Vous êtes sur la page 1sur 99

CHAP 2 - Rappels de Biologie Moléculaire

Chapitre 2 - Rappels de BM 1
Plan
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
II.Structure des gènes

III.Quelques propriétés physico-chimiques des acides


nucléiques

IV.Enzymes du génie génétique

Chapitre 2 - Rappels de BM 2
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
1. Composition des acides nucléiques
2. Structure de l’ADN
3. Structure de l’ARN
4. Composition et structure des protéines
5. Le code génétique

Chapitre 2 - Rappels de BM 3
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
1. Composition des acides nucléiques
2. Structure de l’ADN
3. Structure de l’ARN
4. Composition et structure des protéines
5. Le code génétique

Chapitre 2 - Rappels de BM 4
STRUCTURE DES ACIDES NUCLEIQUES

Composition :
- Sucre (ose) : ribose (ARN) ; désoxyribose (ADN)
- Bases azotées : purines ; pyrimidine
- Groupement phosphate

Chapitre 2 - Rappels de BM 5
Chapitre 2 - Rappels de BM 6
Ribose (ARN) Désoxyribose (ADN)

7
Les bases azotées: purines et pyrimidines

8
Bases puriques

Adenine = 6-amino purine


Guanine = 2-amino 6-oxy purine

9
Bases pyrimidiques

Cytosine = 2-oxy 4-amino pyrimidine


Uracile = 2,4-dioxy pyrimidine
Thymine = 2,4-dioxy 5-methyl pyrimidine

10
Nucléosides et nucléotides
Base + sucre: liaison N-osidique

11
Nucléosides et nucléotides
Sucre + Phosphate: liaison ester

12
13
Nucléoside phosphate
Base Nucléoside
Mono-P Di-P Tri-P

Adénosine AMP ADP ATP


Adénine
désoxy-Adénosine dAMP dADP dATP

Guanosine GMP GDP GTP


Guanine désoxy-Guanosine
dGMP dGDP dGTP

Cytidine CMP CDP CTP


Cytosine
désoxy-Cytidine dCMP dCDP dCTP

Thymine désoxy-Thymidine dTMP dTDP dTTP

Uracile Uridine UMP UDP UTP


14
NUCLÉOTIDE

Base azotée

Groupement
phosphate

Sucre : désoxyribose
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
1. Composition des acides nucléiques
2. Structure de l’ADN
3. Structure de l’ARN
4. Composition et structure des protéines
5. Le code génétique

Chapitre 2 - Rappels de BM 16
Structure primaire de l’ADN
 L’ADN (acide désoxyribonucléique) est la molécule dépositaire de
l’information génétique transmise entre générations.

 Il est composé des nucléotides A, T, C et G.

 La structure primaire de l’ADN correspond à la séquence, c’est a


dire la l’enchaînement linéaire des nucléotides qui le composent.

17
Extrémité 5’ et 3’
La polymérisation du brin
d’ADN se fait de l’extrémité
5’ vers l’extrémité 3’.
Séquence = CAG ou 5’ CAG

18
Structure secondaire de l’ADN
 L’ADN se présente en général sous forme double brin dans la
cellule.
 Le double brin d’ADN est formé par l’appariement entre les bases
complémentaires des deux brins qui sont orientés de façon
opposée: on parle de chaines antiparallèles.
 L’appariement des bases des deux brins se fait par l’intermédiaire
de liaisons hydrogène.
 La forme double-brin de l’ADN (i) stabilise la molécule et (ii)
permet la transmission de l’information génétique lors de la
réplication ou de la transcription.

19
Les liaisons hydrogène de l’ADN
 La liaison hydrogène est une liaison de faible énergie impliquant un
atome d’hydrogène (donneur) et un atome (accepteur) possédant des
électrons libres (O et N dans le cas de l’ADN).
 Les liaison hydrogène permettent l’appariement de deux brins
complémentaires d’ADN qui forment ainsi une molécule double brin.
 Les liaison hydrogène s’établissent entre une base purique et une
base pyrimidique.
 L’appariement Adénine-Thymine fait intervenir 2 liaisons hydrogène
alors que l’appariement Cytosine-Guanine en implique 3.

