (par cette lgende (de Ka et Pauraka) de nouveau, on nous laisse entendre un srieux conflit entre les adeptes de Viu et de iva). En tout cas, la rconciliation est compltement russie, en ce qui concerne le Mahbhrata; tantt, VII, 201, 61 = 9451, Nryaa obtient, grce des pnitences et un hymne, la faveur de iva, qui lui octroie gracieusement le plus haut rang parmi les dieux, tantt, XII, 340, 79 = 13085, Brahman fait natre iva de son front, tantt, XIX, Vish., 71, 17 = 7352, Nrada enseigne Indra que iva et Viu, entre lesquels il ny a aucune diffrence, ont engendr Brahman, tantt, XIV, 147, 38 = 6834, iva explique: qui veut voir et moi et le grand-pre Brahman, quil contemple la majestueux Vsudeva et il nous verra aussi . Par suite de cette rconciliation, un grand nombre de passages shivates furent introduits dans le Mahbhrata, en plus de ceux que nous avons dj cits, par exemple lhistoire des cinq Indra, I, 197, 1 = 7275, lhistoire de la conqute par iva (avant cela par Agni) de la ville des ennemis - 60 -

http://www.utqueant.org des dieux, Tripura, VIII, 33, 1 = 1391, comment le reprsentant du brahmanisme pur et exclusif, Rma, le fils de Jamadagni, devint son favori, VII, 34, 126 = 1582, lhistoire du hibou et du chacal, XII, 153, 2 = 5676, etc, sans compter des strophes introduites en lhonneur de iva, comme IX, 35, 77 = 2050 et les mentions du liga shivate, VII, 201, 93 = 9486; VII, 202, 135 = 9617; X, 17, 21 = 780; XIII, 13, 162, 15 = 7516. Oui, en iva tous les deux sont contenus, comme les vaches dans ltable , XII, 284, 79 = 1053. Mais cependant il nest pas juste, comme A. Barth, dans son Geschichte der Indischen Religionen (Histoire des religions indiennes), semble inclin le croire, de dire que le culte de iva est le culte dominant du Mahbhrata: ( here the most widely spread cultus is in the main that of iva (ici, le culte le plus largement rpandu est, dans lensemble, celui de iva), p. 167 de la traduction anglaise. Pourtant Viu domine de beaucoup et iva reste derrire de faon significative. On remarque aussi une grosse diffrence entre les appendices rdigs en lhonneur de ces deux dieux. Les morceaux shivates sont ajouts lpope de faon lche et on peut sans difficult les supprimer, ils sont nettement plus rcents que les morceaux vishnoutes, qui ont pntr lancienne pope et y sont incorpors pour toujours. Linsertion des premiers est une liaison mcanique, celle des derniers, une liaison chimique; la version vishnoute date du dbut du combat contre les bouddhistes, iva ne trouva sa place que quand ce combat fut termin.Mais il est certain que, par ladmission des deux dieux les plus importants, qui prtendaient tous deux tre le seul vrai dieu, comme aussi par leur identification diffrent dieux qui sillonnait toute la mythologie indienne et conduisait un syncrtisme un peu grossier , Burnouf, Bh. P., I, intr. p. 131, une dissonance, une ambigut se produisit, qui, dans le souci de faire droit aux deux partis, devait, dun ct comme de lautre, blesser leurs adeptes zls. On tenta dexploiter le Mahbhrata: aussi bien dans le sens des vishnoutes que dans celui des shivates. Ainsi Taylor, c a t . , I, p. 178, note 8, cite un ouvrage sanskrit, le Mahbhratattparyarak, attribu au Vednta carya; lauteur polmique contre les shivates, prtend que nulle part dans le Mahbhrata Ka nhonore iva, et dcrit ce dernier, dont il ne nie pas lexistence, comme un simple homme, sans supriorit particulire (paratva, paramatva). Un autre ouvrage sanskrit au contraire, le Bhratasrasagrahastrotra, exploite le Mahbhrata: dans le sens shivate et rassemble les passages correspondants, Taylor, II, p. 295: de mme, toujours dans lintrt des shivates, en sanskrit, le Bhratavivaraastrotra, Burnell, Class ind., p. 199, et aussi, toujours en sanskrit, le Vidyrayayati, ou bien luvre majeure de Syana, le akaravilsa, une simple compilation, lexception de lintroduction, des passages shivates de divers Pura et du Mahbhrata (de ce denier, par exemple, le Kirtrjunya et des fragments des livres Kara et Anusana), Burnell, p. 202. Un ouvrage sanskrit, ivarahasya, asserts that he who even thinks that Viu is equal to iva, will go to hell (affirme que celui qui pense que Viu est gal iva, ira en - 61 -

http://www.utqueant.org enfer), Burnell, p. 206. Ainsi iva apparat ses adeptes comme un dieu bienveillant, aux vishnoutes des temps anciens comme un esprit mauvais; une de ses faces est bienveillante, lautre terrible et dltre , XIII, 141, 6 = 6395. Il est difficile de dire quand on commena conclure la paix entre Viu et iva,; ce processus de rconciliation fut rapide dans certaines rgions, plus lent dans dautres, et nest pas encore termin aujourdhui. Encore maintenant, comme le montrent les ouvrages cits plus haut, ladepte exclusif de Viu refuse toute adoration iva, de mme le shivate Viu; Mais les vishnoutes et les shivates exclusifs ne sont pas trs nombreux en proportion. Bombay, iva et Viu se tiennent cte cte dans les temples, Gaul, III, p. 75, dans les pays tulu, iva et Viu vont lun ct de lautre sans opposition, III, p. 187, dans les pays malayala on les fte ensemble, et les diffrences entre les deux sectes ne portent que sur des dtails, dans les pays tamil, par contre, les diffrences sont accentues et profondes, III, pp. 219; 226; 337. Encore aujourdhui, dans les saints lieux, des coups sont volontiers changs entre les vishnoutes et les shivates, Rammohun Roy, Books of the Veda, p. 90. Nous ne pouvons que supposer quexistaient les mmes diffrences locales dans des temps plus anciens. Au Cachemire, les deux dieux taient honors ensemble, dj par le roi Avantivarman, 857-886, daprs Lassen, III, 1019; sur une inscription Vijayanagara vers 1370, les deux sont appels laide IV, 172; on ne peut tirer aucune conclusion de ces informations et dautres parses. tout au plus pouvons-nous supposer que le rapprochement des deux dieux sest impos de faon urgente et gnrale seulement quand le danger dtre opprim par des ennemis trangers htrodoxes se faisait plus pressant et rendait plus vidente pour les indiens menacs la ncessit de sunir, cest--dire depuis les premires invasions durables des musulmans vers lan 1000 aprs J.-C. Nous proposerons donc pour le deuxime remaniement du Mahbhrata la priode des deux sicles avant et aprs lan 1000, quand il ntait plus question des bouddhistes et pas encore des musulmans.

7.

