Vous êtes sur la page 1sur 44

Travail ralis au LEM lInstitut de Biologie Structurale Grenoble Prsent par:

Elodie Crublet
sous la responsabilit de: Hugues Lortat-Jacob Romain Vivs

LES HPARANES SULFATE

Chane dhparane sulfate (HS)

Core protique

1 unit = 7.2 m
Stevens et al. Am J Physiol Lung Cell Mol Physiol, in press (may 2007)

Marquage fluorescent des HS la surface dun tapis de 10 cellules endothliales de poumon (*)

6-O-SO3O HO COOO OH O HO 3-O-SO3OH O Ac-N O N-SO3-

n n = 20 100 [acide hexuronique (GlucA ou IdoA) et N-actyl glucosamine] n

2-O-SO3-

48 disaccharides diffrents
48 = 2304 : ttrasaccharides 483 > 105 : hexasaccharides 484 > 5.106 : octasaccharides 485 > 2.108 : dcasaccharides 486 > 1010 : dodcasaccharides...

Grande htrognit et diversit structurale considrable

domaine NA

domaine NS

COOO HO OH O O HO

6-O-SO3OH O Ac-N O COOO HO OH O O HO 3-O-SO3OH O

Ac-N O

2-O-SO3-

N-SO3-

Rgions N-Actyles, peu sulfates

Rgions N-Sulfates hautement sulfates

Facteurs de croissance Cytokines Chimiokines Molcules dadhsion Protines de la matrice Enzymes

Prolifration
Diffrenciation Migration Adhsion Cohsion tissulaire Voies mtaboliques Coagulation Infection ...

Inhibiteurs denzymes
Agents pathognes ...

HSPG

Des bactries Des parasites De nombreux virus

HSPG

FMDV, HIV, Ad-2, Ad-5, AAV Human

Adenovirus 2 et 5 Adeno-associated virus Cytomegalovirus Flavivirus (Dengue, Yellow fever, Hepatitis C) Foot-and-mouth disease virus INFECTION EN CIS INFECTION DIRECTE Herpes simplex virus I et III
HSV-1 immunodeficiency virus (VIH)

Papilloma virus Cellule Pseudorabies virus cible virus Respiratory syncytical Sindbis virus Vaccine virus HSPG

INFECTION EN TRANS
HIV

LE VIRUS DE LIMMUNODFICIENCE HUMAINE

Dfinition
Agent responsable: le VIH Attaque du systme immunitaire Lymphocytes T Monocytes Donnes pidmiologiques Macrophages

Prvalence chez ladulte Europe occidentale 0,3%

Afrique subsaharienne Zimbabwe Swaziland


33,2 millions de personnes sropositives (2007 - ONUSIDA)

5% 20,9% 33,4%

gp41

gp120 Corcepteurs et tropisme viral

CCR5 Virus R5
Monocytes Macrophages

CXCR4

CD4
CD4i Virus X4
Lymphocytes T

Virus R5X4

Corcepteur
Cellule

Source: Boehringer Ingelheim

Domaine interne

Domaine externe

Stephen Harrison http://www.childrenshospital.org


binding to the CD4 receptor

Feuillet intermdiaire
Kwong et al., Nature, 1998 Structure de gp120 en complexe avec un fragment de CD4 et de 17b

LE RLE DES HPARANES SULFATE DANS LINFECTION PAR LE VIH

HS Macrophages Lymphocyte T CD4+ Cellules pithliales/endothliales


cellule CD4+

CD4 + +++

+++ (?) +

(?)

+++

Trans infection

Barrire hmatoencphalique

Cis infection
Saphire et al., J. Virol., 2001

cellule CD4- (pithliale)

Transcytose
Argyris et al., J. Virol., 2003 Bobardt et al., Immunity, 2003 Bobardt et al., J. Virol., 2004

Fin des annes 80: lhparine inhibe le VIH, in vitro


Baba et al., Antimicrob Agents Chemother, 1988

DEPUIS : composs polyanioniques tests pour inhiber le VIH Seuls les virus X4 fixent lhparine
Lortat-Jacob et al., Virologie, 2005 Vivs et al., J. Biol. Chem, 2005 Moulard et al., J. Virol., 2000

rsultats mitigs

virus X4 (MN)
800 700 600 500 400 300 200 100 Virus 0 -100 0
800 700 600 500 400 300 200 100 0 -100

virus R5 (JRFL)
Response (RU)