20
21
Appariement A-T

22
23
Appariement G-C

24
Appariement de deux brins de l’ADN

A C T G

5’ A C TG 3’

3’ T GAC 5’

25
Structure secondaire de l’ADN: la double hélice

 Les 2 brins d’ADN s’enroulent l’un autour de l’autre


formant une structure en double hélice.
 Dans la double hélice d’ADN, les bases sont tournées vers
l’intérieur de l’espace délimitée par les 2 brins alors que
les groupements phosphate et les molécules de sucre sont
situés sur la partie externe.

26
La double hélice d’ADN

27
La double hélice d’ADN

28
La double hélice d’ADN

29
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
1. Composition des acides nucléiques
2. Structure de l’ADN
3. Structure de l’ARN
4. Composition et structure des protéines
5. Le code génétique

Chapitre 2 - Rappels de BM 30
 L’ARN (acide ribonucléique) est composé de nucléotides constitués
par un phosphate+ un sucre + une base azotée.

 Contrairement à l’ADN:
• le sucre de l’ARN correspond à la ribose;

• les bases pyrimidiques de l’ARN sont la cytosine et l’uracile;

• dans la cellule l’ARN existe généralement sous forme simple brin.

• Le brin d’ARN est souvent le siège d’appariements intramoléculaires qui


confèrent à la molécule des structures secondaire et tertiaire.

 Les molécules d’ARN sont en général de taille beaucoup plus petite


que l’ADN. 31
 Il existe plusieurs types d’ARNs qui interviennent dans des
fonctions biologiques diverses
• ARN de transfert (ARNt);

• ARN ribosomale (ARNr);

• ARN messager (ARNm);

• snARN, petits ARNs nucléaires

• siARN, petits ARNs interférant


• Etc.

32
Structure secondaire de l’ARN
Appariement G-C et A-U entre des segments complémentaires d’un même brin.

33
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
1. Composition des acides nucléiques
2. Structure de l’ADN
3. Structure de l’ARN
4. Composition et structure des protéines
5. Le code génétique

Chapitre 2 - Rappels de BM 34
Les protéines
Les protéines représentent 20% du poids de la cellule (eau = 70%).

Elles remplissent plusieurs fonctions:

 Structurale: exemple, le collagène relie les os et les tissus.


 Catalytique: les enzymes catalysent une multitude de réactions biochimiques
(formant le métabolisme).
 Transport: les protéines membranaires maintiennent l’environnement
cellulaire, régulent le volume de la cellule, créent des gradients ioniques pour
les muscles et le système nerveux, etc.

35
Protéine= polymère d’acides aminés

Chapitre 2 - Rappels de BM 36
Structure primaire
Il y a 20 acides aminés qui entrent dans la composition
des protéines. On peut donc présenter la séquence
primaire des protéines comme un texte basé sur un
alphabet à 20 lettres.
Exemple: séquence de l’insuline

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Chapitre 2 - Rappels de BM 37
Chapitre 2 - Rappels de BM 38
Liaison peptidique:

Chaîne : Lys-ala-ile-thr
STRUCTURE SECONDAIRE DES PROTEINES

Certaines parties de la chaîne d'acides aminés adoptent une structure régulière


appelée structure secondaire. On reconnaît deux grands types de structure
secondaire :

Hélice alpha

Dans la structure dite en hélice alpha, la chaîne d'acides aminés prend la forme d'une
hélice qui est stabilisée par des liaisons hydrogènes.