Dans le Mahbhrata, les passages qui expriment, sous le nom de Trimrti, la

notion bien connue de la trinit indienne sont bien plus rares que ceux qui concilient Viu et iva. Lesprit de conciliation ratissa encore plus loin autour de lui, et les deux dieux principaux identifis lun lautre, Viu et iva, furent dclars de mme nature que lancien dieu crateur du monde, Brahman, de sorte que ces trois dieux semblables entre eux, ne sont que diffrentes manifestations du mme tre suprme. Cette notion de Trimrti est arrive trs tard en Inde et semble ne pas avoir eu grand succs. Il y a dans le Mahbhrata des passages qui enseignent la Trimrti, mais ils sont relativement rares. iva et Viu sont souvent identifis lun lautre; iva est viurpa et Viu est ivarpa, III, 39, 73 = 13155; lidentit des - 62 -

http://www.utqueant.org deux dieux est affirme et leurs noms rciproquement changs, XIX, Bhav., 88, 61 = 14694. Mais, aprs que ces deux dieux aient t combins lun avec lautre, les brahmanes nhsitrent pas incorporer aussi leur ancien dieu Brahman cette manifestation pourtant peu brahmanique. Cela se passa sans rsistance. le peuple navait rien objecter un troisime associ, qui lui tait indiffrent; des dieux impartiaux comme Brahman ne sont pas honors , XII, 15, 18 = 441. Dans le Brahmavaivarta Pura, labandon de Brahman est attribu une maldiction de Nrada, Wilson, Essays, I, p. 112; R.L. Mitra, not, III, p. 239, 12-14. Il est apjya et nindita dans le Kathsaritsgara, I, 1, 30. Dans le Mahbhrata, on ne parle que rarement de la Trimrti, et seulement dans des passages rcents. Il nest pas ncessaire de citer ici les passages o seuls les noms des trois dieux sont cits ensemble, sans que leur identit de nature soit constate; comme VIII, 96, 62 = 5044: Viu, Svayabh (cest--dire Brahman) et Bhava (cest--dire iva) sont bienveillants envers celui qui a tudi le Karaparvan; Passages similaires dans mon essai sur Brahman, ZDMG XXXVIII, p. 203. On ne peut citer avec certitude quun seul passage de tout le Mahbhrata proprement dit, qui pourtant a des interpolations trs tardives, III, 272, 47 = 15824: Le seigneur des cratures se manifeste de trois faons, en tant que Brahman, il cre, en tant que Purua (Viu), il maintient, en tant que Rudra (iva), il dtruit. Le Harivaa sexprime encore plus clairement; iva y dit Viu, XIX Bhav., 88, 31 = 14935: tu es Brahman au temps de la cration, tu es Viu pour le maintien, tu es Rudra pour la destruction du monde, ces trois forces sont runies en toi ; et en XIX, Vish., 125, 31 = 10662, Mrkaeya exprime clairement la notion de la Trimrti: yo vai Viu sa vai Rudro, yo Rudra sa Pitmaha, ek mrtis, trayo dev Rudraviupitmaha. La Trimrti est expose tout aussi clairement dans Wilson, Viu Pura, I, p. 41, et dans le Bhgavata Pura, IV, 7, 54: les trois dieux sont identiques, ils ont la mme nature et sont les seuls tres existant vraiment. On les trouve dj dans la Maitrya-upaniad et dans la Nsihatpanya-upaniad, la triade de dieux, Brahman, Viu, iva, apparat comme subordonne lEsprit Suprme, Weber, Ind. Stud, IX, pp. 57; 124. Dj avant 1189 aprs J.-C., sur la Narmad, ces trois dieux ont t reprsents cte cte dans un temple, Lassen, IV, p. 108; un temple leur fut bti Vijayanagara entre 1420 et 1445, Lassen IV, p. 172; le portugais Faria y Susa, vers 1550, parle de la Mahmrti des indiens, forme de lensemble de ces trois dieux, Wheeler, livre III, chapitre VIII, vers la fin. Mais il ne faut pas ramener une poque trop rcente la deuxime recension, qui ignore visiblement la Trimrti; mme de ce point de vue, il est recommander de la placer vers 900-1100.

8.

Pour le reste, ce remaniement tait pens pour dvelopper les tendances

vishnoutes et brahmaniques, ce qui avait dj motiv la premire rdaction. La - 63 -

http://www.utqueant.org divinit de Viu, qui se dclare lui-mme identique Brahman et iva, XIV, 54, 14 = 1576, repoussait toujours plus les anciens dieux larrire-plan; il prend la place aussi bien de Brahman (le dieu comme le concept): Viu est le Tout, dit le Bhgvata Pura, II, 6, que celle dIndra, on lui attribue maintenant la destruction des asura, qui tait auparavant luvre dIndra, (cf. mon Indra, ZDMG XXXII, p. 305: 329), vers lui tous les dieux se tournent en cas de difficult et en reoivent de bons conseils, comme auparavant de Brahman (ZDMG XXXVIII, p. 176). Il ntait pas difficile de transformer les ancien rcits sur les dieux dans un sens vishnoute ou de crer une glorification de Viu daprs le modle des anciennes. Le vishnousme ne montre en tout cas aucune imagination cratrice dans notre pope; les noms et les actions dIndra, Agni, Brahman, sont tout simplement reportes sur lui. Par exemple, lexplication du mot upendra (sous-Indra), un ancien nom de Viu, dans les commentaires du Viu Pura, montre jusqu quel point on est all dans la glorification de Viu; upa (sous) serait prendre ici dans le sens de upari (sur), Wilson, IV, p. 319; et lon retrouve cette belle interprtation dans le texte mme du Harivaa, dans le passage cit par Wilson et Hall, XIX, Vish., 19, 46 = 4006; Nlakaha explique que upa viendrait de upari par lision de la syllabe ri. Lide aussi quil suffit de penser Viu pour obtenir lunion avec lui est au moins insinue. Du corps de iupla, lennemi de Viu, schappe une lueur qui pntre le corps de Viu, II, 45, 26 = 1585. Ceci est mieux expliqu dans le Bhgavata Pura; mme les ennemis de Viu rejoignent son tre aprs leur mort, parce quils ont pens lui, mme de faon haineuse; de mme que les vachres se sont unies Ka par suite de leur amour (kamt), de mme iupla, par suite de sa haine (dvet), VII, 1, 30. Bien sr, le Bhgavata Pura ne poursuit pas cette trange proposition dans toutes ses consquences; les Dnava sont dtruits parce quils nont pas cru en Viu (abhakt Harau, VII, 6,10) mais on ne dit pas quils se sont unis lui ensuite. Cest probablement dans ce second remaniement quont t introduites dans lpope les dix incarnations de Viu; en III, 102, 20 = 8756, Viu est proclam crateur et destructeur du monde et ses avatra dnombrs; parmi ceux-ci, il y a aussi le hros du Rmyaa, Rma, le fils de Daaratha, comme dans cette pope elle-mme, III, 99, 41 = 8657; III, 147, 31 = 11197. La manifestation la plus aime de Viu tait et reste Ka, qui apparat bien avant lan 1000 dans son interprtation puranique: il est reprsent dans un temple bti au Cachemire entre 695 et 732, soulevant la montagne Govardhana, daprs le texte des Pura et du Harivaa, Lassen IV, p. 575. La dification de Ka, conduit aussi celle de son ami, Arjuna; cette ide des incarnations, pousse son terme, fait de lensemble des Pava des dieux ou des fils de dieux, des adversaires des Asura. Les fils de Pu reurent pour pres Yama, Vyu, Indra et les deux Avin; au dbut fut Arjuna, dont le nom tait aussi un des noms dIndra, Srensen, p. 361. Dans des passages plus tardifs, Arjuna apparat simplement comme un dieu; ses flches font jaillir des sources deau - 64 -