Response (RU)

gp120 interagit avec les HS via sa boucle V3

R5
200

Boucle V3 basique (< +5)


Hparine

Hparine

Virus X4

400

600

800

200

400

600

800

Boucle Time (s)

V3 trs basique (+7 +10) Time (s)


Moulard et al., J. Virol., 2000

Expriences de destruction des HS cellulaires


Roderiquez et al., J. Virol., 1995

Rponse (RU)

600 500 400 300 200 100 0 0 500 1000 1500

100 80

Boucle V3

X4

60 gp120 gp120 + CD4 40 gp120 20 Vivs Moulard et al., et J.al., Biol. J. Virol., Chem,2000 2005 0 0 500 1000 1500

100 80

Temps (s)

R5

gp120/CD4 Lys 432 gp120


0 500 1000 1500

60

Lys 121
40 20

CD4i, site de fixation aux corcepteurs

Arg 419
0

Lys 421

Temps (s)

HS

CD4i

Les HS pourraient inhiber linteraction gp120/corcepteur

Approfondir les connaissances sur linteraction gp120/HS Confirmer le rle de CD4i dans linteraction et dterminer les rsidus impliqus

Production et purification de gp120 et de ses formes mutes

Caractrisation fonctionnelle de gp120


BIAcore Tests cellulaires (chimiotaxie)

Dveloppement et optimisation dune mthode didentification des domaines protiques dinteraction avec lhparine
Principe Exemple de rsultats: la chimiokine RANTES Optimisation: limination du support solide Application gp120

Etude du site CD4i de gp120 par mutagnse dirige

Cellules dinsectes
Cellules S2 de drosophiles

Technologie Baculovirus

Optimisations

Squence signal

Type cellulaire

st

0h

24h 48h 72h 96h

24h

48h 72h 96h 120h

130 100 melittine 72 55

Sf9

110

egt

130 100 72

Sf21 HF

110

110

Production en mini fermenteur (1L) infection de cellules Sf21 pendant 72h 25 30 mg/L

mAU

Echangeuse dions

SP spharose

mAU mAU 350 200 600 300 250 150 200 150 400 100 100 50

Affinit

Lentil lectine

0 50 200

65

70

75

80

85

mL

0 0

10

15

20

mL

10

20

30

40

50

60

mL

Exclusion

Superdex 200

180 130 100 72

17 18 19 180 180 130 130 100 100 72 72

Superdex 200
55 55 43 43 34

10 12 14 16 18 20 22 24 20 21 11 22 12 23 13 2414 25 28 10 15 26 16 27 7 18

29 30

55 43

Rendements

1 2 mg de protine purifie/L

Production et purification de gp120 et de ses formes mutes

Caractrisation fonctionnelle de gp120


BIAcore Tests cellulaires (chimiotaxie)

Dveloppement et optimisation dune mthode didentification des domaines protiques dinteraction avec lhparine

Etude du site CD4i de gp120 par mutagnse dirige

BIAcore

eq
(RU)
300 200 100 0 0 200 400 600 Response

ass
Time (S)

diss

CD4
300 250 Rponse (RU) 200 150 100

Y
gp120
900

17b

17b: anticorps anti-CD4i


200 nM
Rponse (RU)
800 700 600 500 400 300 200 100 0 0 100 200 300 400
gp120 wt 50nM gp120 wt/CD4 50/50nM

gp120+CD4

100 nM 50 nM

50 0 0 100 200 300 400 Temps (s)

CD4

gp120 17b
Temps (s)

Kd: 8 nM

gp120 interagit avec CD4. Cette interaction induit lexposition du site de fixation aux corcepteurs (CD4i)

Chimiotaxie
80 70 60 50 40 30 20 10 0 0,3 3 2 gp120/CD4 20 200 SDF-1 ou

% migration

Insert Transwell
Cellules CXCR4+
2

Chambre suprieure Membrane poreuse (nM) 20 200 Chambre infrieure

SDF-1a

gp120 LAI/ gp120 HXBc2 (labo)/ CD4 (200 nM) CD4 (200 nM) Cell. mammifres Cell. dinsectes

gp120 ninduit pas les voies de signalisation en aval de CXCR4

Production et purification de gp120 et de ses formes mutes

Caractrisation fonctionnelle de gp120

Dveloppement et optimisation dune mthode didentification des domaines protiques dinteraction avec lhparine
Principe Exemple de rsultats: la chimiokine RANTES Optimisation: limination du support solide Application gp120