Feuillet bêta

Dans un feuillet bêta, il se forme parallèlement les uns par rapport aux autres. L'ensemble
forme comme une membrane plissée.
Structure secondaire : Hélice
Hélice  droite
Conformation repliée impliquant des liaisons hydrogènes répétitives entres
atomes de la chaîne principale (NH et CO) des résidus i et i+4
Structure secondaire : Feuillets 

Feuillets  parallèles
Structure secondaire : Feuillets 

Feuillets  antiparallèles
Structure secondaire
Hélice α Feuillet β

Chapitre 2 - Rappels de BM 44
Structure tertiaire

Chapitre 2 - Rappels de BM 45
Structure quaternaire

Chapitre 2 - Rappels de BM 46
Nouvelles notions
Séquence d’ADN Structure secondaire
Extrémités 5’ et 3’ Structure tertiaire
Chaines antiparallèles Structure quaternaire
Liaison hydrogène Hélice 
Double hélice Feuillets  parallèles
Plateau de bases Feuillets 
antiparallèles
47
I. Structure des macromolécules informatives (acides
nucléiques – protéines)
1. Composition des acides nucléiques
2. Structure de l’ADN
3. Structure de l’ARN
4. Composition et structure des protéines
5. Le code génétique

Chapitre 2 - Rappels de BM 48
Le code génétique ou comment l’information contenue dans l’ADN
est déchiffrée pour permettre la production des molécules qui
assurent le fonctionnement de la cellule.

L’information contenu dans la molécule d’ADN est


codée sous forme de triplets de nucléotides appelés
codons, chaque codon spécifiant un acide aminé ou
un signal d’arrêt de la traduction.

Chapitre 2 - Rappels de BM 49
Le code génétique
64 triplets

20 acides aminés

Méthionine: signal de
début de traduction

Stop: signal de fin de


traduction

Chapitre 2 - Rappels de BM 50
Caractéristiques du code génétique
 Universel: un même code pour tous les organismes vivants (différences chez la
mitochondrie et les chloroplastes).
 Dégénéré: un acide aminé peut être spécifié par plusieurs codons différents.
 Codon d’initiation: ATG (Met) pour la majorité des gènes;
 Autres codons d’initiation: TTG (Leu), GTG (Val), CTG (Leu).
 Codons stop:
• TAA = ocre.
• TAG = ambre.
• TGA = opale.

51
II.Structure des gènes

1. Gène procaryote

2. Gène eucaryote

Chapitre 2 - Rappels de BM 52
Le gène procaryote
Peut être divisé en 2 parties:
 Le promoteur
 L’unité transcriptionnelle

53
Le promoteur procaryote
 Séquence d’ADN situé dans la région 5’ du gène.
 Site où s’assemble la machinerie cellulaire qui
réalise la transcription du gène.
 Nécessaire à la transcription d’un gène.
 Contient des signaux qui sont conservés.
54
Les signaux du promoteur procaryote:
le site d’initiation de la transcription
+1

Promoteur Unité transcriptionnelle


Les signaux du promoteur procaryote:
la boite TATA ou boite de Pribnow ou boite -10
+1

-10
TATAAT
G

Promoteur Unité transcriptionnelle

 Située à environ 10 nucléotides en amont du +1.


 Hexanucléotide TATAAT fréquemment retrouvé chez les gènes procaryotes et
eucaryote = séquence consensus.
 Richesse en AT facilite l’ouverture du double brin lors de la transcription.
56
Les signaux du promoteur procaryote:
la boite -35
+1

-35 -10
TTGACA TATAAT
G

Promoteur Unité transcriptionnelle

 Située à environ 35 nucléotides en amont du +1.


 Site de fixation de l’ARN polymérase.
 Consensus TTGACA retrouvé chez les promoteurs procaryotes les plus forts.
 Séparée par 17  1 nucléotides de la boite TATA.
57
Unité transcriptionnelle des ARNm procaryotes:
la phase ouverte de lecture (ORF)
+1

-35 -10
TTAGCA TATAAT
G ATG Stop

Promoteur Unité transcriptionnelle


 Appelée ORF (Open Reading Frame).
 Commence par un codon d’initiation et se termine par un codon stop.
 Correspond à l’ensemble des codons qui déterminent la séquence de la protéine pour
laquelle code le gène.
58
Unité transcriptionnelle des ARNm procaryotes:
la séquence leader
leader
En. -35 Op. -10 +1
RBS ATG Stop
TTAGCA TATAAT

Promoteur Unité transcriptionnelle

 Séquence 5’ transcrite non traduite.


