GENES, GENOMAS Y TÉCNICAS DE INGENIERÍA GENÉTICA...

... CON UN TOQUE DE BIOINFORMÁTICA

CÓDIGO GENÉTICO
DNA Doble Hélice 5'ATG CTT CCT CGG TGC TAC TGT GAA TAA 3' 3'TAC GAA GGA GCC ACG ATG ACA CTT ATT 5'
Hebra codificadora Hebra no codificadora

Retrotranscripción mRNA

TRANSCRIPCIÓN 5'AUG CUU CCU CGG UGC UAC UGU GAA UAA 3' TRADUCCIÓN

Proteína

(NH2)MET-LEU-PRO-ARG-CIS-TIR-CIS-GLU-FIN(COOH)‫‏‬

GENES
Un gen es la unidad básica de herencia de los seres vivos. Un gen es una secuencia lineal de nucleótidos en la molécula de ADN (o ARN en el caso de algunos virus), que contiene la información necesaria para la síntesis de una macromolécula con función celular específica. Por ejemplo: Proteínas, ARNm, ARN ribosómico, ARN de transferencia y ARN pequeños.

GEN PROCARIOTA

mRNA POLICISTRÓNICOS .

.

GEN EUCARIOTA .

.

.

EUCARIOTAS CROMOSOMA MITOCONDRIAS CLOROPLASTOS .GENOMAS El genoma es todo el material genético contenido en las células de un organismo en particular.

GENOMA HUMANO 3200 MB .

5 x 1011 .Organismo Tamaño Genoma(pares de bases)‫‏‬ Fago‫‏‬λ‫‏‬ 5×104 Escherichia coli 4×106 Levadura 2×107 Caenorhabditis elegans 8×107 Drosophila melanogaster 2×108 Humano 3×109 Amphibians 109–1011 Psilotum nudum 2.

.C-value enigma ó C-value paradox El C-value enigma ó C-value paradox es un término usado para describir la variación en los tamaños de genomas nucleares entre las especies eucariotas. El objeto de estudio del C-value enigma es la observación de que el tamaño del genome no se correlaciona con la complejidad del organismo.

ebi. http://www. Especificaciones del formato Genbank.EJERCICIO    Hacer un programa que a partir del archivo MTtabaco.html Especificaciones del formato Fasta.ac.gbk que contiene el genoma mitocondrial de tabaco extraer el gen que pida el usuario con 1000nts upstream y 1000nts downstream y guardarlo en formato fasta. http://www.uk/embl/Documentation/FT_d efinitions/feature_table.org/wiki/FASTA_sequence_f ormat .bioperl.

TITLE Direct Submission JOURNAL Submitted (04-APR-2003) Yasuo Sugiyama.A. Aichi 464-8602. core eudicotyledons.1 GI:56806513 KEYWORDS . Genet.LOCUS BA000042 430597 bp DNA circular PLN 02-MAY-2006 DEFINITION Nicotiana tabacum mitochondrial DNA.M. Nagase. Embryophyta. Solanaceae.. Genomics 272 (6).. eudicotyledons. Streptophyta. Makita. Furo-cho. Chikusa-ku.S. asterids. Magnoliophyta.ac. Nagoya.nagoya-u. Watase. Center for Gene Research. and Sugiura. Japan (E-mail:ysugiya@gene. Tel:81-52-789-5943. Spermatophyta.Y. Nicotianeae.Y. and Nagase. Watase..jp. Tracheophyta. SOURCE mitochondrion Nicotiana tabacum (common tobacco)‫‏‬ ORGANISM Nicotiana tabacum Eukaryota. TITLE The complete nucleotide sequence and multipartite organization of the tobacco mitochondrial genome: comparative analysis of mitochondrial genomes in higher plants JOURNAL Mol. Nicotianoideae. Fax:81-52-789-4526)‫‏‬ FEATURES Location/Qualifiers .N. 603-615 (2005)‫‏‬ PUBMED 15583938 REFERENCE 2 (bases 1 to 430597)‫‏‬ AUTHORS Sugiyama.Y. ACCESSION BA000042 AP006340 AP006341 VERSION BA000042. Hirai.M. Nagoya University.Y. Yagura. complete genome.M. Nicotiana... REFERENCE 1 AUTHORS Sugiyama. lamiids. Solanales. Viridiplantae..