http://www.utqueant.org vive, VI, 121, 19 = 5780; VII, 99, 59 = 3721, ce qui rappelle son alter ego, Rma, le fils de Daaratha, dont on montre encore aujourdhui Bombay une source jaillie dune de ses flches, Graul, III, 51 p. 322. Je retiendrais mon jugement sur lintressante question de savoir si et jusquo des influences chrtiennes ont prvalu dans le Ka du Mahbhrata; l dessus, cf. A. Weber, Ind. Stud., II, pp. 390-400; sur le Jaiminibhrata, Goldstcker, Hindu epic poetry, p. 45; Peter Thiele, en Ka, in Theologischen Zeitschrift, Leiden 1877, p. 63; Telang, Bhag., 1875, intr. p. 27; Hermann Jacobi, ZDMG XLII, p. 493; sur le vetadvpa, Muir, Metr. Transl., intr. p. 23: Lassen II, p. 1118; Weber, Ind. Stud., I, pp. 400; 421; 423; II, pp. 168; 409; XIII, p. 148; J; Skizzzen, pp. 37; 93; sur le jour de naissance de Ka, pp. 316; 318; 321; Telang, Bhag., 1875, intr. pp. 34-36. Naturellement, autant Arjuna et Ka taient glorifis, autant Duryodhana et ses parents devaient tre dvalus. Cette tendance a dvaluer les Kaurava et glorifier les Pava est plus marque dans les ditions imprimes, plus encore dans Bombay que dans Calcutta (cf. mes remarques sur I, 129, 35 = 5067 et I, 104, 25 = 1495 dans Literaturblatt, I, 71; 72, en accord avec Edward Hopkins, American Oriental Society Proceedings, Octobre 1888, p. 4: most noteworthy are those (appendices de B, quon ne trouve pas encore en C) exhibiting examples of the development of the poem from a desire to exhalt Viu et Arjuna (remarquables sont ces appendices qui donnent des exemples dun dveloppement de lpope d un dsir dexalter Arjuna et Viu). Les tendances brahmaniques, tout autant que les tendances vishnoutes, sont constamment exaltes, je veux dire les efforts pour exagrer les privilges des brahmanes et leur statut divin. Aprs la victoire sur les bouddhistes, les brahmanes navaient plus aucun ennemi craindre dans leur peuple et tombrent dans une morgue sans limites qui sexprime de faon dautant plus drastique que le passage du Mahbhrata est plus rcent. Les passages les plus marqus dans ce sens se trouvent dans le livre qui est le plus rcent daprs toutes les apparences, savoir le treizime livre. On y lit des passage comme XIII, 35, 19 = 2160: Cest grce aux brahmanes que les dieux habitent le ciel, la terre ne peut tre gouverne quen obissant aux brahmanes, les brahmanes sont des dieux mme pour les dieux ; cf. Muir, S. T., I, pp. 130; 506. Ce nest que dans les livres les plus anciens, que lon trouve encore a et l des passages intacts qui honorent des points de vue clairs sur la morale et la nature des castes, comme III, 216, 13 = 14075: Celui qui a une manire de penser mauvaise est un dra, mme sil est n brahmane; mais celui qui est bon, mme appartenant la caste des dra, est un brahmane (une strophe du Vajrasci de lAvagoa, attribue Vaiapyana, Weber, Ind Stfn., I, p. 205, note 42, exprime la mme ide; ou bien III, 200, 97 = 13446: Si le cur nest pas pur, la bonne conduite et les pnitences sont vaines ; et tout de suite aprs, 102 = 13451: Une mauvaise conduite ne peut jamais tre rachete par des jeunes et des pnitences . Dans le treizime livre, la saintet des rites atteint son point culminant, ce que confirme la plainte dun rudit: we are now - 65 -

http://www.utqueant.org so attached to a lifeless ritualism (nous sommes maintenant tellement attachs un ritualisme sans vie), Telang, Bhag., intr. p. 26. Foi inconditionnelle Viu, vnration des brahmanes, et observance scrupuleuse du crmoniel, cest finalement tout ce qui est recommand au lecteur du Mahbhrata, et les rcits des exploits des dieux et des hros sont raconts aux guerriers de telle manire quils ne puissent jamais oublier que la victoire nest due qu laide de Viu et de la force agissante des prires et des sacrifices des prtres. Si Indra lui-mme, dans toute sa majest, tremble devant tout saint dont les pnitences ont le pouvoir de le chasser du ciel, plus facilement que tous les Asura runis, combien plus un roi indien a-t-il de raisons de craindre et dhonorer les brahmanes !

9.

En mme temps que le second remaniement de lpope, se produit la

transformation du Mahbhrata en livre de droit, en dharmastra. On dcida de faire de lpope, autrefois lecture prfre des guerriers, un livre denseignement pour tous ceux qui navaient pas le droit de lire les Veda, ou, comme les guerriers, qui ne les comprenaient pas; leur Veda est le Mahbhrata, le cinquime Veda comme il est souvent appel, par exemple par nandatrtha dans son Gtbhsya, Burnell, Class. Ind., p. 103a: Vedd api para cakru pacama Vedam uttara Bhratam; cette pope apprcie par tous, et particulirement par la caste des guerriers, dut accepter de se voir transforme en une sorte dencyclopdie et dy parvenir sous la forme dentretiens interminables, de leons puisantes sur toutes les affaires divines et humaines; les livres nti et nusana sont entirement consacrs ce but, les livres Vana et Udyoga, partiellement. Daprs le point de vue indien, le but du Mahbhrata est didactique: in the hands of the Brahmans the ancient epic has been changed into a didactic legend (dans les mains des brahmanes, lancienne pope a t transforme en un rcit didactique), Max Mller, Anc. lit., p. 18. Cest avec cette intention didactique, disent juste titre les indiens, que Vysa (cest--dire le second remaniement) a compos (cest--dire rdig) lpope. Le Bhgavata Pura explique: Vysa a compos le rcit Bhrata par compassion pour les femmes, les dra et les autres qui ne pouvaient pas couter les Veda, Muir, S. T., III, p. 42; cf. Mdhava crya qui cite ce passage, Foucaux, Onze pisodes, intr. p. 21. De la mme faon, nandatrtha, dans son commentaire cit plus haut, explique que Vysa aurait compos le Mahbhrata dans lintention de donner aux femmes, aux dra et autres la possibilit dobtenir le droit au salut par la connaissance, vednadikri strdrdn ca dharmajnadvr moko bhaved iti, Burnell p. 102b en bas. Aprs lpope elle-mme, V y s a a dsign le M a h b h r a t a comme un livre denseignement (stra) sur le devoir (dharma), I, 2, 383 = 646. Dans lHitopadea, un des personnages dit: moi aussi, jai lu les livres denseignement, les dharmastra; coute et il cite entre autres un passage du Mahbhrata, Schlegen-Lassen, pp. 10; - 66 -

http://www.utqueant.org 11 et 19; Askhedkar, pp. 8; 9 et 19. Le scholiaste Madhusdana compte le Mahbhrata parmi les dharmastra, Weber, Ind. Stud., I, p. 9; de mme nandatrtha: le meilleur des livres de droit est le Mahbhrata, et dans celui-ci encore le meilleur, la Bhagavadgt, Burnell, p. 103b. Dans un inventaire des dharmastra par Aufrecht, cat Bodl, p 266b, les paroles de Vidura et les chants de Vaiapyna sont cits. On voit que les indiens estiment que ces passages didactiques de la grande pope sont justement les plus dcisifs, alors que pour le lecteur europen, ils sont un fastidieux supplice.

10.

La caractristique de ce second remaniement est la grande quantit dajouts.