Etude du site CD4i de gp120 par mutagnse dirige

Principe de la mthode des billes

Squenage N-terminal

Hparine

Vivs RR. et al., J. Biol.Chem., 2004 Crublet E. and Vivs RR., New developments in therapeutic glycomics, 2006

Domaines basiques
PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

mthode des billes

Digestion la thermolysine RANTES (9-68)~300nM

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Glycoprotine denveloppe gC du virus de la pseudo rage Fragment a3LG4/5 de la laminine-5, protine matricielle

Principe
BUTS - saffranchir du support billes - choisir des oligosaccharides de taille et de structure dfinies

B
Hparine ou oligosaccharide

Purification des complexes peptides/hparine sur une rsine de DEAE

MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLF CASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHE DIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTS IRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGF AILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDN V3 AKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAK WNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNST WFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGL LLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKR

MRVKEKYQHLWRWGWRWGTMLLGMLMICSATEKLWVTVYYGVPVWKEATTTLF CASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHE DIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTS IRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGF AILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDN AKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAK WNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNST WFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGL LLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKR

V1/V2

V3

CD4i

V3 V1/V2 C-ter

Participation CD4i lattachement aux Site avec les HS du dj caractris (Arg298) proche du site Rledinteraction dans le clivage de gp160 envirus gp120 et gp41. HS des cellules (virus Sindbis) Site de clivage Implique dans lestructuraux choix du corcepteur rarrangements sous linfluence de CD4, gp120 (Furine) gp41 aboutissant lexposition de CD4i KIEPLGVAPTKAKRRVVQREKRXXXXX Interaction C-ter/hparine ncessaire au clivage

Production et purification de gp120 et de ses formes mutes

Caractrisation fonctionnelle de gp120

Dveloppement et optimisation dune mthode didentification des domaines protiques dinteraction avec lhparine

Etude du site CD4i de gp120 par mutagnse dirige

Lys 121

Lys 432

Arg 419

Lys 421
wt 121 419 421 432 2M
180 130 100

3M 4M

2M: R419S-K421S 3M: K121S-R419S-K421S 4M: K121S-R419S-K421S-K432S

Hparine
450 400 350 300 250 200 150 100 50 0 wt K121S R419S K421S K432S gp gp/CD4

Rsidu

Participation linteraction avec lhparine

K121 R419 K421

+++ +++

K432

+++

Y
900 800 700 600 500 400 300 200 100 0 wt K121S R419S K421S K432S gp gp/CD4 gp/CD4/Hp

17b

Rsidu

Participation linteraction avec lhparine

K121 R419 K421 K432

+++ +++ ++

o Dveloppement de systmes de production et purification

Baculovirus: systme optimis pour la production de gp120


Purification en trois tapes: protine pure 90-95% o Mise au point dune mthode permettant didentifier les domaines dune protine interagissant avec lhparine Dtection simple et rapide de domaines dinteraction Nombreuses protines testes: RANTES, gp120, gC, laminine, Adam12, prp, AT-III o Identification des domaines dinteraction de gp120 avec lhparine boucle V3 (K305) Site CD4i (R419, K421et K432) Deux autres domaines V1/V2 (K168) C-ter (K499)

o Caractrisation structurale et fonctionnelle des domaines V1/V2 et C-ter


o Etude de linteraction gp120/corcepteurs o Etude des motifs saccharidiques de linteraction gp120/sucre o Etude du rle physiologique des HS dans linfection des cellules cibles Existence de cluster corcepteurs/HS? Infectiosit de virus muts sur CD4i? o Dveloppement dun inhibiteur de lentre virale, driv des HS

CD4
CD4i

HS

LES GAGOPHILES oHugues oRomain oRabia oPascal oStphane oCdric

INSTITUT PASTEUR, PARIS

oF. Arenzana-Seisdedos oP. Rueda Quero oF. Baleux CERMAV, GRENOBLE


oA. Imberty UNIVERSITY OF OXFORD

LE LEM CANAL HISTORIQUE


oJP Andrieu oEvelyne GOUT oIsabelle BALLY oEt tous les autres

oQ. Sattentau

ANRS Sidaction MES AMIS ET MA FAMILLE