/db_xref="GI:56806523" /translation="MDLYSIRNQRISPQKREEFPLLSFCSARAWHSLLAERHTEKKKR LPYLSNSSYSYSFLVVVPILVFFFLAFLGPSVFRTVRLATMNEYYVNRVSCSLSCALN TKLGQRCEGL" gene complement(24579.25766)‫‏‬ /gene="atp6" Formato Genbank CDS complement(24579...25766)‫‏‬ /gene="atp6" /note="CDS is reported in Acc# X06595" /codon_start=1 /product="ATP synthase F0 subunit 6" /protein_id="BAD83425.1" /db_xref="GI:56806524" /translation="MFRRIFLFDEDSLNSSVTSYTNASQSTTTIMDYSLKSSDTQGSS SGIFTDHPGLNPCSERIVELQYDIRLKLGALMPKESAQKVLEASEALHGESNNIAFLE YLLEDLQQNGVGGEAYKDAVDLSKDLVSSPLEQFEIISLIPMKIGNLYFSFTNPSLFM LLTLSLVLLLVYFVTKKGGGNSVPNAWQSLVELIYDFVLNPVNEQIGGLSGNVKQKFS PRISVTFTFSLFCNPQGMIPYSFTVTSHFLITLGLSFSIFIGITIVGFQKNGLHFLSF LLPAGVPLPLAPFLVLLELIPYCFRALSSGIRLFANMMAGHSSVKILSGFAWTMLCMN DLLYFIGDLGPLFIVLALTGLELGVAISQAHVSTILICIYLNDAINLHQSASFFIIEQ KRV" gene complement(31411.31743)‫‏‬ ..

subtilis dnaE gene encoding DNA primase.ORIGIN 1 attcacagtg ctcttcgcaa tctcgatcct cgcaatgctc tgcaacccga gggtgagcgc 61 cattgaagga ctggaagcaa gcttcacacc ttccacaacg gcaactacac cgtcgactcc 121 acaagaactc caagaacact cgttcttctc tcacacagca ctcctccctc cgatcttgtc 181 ccatctcggc ttccacgcgc gtgtcgcccc tatatgctgt caccgactag gctcggacgg 241 tggaggaagc tggtagcatt aggagaattt tcagcacttt tataacacag agtcagcgcg 301 aagaaaggca gatccatact agatcaacgg ttttcctttc tcttacgaga ttttcatttc 361 tagttagagg agcagaccac tctaacttac tttagaacaa tgagaaatgt aacactcacc 421 aactgaagaa cgaatgtgag ctcgggagga aatgtgcctc tccaactcgt actttgctac 481 aacgatcttt gtatgtacgg gtatcgataa tggaagagac tagatcaaat agggcaattc 541 gtaatgctct cttcctgtcc tagaataaga aagtagcttg tctgccgtac tggctgcttc 601 attgaatgtg tcgatctgca ttctatataa ggagttgatt tgcatccttg tctggcagtt 661 agctaagcga gaagctgtga tcgaggaagc cccgcccagt agtgcctcta ctctactagt 721 cctagtacta gatactagat agacaggccg gtcaccggtg gcataagatc cttctctgct 781 tgtctaactc aagccagata gcagcaatca ctcgaaatag tcatatgcgg aacacatgca 841 agtccagatt gaaagataag gaaggcaagt caaagcggaa agaaa Formato Fasta >gi|142864|gb|M10040.1|BACDNAE B. complete cds GTACGACGGAGTGTTATAAGATGGGAAATCGGATACCAGATGAAATTGTGGATCAGGTGCAAAAGTCGGC AGATATCGTTGAAGTCATAGGTGATTATGTTCAATTAAAGAAGCAAGGCCGAAACTACTTTGGACTCTGT CCTTTTCATGGAGAAAGCACACCTTCGTTTTCCGTATCGCCCGACAAACAGATTTTTCATTGCTTTGGCT GCGGAGCGGGCGGCAATGTTTTCTCTTTTTTAAGGCAGATGGAAGGCTATTCTTTTGCCGAGTCGGTTTC TCACCTTGCTGACAAATACCAAATTGATTTTCCAGATGATATAACAGTCCATTCCGGAGCCCGGCCAGAG TCTTCTGGAGAACAAAAAATGGCTGAGGCACATGAGCTCCTGAAGAAATTTTACCATCATTTGTTAATAA ATACAAAAGAAGGTCAAGAGGCACTGGATTATCTGCTTTCTAGGGGCTTTACGAAAGAGCTGATTAATGA ATTTCAGATTGGCTATGCTCTTGATTCTTGGGACTTTATCACGAAATTCCTTGTAAAGAGGGGATTTAGT GAGGCGCAAATGGAAAAAGCGGGTCTCCTGATCAGACGCGAAGACGGAAGCGGATATTTCGACCGCTTCA GAAACCGTGTCATGTTTCCGATCCATGATCATCACGGGGCTGTTGTTGCTTTCTCAGGCAGGGCTCTTGG .

Clonado molecular del ADN.Hibridación de ácidos nucléicos.PCR. . reacción en cadena de la polimerasa. . Vectores de clonado. Southern blot.Clivado del ADN en sitios específicos por enzimas de restricción. hibridación in situ y Western blot. .TECNOLOGÍA DEL ADN RECOMBINANTE Las técnicas más importantes: . Northern blot. .