Cette extension gigantesque de lpope a plusieurs raisons. tout dabord la confusion. On runissait les diffrentes rdactions qui staient accumules au cours des sicles; des lments souvent contradictoires taient fondus en un tout; sil tait trop difficile de combiner des versions trop diffrentes, on racontait deux fois la mme histoire. De l, par exemple, les deux gnalogies diffrentes des Kaurava au premier livre, de l galement les deux listes diffrentes des cent fils de Dhtarra, les rcits non concordants des rapports dIndra avec Vtra et Nahua, la double histoire de Yayti aux livres di et Udyoga, la double partie de ds au Sabhparvan, la oaarjakya rpte en VII, 55, 5 = 2138 et en XII, 29, 13 = 905, lhistoire de seize rois heureux qui pourtant doivent mourir la fin, et bien dautre doublets dans notre pope. Les pisodes sont rapports lendroit o, dans lancienne pope, ils sont raconts par un des personnages, mais aussi celui auquel ils appartiennent daprs la suite chronologique des faits; ainsi, en particulier, les deux rcits dAmb et de la naissance de Kara. Pour motiver de tels doublets, un moyen commode: laisser lauditeur demander la rptition dune histoire dj raconte; par exemple VII, 15, 1 = 582. Dans le Rmyaa galement, par exemple en II, chapitres 3 et 4, la mme histoire est raconte deux fois de suite. Dautres ajouts ont pour motif le dsir de sauver autant que possible des plus petits fragments pars de lancien thesaurus de lgendes; bien des histoires qui nont aucun rapport avec le Mahbhrata, ont t introduites, aprs les transformations vishnoutes et brahmaniques ncessaires, sous forme dpisodes de cette pope toujours plus tendue; ainsi maints anciens rcits remarquables ont t sauvs de cette manire dans le Mahbhrata, comme par exemple les belles histoires de Nala, de Svitr, de Sukany, qui, par leur grande popularit, ont vit le sabotage vishnoute. Mais aussi une grande quantit dhistoires de saints, plus ou moins insipides, de rcits dascse et dautres lgendes ont t redcouvertes pour honorer les brahmanes et introduites dans le grand pome; ainsi par exemple, le troisime livre, de 184, 1 = 12625 jusqu 222, 32 = 14240, raconte une lgende de saint aprs lautre; les plus nombreuses et les plus exagres se trouvent dans les livres Vana et - 67 -

http://www.utqueant.org Anusana; galement les deux plerinages des troisime et neuvime livres, importants pour la gographie du Mahbhrata, livrent bien des histoires de ce genre. En fin de compte, on finit par rendre formellement lpope aussi longue que possible, parce quelle devait aussi en imposer par son volume. Cette tendance a au moins lavantage davoir permis de sauver maints passages qui, logiquement, auraient d tre supprims parce quils contredisaient le systme brahmanique. Nous avons dj not plus haut que lpope elle-mme donnait quelques indications sur son extension progressive, ce que reconnaissent maintenant mme les chercheurs indiens conservateurs. Des passages comme VIII, 90, 97 = 4726; VII, 139, 19 = 5714 montrent quelles erreurs remarquables ce dsir dextension a pu conduire: Quand il eut tir la premire flche, il en saisit une deuxime, quand il eut tir celleci, une troisime .. . et ainsi de suite, tout au long des nombres ordinaux, de la premire la onzime, puis de cette dernire jusqu la dix-huitime. En ce qui concerne les extensions les plus longues, elles sont de deux sortes: soit elles apparaissent comme des dveloppements forcs et des ornementations du contenu du rcit existant, soit comme des ajouts propres librement conus. Edward Hopkins, Ruling Caste, p. 67, fait les mmes distinctions et compare les premires extensions, les dveloppements, une masse ajoute la locomotive et les secondes, les ajouts, des wagons de marchandise attachs. Dans lintroduction de sa Grammatik, Whitney dit que les amricains font preuve dun heureux ralisme dans leurs comparaisons: all dates given in Indian literary history are pins set up to be bowled down again (toutes les dates de lhistoire de la littrature indienne sont des quilles, mises en place pour tre renverses de nouveau); dans les romans amricains, la taille de lhrone est compare celle dun poney, ses cheveux avec de leau-de-vie de Dantzig, Westermann, Monatshefte, n 42, p. 613. En ce qui concerne les extensions du premier type, deux passages du rcit donnent particulirement lieu des dveloppements importants et des interpolations nombreuses: lexil des P a v a aprs la partie de ds et le droulement de la grande bataille. Peu aprs le dbut de leur exil, les cinq frres convoquent les rois qui leur sont allis une runion et dcident de reconqurir leur royaume perdu par la force. Cette runion des rois du parti de Yudhihira est raconte deux fois, au dbut du troisime et au dbut du cinquime livre. Mais pas plus quHomre, qui nil molitur inepte (qui nentreprend rien sans raison), na racont deux fois dans lOdysse la mme assemble des dieux, comme elle nous est maintenant servie deux fois dans le premier et dans le cinquime livre, son collgue indien na mis fin de faon abrupte au premier conseil des rois pour reprendre le mme conseil aprs plusieurs milliers de strophes, aprs avoir racont dans lintervalle les vnements survenus durant douze ou treize annes. Il est bien plus probable, comme nous lavons dj indiqu, que les bannis naient pas accompli leur douze annes, mais aient bris leur contrat bien avant. Je renvoie ici aux Indischen - 68 -

http://www.utqueant.org Sagen dont lexpos semble avoir raison sur ce point. Car, aprs que lon a parl en dtail des annes dexil, Kara exige, V, 21, 213 = 636, que les cinq frres passent dans la fort le temps convenu avant de pouvoir prsenter de nouvelles exigences, et de mme Duryodhana, V, 55, 1 = 2143, raconte comme une nouveaut que les amis de Yudhihira lont cherch, lui et ses frres, lont trouv non loin dIndraprastha et ont dcid avec lui darracher la souverainet par la force. Ainsi, probablement, ces deux conjurations guerrires nen faisaient quune lorigine; la premire entirement vaine, se spare sans rsultat mme si au dbut elle avait pris un cours si violent, et le rcit sinterrompt brutalement, III, 12, 10 = 470, pour passer ensuite la louange de Ka. Mais pour remplir les douze annes dexil, un grand nombre daventures devaient tre placs dans cet intervalle de temps, de nombreux pisodes interrompus, ou de nouveaux invents et insrs ici, et ainsi naquit le troisime livre, dans lequel dimportants anciens rcits alternent avec de tout nouveaux. Srensen galement, p. 380, 103, tient la plus grosse partie du long livre Vanaparvan pour inauthentique. On dcouvre que les mchants Kaurava, pas encore satisfaits avec les douze annes dexil, ont ajout, aprs la partie de ds, lobligation pour les Pava de passer une treizime anne sans tre reconnus. Pour cette raison, on insra le Viraparvan, qui me semble tre un rcit existant lorigine, dcouvert par le remaniement (par Vysa, pour parler comme les indiens) et incorpor dans la grande pope. Le fait que lon trouve dans les autres livres des allusions parses au contenu du livre de Vira ne parat montrer que celui-ci tait dj connu lors du remaniement puranique: les souffrances de frres dans la ville de Vira, VII, 132, 12 = 5423; VIII, 83, 47 = 4254; IX, 56, 32 = 3160; XII, 16, 21 = 502; la mort de Kcaka, VIII, 50, 22 = 2412; les exploits dArjuna aprs lenlvement des troupeaux par les Kaurava, VII, 128, 44 = 5259; V, 59, 27 = 2354; V, 124, 57 = 4176; VI, 98, 9 = 4456; particulirement sa victoire sur Kara, V, 49, 38 = 1956; VII, 158, 17 = 6986; VIII, 41, 73 = 1947; son vol des vtements, VIII, 79, 63 = 4057; son serment de vengeance, VI, 106, 35 = 4836, etc. Le noyau sur lequel tout cet pisode est bti est indiqu la fin du livre: la conclusion dune alliance entre les Pava et les Matsya dans la ville de Vira, alors que dans le mme temps, daprs V, 166, 9 = 5756, les cinq frres Trigarta se dclaraient pour Duryodhana. Une preuve supplmentaire que le Viraparvan tait dj connu lors du remaniement se trouve dans les modifications et les interpolations qui prparent son contenu: au deuxime livre le prolongement dune anne du bannissement, au troisime, la maldiction dArjuna par Urva et aussi tout lIndralokbhigamana. Le pote du Viraparvan est peut-tre le mme que celui du Harivaa. Dans celui-ci comme dans celui-l, la mme fantaisie, ngligente et arbitraire, sans contenu plus profond, la mme indiffrence envers le contenu de lancienne lgende, la mme manire de dcrire et le mme vocabulaire; que lon compare, par exemple, IV, 12, 29 = 354 avec XIX, Vish., 30, 35 = 4720. - 69 -

http://www.utqueant.org Le rcit de la grande bataille, dont la dure a t fixe dix-huit jours, a t extraordinairement tendu. Pour pouvoir remplir convenablement cette dure, un mme vnement, savoir une scne de bataille, est rpt avec la mme image, encore et encore, aux endroits les plus diffrents. Comment Ka saute bas du char dArjuna et avec son disque se prcipite sur le char de Bhma est racont de la mme manire au troisime jour, VI, 59, 42 = 2549 et au neuvime jour, VI, 106, 33 = 4834, et donc le mme modle est utilis deux fois; de telles rptitions dvoilent toujours un passage authentique. Dans lancienne pope, on trouve de telles similitudes, le champ de bataille inond de sang reprsent comme une rivire; cette image se trouve dans les endroits les plus diffrents du rcit de la bataille; par exemple, VI, 14, 29 = 536; VIII, 49, 82 = 2379; VIII, 52, 30 = 2549; VIII, 77, 39 = 3899; VIII, 79, 1 = 4004; mais aussi auparavant, IV, 63, 17 = 2014; V, 153, 25 = 5212; V, 160, 20 = 5528; et, dans lappendice XIX, Vish., 85, 10 = 8128; XIX, Vish., 105, 60 = 9334; XIX, Bhav., 59, 89 = 13793; XIX, Bhav., 62, 18 = 13944. Ces passages utilisent et dveloppent le court et simple , Homre, Il., 8, 65 comme modle. Et mme la mort du mme hros est plusieurs fois raconte. Et le Pylaimenes dHomre, qui est tu dans le cinquime livre de lIliade et que nous retrouvons en pleine sant dans le treizime, est peu de chose devant Alambua qui, au quatorzime jour, est prcipit terre par son adversaire qui lui brise tous les os comme on fracasse une cruche sur une pierre , VII, 109, 1 = 4097, qui ensuite, le mme jour, combat de nouveau avec un zle intact jusqu ce quune flche lui spare la tte du tronc, VII, 140, 12 = 5828, puis qui passe au dbut de la nuit sur son char tir par des nes et clair par des lampes-tempte, comme si rien ntait arriv, jusqu ce quun ennemi lui coupe la tte avec son pe, VII, 174, 5 = 7848, sur quoi il cesse finalement de se montrer encore. Malgr cela, lpope ne connat quun Alambua, un seul est nomm dans la liste des hros des deux camps, un seul est lou dans les chants funraires, V, 167, 33 = 5802; VII, 150, 23 = 6515; VIII, 5, 46 = 135; XI, 26, 37 = 792. De mme la mort de Ghaotkaca est apparemment raconte deux fois, VII, 156, 185 = 6916; VII, 166, 37 = 7433; VII, 179, 58 = 8172. Mais de telles ngligences, comme celles signales ci-dessus, napparaissent que dans le livre VII; on ne peut donc les comprendre que par le fait quon na pas affaire ici des lecteurs qui consultent louvrage, mais un public variable dauditeurs. Le Droaparvan, comme cela se produit encore aujourdhui Calcutta, tait lu loccasion de grandes ftes, et comme le public se renouvelait partiellement de jour en jour, ces rptitions importaient peu. De plus, la plus grande partie du volumineux septime livre est, et de loin, un ajout plus tardif. Dj mon oncle, A. Holtzmann, Indischen Sagen, 1846, II, intr. p. 7, disait que, daprs lui, que tout le livre de Droa ne devait son existence quau dsir de rendre lpope trs longue, et que tout ce qui est authentique dans ce livre appartient soit au livre de Bhma qui le prcde, soit au livre de Kara qui le suit . Et cette proposition a t vrifie par - 70 -

http://www.utqueant.org toutes les tudes successives du Mahbhrata. Ce livre contient toute une srie de rcits de combats, rdigs suivant le mme modle, et reprenant le mme droulement. Ainsi le combat entre Bhmasena et Kara, de VII, 131, 32 = 5386 VII, 48, 3 = 6390, est rpt huit fois, la victoire revenant naturellement Bhmasena. On trouve le juste rapport des choses, passablement dissimul, en VII, 139, 91 = 5783; bien que Kara aurait pu tuer Bhmasena, il ne voulut pas le faire, cause de la promesse quil avait donne Kunt . Ces scnes de combat construites mcaniquement manquent de posie et celle-ci a t remplace par lexagration, suivant la manire de faire indienne tardive; ce sont souvent de purs rcits de chasse, par exemple VII, 100, 33 = 3758, o Ka conduit si vite que les flches quArjuna tire vers lavant retombent derrire le char. La magie ne manque pas non plus, Alambua et Ghaotkaca (deux rkasa) en donnent tous les exemples possibles, VII, 174, 28 = 7871: ils combattent en se transformant en feu et eau, en vautour et serpent, en montagne et mtorite, en lphant et tigre, et bien dautres choses encore. De son ct, Arjuna, VII, 39, 59 = 3721, fend la terre dune flche et en fait natre en un clin dil un tang avec oiseaux et poissons, ainsi que tout un arsenal darmes. Il ne manque pas non plus dautres fautes de got; en VII, 112, 61 = 4353, apparaissent, en pleine mle, des prtres sacrifiants et des vierges couronnes. La rigueur du texte est moins forte dans le septime livre que dans les autres; on rpond des questions qui nont pas t poses, VII, 115, 1 = 4543; VII, 155, 1 = 6682. Les diffrences entre les versions B et C ne sont dans aucun livre plus grandes quici; where some passages are very smooth in their correspondence, others are much broken by discordance: the anti is an illustration of one, the Droa of the other (l o certains passages concordent de faon trs rgulire, dautres sont dchirs par leur discordance: le anti est un exemple des premiers, le Droa des autres), Hopkins, Am. Soc. Proceedings, Octobre 1888, p. 5. B prsente souvent des ajouts supplmentaires, cf. la sotte remarque que B, VII, 130, 19 ajoute aprs C 5714. La diction et la langue donnent aussi une impression bizarre; mais cela devra tre prouv plus tard, nous ne sommes pas encore assez avancs dans la grammaire du Mahbhrata pour pouvoir prsenter des considrations valables sur les particularits linguistiques des diffrents livres. Mais je peux indiquer des adjectifs drivs de noms propres construits irrgulirement; Ghaotkaca, le fils dHiimb sappelle Haiimba, VII, 181, 25 = 8237, mais plus souvent Haiimbi, VII, 109, 1 = 4097; VII, 156, 94 = 6822. Ladjectif driv de Kubera est soit Kaubera, V, 169, 21 = 5870; IX, 46, 36 = 2654; IX, 47, 25 = 2752, mais aussi Kauberya, VII, 23, 14 = 1041. Le fils de Yudhihira est normalement Yaudhihira, I, 2, 32 = 302, de mme son arme, I, 2, 245 = 520, mais en VII, 108, 9 = 4061, ladjectif patronymique est Yaudhihiri. Les erreurs ne manquent pas non plus dans ce livre; ainsi Rma est un fils de Vsudeva, VII, 11, 31 = 412, nomm parmi ceux qui ont combattu contre Duryodhana aux cts de Ka, alors quil na pris aucune part toute la bataille. Les - 71 -