.Permiten realizar cortes en sitios específicos en el ADN. que permiten aislar y manipular genes individuales. .Son endonucleasas (cortan enlaces internos de la molécula) de origen bacteriano.Reconocen secuencias específicas de ADN de diferente longitud. . .MANIPULACIÓN DEL ADN IN VITRO ENZIMAS DE RESTRICCIÓN .Luego del reconocimiento realizan el corte.

.

.

ENZIMAS DE RESTRICCIÓN .Existen alrededor de 4000 enzimas de restricción conocidas.html .neb. .Hay bases de datos de enzimas de restricción y sus sitios de reconocimiento y corte: REBASE http://rebase. .com/rebase/rebase.671 disponibles comercialmente.

IUPAC.CommOnly.Seq\ (secuencia.RESTRICCIÓN EN 2 PASOS from Bio import Restriction from Bio import Seq from Bio.unambiguous_dna))‫‏‬ an.Alphabet import IUPAC an=Restriction.Analysis(Restriction.print_as ("map")‫‏‬ Resultado (output): 7 TspEI Sse9I Tsp509I FokI | | 12 HpyCH4V CviRI | | | | 20 BstF5I BseGI | | | ATGGGTAATTGCAACGGGGCATCCAAG ||||||||||||||||||||||||||| TACCCATTAACGTTGCCCCGTAGGTTC 1 27 . Seq.

.

. C-G).A T C T C C C G A T T G C A T -3' .A T CT C C C G A T T G C A T -3' 5'.HIBRIDACIÓN DE ACIDOS NUCLÉICOS . .A T G C T A G A G G G C T A A C G T A C T A G -3' 5'.El apareamiento de las bases (A-T y C-G) para formar una doble hélice se llama hibridación. T0. etc). concentración de sales.A T G C T A G A G G G C T A A C G T A C T A G -3' 5'. 5'.El fenómeno de hibridación ocurre bajo condiciones especiales en solución (pH.La hibridación permite la formación de complejos DNA:DNA y ADN:ARN usando la complementariedad de bases (A-T. dado que puede utilizarse para formar ADN híbrido compuesto por cadenas de diferentes orígenes.

TÉCNICAS BÁSICAS DNA Cortado por enzimas de restricción RNA PROTEÍNA ELECTROFORESIS TRANSFERENCIA Tranferencia de proteínas. Detección de Proteínas con anticuerpos marcados. RNA o DNA separados por electroforesis a membranas sintéticas. REVELADO RESULTADOS Southern blot Northern blot Western blot . Revelado por radioautografía. Hibridación del DNA o RNA con secuencias marcadas con radiactivo (“sondas”).

HIBRIDACIÓN IN SITU .

CLONADO MOLECULAR Introducción en una célula húesped de una mólecula de ADN capaz de replicarse en paralelo con el genoma del húesped en estado episomal. es decir sin integrarse al genoma. .

VECTORES DE CLONADO BACTERIÓFAGO‫‏‬O‫“‏‬FAGO” PLÁSMIDOS .

.

PCR .

TM temperature melting DNApol de bacterias termofilas Diseño de primers 15-30 nts .

MUESTRAS .

USOS DE LA PCR Huella genética Test de Paternidad Diagnóstico de enfermedades hereditarias Clonación de genes Mutagénesis Análisis de ADN fósil Genotipado de mutaciones específicas Identificación de especies .

SECUENCIACION A partir de 1970 fue posible determinar secuencia nucleotídica de fragmentos de DNA Métodos clásicos: químico y enzimático Método químico de Maxam y Gilbert Pero en la actualidad los métodos de secuenciación utilizados se basan en el Método enzimático de Sanger .

.

.

.

Automatización completa de todo el proceso.Ventajas .Pirosecuenciación . por lo que pueden leerse del orden de 450 nucleótidos en el plazo de 1 hora. .Empleando microarray . no siendo necesaria siquiera la presencia de un técnico que cargue las muestras.Rapidez en el análisis de cada muestra: dado el pequeño diámetro de los capilares. Otros métodos de secuenciación automática: .

Lectura de unas 100 millones de bases por corrida del instrumento (7.5 horas). .

aol. http://www. Virginia González .nih.com/BearFlag45/Biology1A/LectureNotes/LNPics/Recomb/pcr.genomesonline.jpg www.gov/books http://www.clc.biopython.htm Lic.com/images/biol_02_img0140. 1998.org/gold_statistics.gbiosciences. http://www.jpg http://www.htm http://members. Goméz y Alonso. Universidad Nacional de Quilmes.biologyreference.com/Image/BE307.ncbi.Referencias Molecular Biology of The Cell.edu/fankhauser/Labs/Genetics/PCR/PCR_Protocol.uc.org http://biology.gif Introducción a la Oncología Molecular.nlm.