http://www.utqueant.org frres Vinda et Anuvinda sont tus ici par Arjuna, VII, 99, 17 = 3682, dans les anciens livres, ils ne sont tus que plus tard pat Yuyudhna, VIII, 13, 21 = 507. Les combats avec les conjurs, les Saaptaka, qui ont jur la mort dArjuna, sont raconts en VII, 18, 12 = 743 entre autre; mais ils appartiennent aussi au huitime livre, cf. mon Arjuna, p. 41. Le nom crya, matre, dsigne normalement Droa, mais ici il dsigne aussi Kpa, VII, 169, 23 = 7581. Les images sur les enseignes sont galement trs rcentes, par exemple un autel, VII, 21, 36 = 890. Les extensions, particulirement dans le rcit de la mort de Jayadratha, sont presque insupportables; et les dialogues insrs entre Dhtarra et Sajaya rendent ce livre plus long, mais certainement pas meilleur. Les rcits de bataille sont misrables, le conteur na aucune ide de la situation relle, il raconte en lair. Le Droaparvan, dans son ensemble, est un rajout, qui a t vraisemblablement insr bien aprs le second remaniement. Tout le commandement des armes par Droa nest pas authentique. Aussi longtemps que Bhma est en vie, Kara plein de rancur se tient lcart du combat; Bhma, bless mort, le fait appeler, se rconcilie avec lui, VI, 122, 7 = 5824; VII, 4, 1 115, et place larme sous sa protection et son commandement, VII, 4, 14 = 128; Kara promet quil protgera larme, comme lavait fait Bhma auparavant, quil est dcid vaincre ou mourir, VII, 2, 13 = 64. Lenthousiasme avec lequel les Kaurava acceptent Kara est dcrit de manire trs vivante; les combattants sont persuads davoir trouv en lui un nouveau chef, VII, 5, 2 = 135. Ainsi, la fin du sixime et au dbut du septime livre, tout le dveloppement du rcit repose sur Kara; mais soudain ce nest plus lui le commandant en chef, comme tous les lecteurs sy attendent, mais Droa. Les cinq jours de Droa sont annuler. Dans les autres livres relatant les combats, les rcits de bataille ont galement t visiblement rallongs, lexception du Sauptikaparvan; l au contraire, le rcit a t fortement raccourci, pour passer aussi vite que possible sur la catastrophe qui frappait les Pava. Il fallait, par exemple aprs la mort de Kara, gagner encore un jour de combat; les interpolations sont signales ici par des rptitions frquentes des strophes dintroduction, que lon compare par exemple VIII, 93, 2 = 4835 avec IX, 3, 1 = 126, puis VIII, 93, 16 = 4850 avec IX, 3, 17 = 142; IX, 19, 32 = 1028; et VIII, 93, 51 = 4885 avec IX, 3, 51 = 176. On peut se demander sil sera un jour possible de reconstituer lordre des combats, tels quil tait dans les livres anciens et authentiques; les efforts que jai faits pour dcouvrir lordre et le plan de la bataille dans danciens exposs ont t vains. Sous ce rapport, les ngociations de paix prcdant la bataille qui remplissent lensemble du livre Udyoga, sont encore presque plus dsesprantes; elles ne sont pas seulement abusivement allonges, mais galement dformes pour masquer la situation relle en faveur de Yudhihira. Au lieu de propositions concrtes des ngociateurs, nous trouvons une multitude de gnralits sous forme proverbiale, qui sont parfois trs belles, mais nont aucun

- 72 -

http://www.utqueant.org rapport avec le droulement de laction, quels que soient les efforts de Nlakaha pour en tablir un en forant leurs significations. Les ajouts invents de toutes pices se trouvent en plus grand nombre, comme il est habituel dans les uvres indiennes, la fin de lensemble. Les premiers chapitres du douzime livre contiennent encore des restes prcieux de lancienne pope, des informations sur Kara et Duyodhana qui ont t placs ici aprs avoir t retirs de leur ancienne place. Mais ensuite, et jusqu la fin du livre, stendent une masse de renseignements plus tardifs, dont le contenu et la langue diffrent souvent des premiers livres de faon notable. Le livre nti dans son entier a pour but de faire un dharmastra de lancienne pope; pour donner plus de poids cet enseignement sur le devoir et le salut et lui prter lautorit de lantiquit, il est plac dans la bouche de Bhma, qui pour cela, doit repousser sa mort. Lorsquil a t rattach au remaniement puranique, le ntiparvan avait une tendue plus modeste que maintenant; mais il tait trs facile aux copistes et aux conteurs, lorsquils croyaient dceler une lacune dans lenseignement du devoir et du salut, dinventer une nouvelle question de Yudhihira et une nouvelle rponse de Bhma et de les insrer dans luvre nimporte quel endroit considr comme appropri. Tous ces fragments, qui se prsentent comme des parties du Mahbhrata, nont pas t vraiment retenus dans notre texte. Ainsi, dans le douzime livre, Bhma raconte Yudhihira bien des choses sur uka, le fils de Vysa. Quelquun en a fait un rcit part: une question de Janamejaya, Vaiapyana rapporte un long entretien entre Vysa et uka, et la vaine tentative de Rambh, une Apsaras, de dtourner les deux saints personnages de leurs dvotions. Ce passage se donne pour un extrait du Mahbhrata, mais ny est pas reu, plutt comme un rcit indpendant sous le titre de Vysaukasavda, Aufrecht, cat. Bodl., 228b. Aussi tardif que soit le ntiparvan par rapport aux autres parties de lpope, il est cependant encore plus ancien, de faon significative, que le Anusanaparvan qui le suit et qui nest pas encore reconnu partout comme un livre part. lpoque o les brahmanes sinstallaient Java, ce livre nexistait pas encore comme livre indpendant du Mahbhrata, Weber, Ind. Stud., II, p. 138; et lon place cette poque 500 aprs J.-C.; une valuation trop rcente, cette poque le ntiparvan nexistait pas non plus. De ce dernier, Hopkins, Quotations from Manu, AM; O. Soc., XI, p. 256, dit: being also earlier than the thirteenth, but not so early as the preceding books (plus ancien que le treizime, mais pas autant que les livres prcdents); le mme place le livre des lois de Manu avant lachvement du Mahbhrata: the stra was in great part collated between the time when the bulk of the epic was composed and its final completion (le stra a t collationn en grande partie entre le moment o le plus gros de lpope a t compos et celui de son achvement final), ibid., p. 268. Un bref sous-chapitre du ntiparvan, nomm dnadharman a t rendu plus tard indpendant et largi pour former le treizme - 73 -

http://www.utqueant.org livre. Larrogance des brahmanes et la considration accorde au rituel atteignent ici leur plus haut degr. Le brahmane est digne dtre rvr en tant que tel, indpendamment de sa personnalit; quil soit orn ou sale, quil mange ou quil jene, que ses vtements soient fins ou grossiers, le brahmane est un brahmane , XIII, 152, 14 = 7175. En dehors de lobissance aux brahmanes et de la gnrosit leur gard, le roi a peu de devoirs dont il ne puisse de dbarrasser: si tu veux possder la terre ceinture docans, honore les brahmanes par ton obissance et tes dons; ce nest que par les dons que leur noblesse peut tre amadoue , XIII, 35, 22 = 2163. Dans ces discours interminables et fastidieux des livres nti et Anusana, il nest vraiment question que de rebus omnibus et quibusdam aliis. Il ny a que du patriotisme que lon ne trouve nulle trace; on chercherait en vain le nom de la patrie; la carte des guerriers ne laisse transpirer aucune ide patriotique. La seule expression dun sentiment patriotique est le mpris envers les trangers barbares, mais ce mpris atteint de la mme manire ces frres ariens qui nont pas accept la loi des brahmanes. Dun mal qui concerne tout le pays, lindividu ne doit pas sattrister , XIII, 320, 15 = 12496; Spruch 3245. Les cinq livres suivants, Avamedha, ramavsika, Mausala, Mahprasthnika et Svargrohaika, appartiennent au second remaniement; aprs que Yudhuhira, ses frres et Ka ont survcu la grande bataille, leurs actions et leur mort doit l aussi tre raconte. Mais l encore, des parties plus anciennes ont t dplaces et insres, comme lAnugt. Au second remaniement, ou remaniement puranique, jattribuerais aussi laccueil du Harivaa. Cette uvre semble avoir dj exist avant dtre rattache au Mahbhrata. Ballla, un crivain vivant vers 1600, le cite, Aufrecht, Cat. Bodl., 130b; Mallintha, le commentateur du Raghuvaa, vers ou aprs 1400, le connat galement, ibid., 112a; du temps des arabes, Albrni, vers 1050, lui accorde une grande autorit, Lassen, III, p. 850; et daprs Weber L.G. 206, Ind. Stfn., I, p. 380, Sur le Rmyaa , 41, il est attribu Subandhu, le compilateur du Vsuvadatta, qui serait dater entre 600 et 700. En tout cas, il navait rien voir au dbut avec le Mahbhrata. Ksna ne sy montre pas comme un noble, comme les hros de lpope, mais comme un joyeux berger. Obir et tudier, telle est lducation des jeunes Pava et des jeunes Kurava; les rcits de la jeunesse de Ka nous parlent despiglerie, de vagabondage, damourettes; le jeune dieu ne pense qu son plaisir. Il doit tre prsent comme un modle de vertu, mais livrognerie et la dbauche sexuelle sont reproches son peuple et particulirement son frre Rma dabord, ensuite lui-mme. Des milliers de courtisanes (vey, krr, gaik) se sont installes Dvravat, est-il rapport en XIX, Vish., 88, 8 = 8308; on remarque ce sujet que le sage Ka a favoris ces abus de sorte quaucune jalousie ne naisse entre ses guerriers. Le Ka du Harivaa nest pas celui du Mahbhrata; ce dernier nest pas un guerrier, mais le premier en est un; dans une allusion - 74 -

http://www.utqueant.org occasionnelle au rcit du Mahbhrata, XIX, Vish., 102, 17 = 9149, il a vaincu au combat Kpa, Droa, Avatthman, Kara et Bhma: une affirmation que lon ne retrouve nulle part dans les dix-huit livres de lpope elle-mme. De plus, Ka est orthodoxe dans lpope, dans le Harivaa il montre une propension douteuse pour les cultes de la nature, il blme le culte dIndra et recommande de prier les montagnes, les forts et les vaches; Wilson, V. P., IV, p. 313, voit dans ces traits une preuve de lorigine mridionale du Harivaa; il viendrait du Deccan o le couronnement et ladoration des vaches fait encore partie des murs. V, p. 54, note 1, reprend aussi le mme point de vue. Peut-tre faut-il placer dans le sud de lInde lensemble du remaniement puranique du Mahbhrata, avec ladoption du Harivaa et lacceptation du culte de iva. L, la culture et la littrature ont t protges des fureurs des mahomtans, pour revenir ensuite modifie de bien des manires par-dessus le Vindhya. A. Weber parle de lInde du sud comme le sige de la nouvelle littrature, Ind. Streifen, III, p. 351; cf. Richard Simon, Vedische Schulen, 1889, p. 10. Le Harivaa a peu de valeur historique; Wilson le dsigne comme a careless and ignorant compilation (une compilation ignorante et peu soigne), III, p. 239, of no weight whatever as an authority for the dynasties of kings (daucun poids en tant quautorit pour les dynasties royales); lauteur y laisse le champ libre sa propre fantaisie; cette uvre serait un peu plus jeune et de moindre valeur que le Vipura, I, intr. p. 110, Hall sur IV, 139. Les manuscrits sont peu diffrents, dit Burnell, Class. Ind., p. 76; et donc, ajoute-t-il, luvre est moderne. Cela ne correspond pas avec les informations donnes ci-dessus par Weber, daprs lesquelles le Harivaa devrait dj avoir t connu entre 600 et 700. Il et certain que luvre ne donne pas une impression danciennet. De plus la correspondance des manuscrits nest pas si complte. Des passages qui se trouvent en B et C manquent dans les manuscrits utiliss par Langlois. Ces ajouts sont pour la plupart shivates. Bien que le Harivaa soit consacr entirement la glorification de Viu, il a aussi scrupuleusement pris la peine, probablement aprs son adoption dans le Mahbhrata, de donner aussi sa place iva. Ainsi Pradyumna, avant son combat avec ambara, se tourne-t-il vers Durg, qui transforme la massue de ambara en une fleur de lotus qui tombe autour du cou de Pradyumna, XIX, Vish., 107, 20 = 9437; de mme Aniruddha est-il libr de ses chanes par Durg, XIX, Vish., 120, 35 = 10264.

11.

Aprs lachvement du second remaniement, le remaniement puranique, des

ajouts supplmentaires ont t incorpors sans hsitation lpope; les volumineux livres Droa et Anusana me semblent tre de ceux-ci. Mais il fallait bien cependant que les remaniements continuels et lallongement de lpope trouvent une fin; et - 75 -

http://www.utqueant.org mme si, selon les apparences, des ajouts mineurs ont t possibles jusqu notre poque, et ont t accepts, les ditions actuelles et les manuscrits du Mahbhrata ne montrent plus, dans leur ensemble, en ce qui concerne lordre et le volume de luvre, aucune diffrence significative. Cela ne veut naturellement pas dire que pour ltablissement du texte dans ses particularits, une comparaison des variae lectiones soit inutile; les deux manuscrits parisiens en criture bengalie par exemple aident remettre sur pied bien des passages qui navaient aucun sens dans les ditions imprimes. De plus, il faut souligner que le Mahbhrata, en Inde du nord au moins, est parvenu une stabilit certaine des textes dans leur ensemble. Comment une rdaction tellement bien arrte a-t-elle t possible dans un pays qui ne connaissait pas dtat unifi, sous la direction dune caste qui navait jamais pu adopter une rgle unique, cela est un mystre des brahmanes indiens. Et nous rencontrons aussi dans dautres domaines de la littrature indienne, par exemple partiellement dans les Veda et dans la grammaire, ce fait remarquable quune seule cole perce, les autres disparaissent sans laisser de traces. Les brahmanes devaient avoir trouv le moyen de se mettre daccord pour fixer dfinitivement leur littrature et mettre en uvre leurs dcisions. Car, part la recension du sud de lInde, qui est pratiquement inconnue chez nous en Europe, nous ne connaissons quun texte du Mahbhrata, exactement fix. Et la tendance de cette rdaction brahmanique bien arrte est nettement reconnaissable: elle est apaisante et conciliante. Elle donne raison aux shivates comme aux vishnoutes, elle explique les systmes philosophiques comme conduisant dans lensemble au mme but et nomme sage celui qui les a reconnu identiques daprs leur vraie signification. Ainsi, en XII, 305, 19 = 11347 il est dit clairement que celui qui voit vraiment lunit du Yoga et du Sakhya est un sage; du reste toute la section en question a pour but dtablir une entente entre les diffrentes sectes philosophiques. De mme, en VI, 29, 4 = 1039, nous trouvons que seuls les fous font une diffrence entre Sakhya et Yoga. Mais plus important encore que la conciliation entre les diffrentes coles philosophiques est naturellement le compromis entre les diffrentes religions, qui se rattachent aux noms de Brahman, Viu et iva. Le sentiment pacifique qui traverse sous ce rapport toute la rdaction actuelle de lpope amne penser quelle est placer une poque o les querelles trs vives entre les brahmanes orthodoxes taient reconnues comme inadmissibles et dangereuses en face dun ennemi intrieur ou extrieur devant lequel le sentiment national indien devait rassembler toutes ses forces. Si la rdaction dfinitive du Mahbhrata est luvre de Nlakaha, elle serait placer lpoque des royaumes mahomtans et il faudrait rechercher si on trouve dans le Mahbhrata des passages qui pourraient tre dplacs si loin. Le seul point qui pourrait peut-tre tre ramen une domination mahomtane trangre, ce sont les plaintes amres sur la domination des barbares, que lon trouve dans les parties tardives de lpope sous forme de prophties. Une priode terrible est dcrite, o - 76 -

http://www.utqueant.org toute la terre est possde par les barbares de louest, les Y a v a n a ou tout simplement les Barbares, les Mleccha, III, 188, 34 = 12838. On dsigne par Yavana, aussi bien les grecs qui habitent louest de lInde que, plus tard, les arabes; aujourdhui encore, les arabes installs sur la cte de Malabar sappellent Yonaka, Graul, III, p. 233; ces noms imprcis, plusieurs sens, ne dcident rien. Les Barbares mprisent et dnigrent les anciens textes, les Veda sont asservis, partout rgne lincroyance. Les diffrences entre les castes disparaissent, le monde devient dune seule couleur (ekavara, III, 190, 42 = 13050), cest dire sans castes, chaque caste pratique les activits des autres, III, 190, 17 = 13025, les brahmanes sautorisent toute les nourritures et les dra prononcent les formules sacres, III, 188, 33 = 12837, les premiers accomplissent des basses uvres, les derniers ont le front denseigner. Les brahmanes sont pourchasss, mais les hommes qui ne se plient pas la loi vivent heureux et longtemps, III, 188, 55 = 12860. Les rois deviennent des voleurs, les guerriers insolents dpouillent leurs sujets en pleurs de leurs femmes et de leurs biens, III, 190, 35 = 13043, on ne sacrifie plus aux dieux, au lieu de temples aux dieux, la terre est remplie dossuaires, les Mleccha, dont la terre est pleine, y prient. Le mot eka, ossuaire, III, 190, 67 = 13074 dsigne des temples-reliquaires bouddhiques, Lassen, I, p. 589; la traduction de Pratpa Rya, Vana, 576, donne: the earth will be defigured with tombs and walls containing bony relics (la terre sera dfigure par des tombes et des murs contenant des os et des reliques). Mais celui qui voudrait voir les eka comme des temples contenant les reliques de saints musulmans pourrait sappuyer sur le fait que les hrtiques, dont la domination est prophtise ici, cest dire constate, et les rois Mleccha, doivent tre renvoys une poque postrieure ce Kalkin que lon attend encore, tandis que lexpulsion des bouddhistes hors de lInde est un fait historique achev. Enfin, ce texte conclut que Kalkin, une incarnation de Viu, apparatra, anantira les trangers et rendra la terre aux brahmanes; ensuite le droit se renforcera, et le non-droit disparatra, III, 190, 93 = 13101. Les indiens attendent encore maintenant ce Kalkin. Le nom de nstika, incroyant, III, 190, 22; 28 = 13030; 13037, ne nous mne pas non plus plus avant; il dsigne souvent le B u d d h a , mais pas toujours. Ce tableau montre visiblement une domination des incroyants qui dure dj depuis longtemps et est douloureusement supporte; il est cependant possible que le brahmanisme rfugi au del du Vindhya veuille dpeindre ici ladministration de lIslam en Inde du nord. Il faudrait donc placer la dernire rdaction complte, qui a accept aussi des ajouts postrieurs, deux sicles ou plus aprs lan 1000. Mais un rapport quelconque avec lIslam dans le Mahbhrata, ici et ailleurs, est encore tablir. Le tableau des temps les plus noirs dans le Harivaa prsente quelques allusions au bouddhisme, et nomme mme kyabuddha, XIX, Bhav., 3, 15 = 11142.

- 77 -

http://www.utqueant.org

12.

Par consquent, nous faisons commencer la quatrime priode de lhistoire du

Mahbhrata avec le second remaniement de lpope environ entre 900 et 1100 aprs J.-C. car la rdaction dfinitive et lachvement de lpope suivaient quelques sicles plus tard. Depuis lors, des textes dun volume important ne furent plus insrs. Ce nest pas sans une irritation justifie contre les brahmanes que nous reposons notre pope, Ils ont transform lancien rcit pique, le plus beau trsor littraire de leur peuple, en un Pura ennuyeux qui ne prche que ladoration de Viu, le respect des brahmanes et des cultes dpourvus desprit. On a dans lhistoire de lEspagne un exemple de ce que peut faire lidologie monastique tout un peuple dont elle stait empare; on pourrait recommander ltude du Mahbhrata qui voudrait voir comment le mme principe sapplique la posie. Mais nous ne devons pas oublier que les brahmanes ont rempli de faon remarquable, pendant des sicles, leur tche de chefs et de pres dun grand peuple et quils ont maintenu un haut degr chez celui-ci le srieux des murs, la justice et la vracit, au point dveiller chez les grecs, et plus tard chez les chinois, ladmiration la plus vive. Placs la tte de la nation, ils se sont contents de la prdominance spirituelle, laissant la deuxime caste le pouvoir et la force, la troisime la richesse et le bien-tre. Leur vie, remplie dobservances pnibles, tait peu enviable, tel point quune fois dans notre pope, XIII, 152, 8 = 7169, le brahmane est compar une vache maigre qui doit porter tous les jours en haut dune montagne abrupte le mme fardeau pesant. Martin Haug, Brahma und die Brahmanen, p. 25, fait remarquer quils nont jamais investi ou dpos des rois arrogants et jamais laiss une hirarchie se dvelopper sous eux. Ils ont extraordinairement uvr pour la science, et nont jamais ddaign dapprendre de peuples trangers, par exemple des grecs. Le dclin du brahmanisme remonte lpoque o ils navaient plus dennemis craindre; aprs lexpulsion des bouddhistes, ils furent la proie dune arrogance sans limites que mme loccupation trangre ne russit pas attnuer. En ce qui concerne le Mahbhrata, nous devons au moins leur tre reconnaissants davoir vit la perte de lpope et de ne lavoir pas compltement dfigure, ce quaucun pouvoir naurait pu viter. Car, malgr tout le despotisme des brahmanes, beaucoup dor pur a t sauv, trop du moins pour que lon doive abandonner la tentative de rtablir les traits principaux de lancienne lgende hroque. Le Mahbhrata est comme une montagne qui cache sous des scories sans valeur de vritables joyaux, ou bien comme un palimpseste maintes fois rcrit qui laisse apercevoir encore clairement lancien et prcieux manuscrit. Durant de nombreux sicles, lhistoire du Mahbhrata, la plus volumineuse de toutes les uvres potiques, a accompagn lhistoire du dveloppement du peuple indien. Une premire priode de construction graduelle, est suivie par une seconde de fixation artistique, par une troisime et une quatrime de remaniement partisan, puis par une solidification dfinitive. Puissions-nous bientt - 78 -

http://www.utqueant.org jouir dune cinquime priode, celle de lexplication et de la critique du Mahbhrata avec les moyens et les mthodes de la philologie occidentale, celle de la reconstruction de lancienne pope sur la base des passages authentiques de lpope actuelle. Puisse le temps tre derrire nous, o il tait permis de dire: ltude du Mahbhrata est encore dans son enfance !

- 79 -