 Commence au nucléotide +1 et se termine juste avant le codon d’initiation.
 Contient le RBS (Ribosome Binding site), séquence reconnu par le ribosome lors du
démarrage de la traduction.
59
Unité transcriptionnelle des ARNm procaryotes:
la séquence trailer

leader trailer
En. -35 Op. -10 +1
RBS
TTAGCA TATAAT ATG Stop

Promoteur Unité transcriptionnelle


 Séquence 3’ transcrite non traduite.
 Commence immédiatement après le codon stop et se termine à la fin de l’ARNm.
 Peut contenir des signaux de terminaison de la transcription.
 En général important pour la stabilité de l’ARNm
60
1. Structure du gène procaryote
leader trailer
-35 -10 +1
TTAGCA TATAAT RBS ATG Stop

Promoteur Unité transcriptionnelle

61
Le gène eucaryote
Caractères généraux similaires à ceux du gène procaryotes. Plusieurs
différences:
 Taille plus grande.
 Boite TATA située à  25 pb en amont du +1.
 Boite CAAT située à  80 pb en amont du +1
 Plus grand nombre de séquences régulatrices.
 Présence d’introns et d’exons.
 Modifications post-transcriptionnelles absentes chez les procaryotes
62
63
2. Structure du gène eucaryote
 Exon: séquence transcrite et traduite.
 Intron: séquence transcrite non-traduite.

Promoteur ATG Stop

Exon 1 Intron 1 Exon 2 Intron 2 Exon 3

64
Transcription du gène eucaryote
Promoteur ATG Stop PolyA

Exon 1 Intron 1 Exon 2 Intron 2 Exon 3

TRANSCRIPTION

Exon 1 Intron 1 Exon 2 Intron 2 Exon 3


AAAAAAAAAAAA

EPISSAGE

Exon 1 Exon 2 Exon 3


AAAAAAAAAAAA
65
III.Quelques propriétés physico-chimiques des acides
nucléiques

1. Charge des acides nucléiques et électrophorèse en


gel d’agarose

2. Dénaturation et hybridation moléculaire

Chapitre 2 - Rappels de BM 66
III.Quelques propriétés physico-chimiques des acides
nucléiques

1. Charge des acides nucléiques et électrophorèse en


gel d’agarose

2. Dénaturation et hybridation moléculaire

Chapitre 2 - Rappels de BM 67
Les acides nucléiques possèdent une grande quantité de
charges négatives dues aux groupement phosphates.

Chapitre 2 - Rappels de BM 68
Gel d’agarose
• Gel formé par la polymérisation des molécules d’agarose.
• Contient des pores par lesquels des molécules d’acides nucléiques peuvent migrer sous l’effet d’un
champ électrique.
• La migration se fait de l’anode vers la cathode du fait des charges négatives des acides nucléiques.
• Plus une molécule est petite, plus sa migration est rapide.

Chapitre 2 - Rappels de BM 69
Migration des acides nucléiques sur gel d’agarose

Après la migration l’ADN est révélé grâce à des molécules qui s’intercalent dans le grand sillon et
émettent des signaux qui permettent de les détecter (UV, fluorescence, etc.)

Chapitre 2 - Rappels de BM 70
III.Quelques propriétés physico-chimiques des acides
nucléiques

1. Charge des acides nucléiques et électrophorèse en


gel d’agarose

2. Dénaturation et hybridation moléculaire

Chapitre 2 - Rappels de BM 71
Dénaturation de l’ADN

Chapitre 2 - Rappels de BM 72
Suivi de la dénaturation de l’ADN

Chapitre 2 - Rappels de BM 73
Hybridation moléculaire
L’hybridation moléculaire est l'association entre deux acides
nucléiques simples brins de séquences complémentaire et qui
conduit à la formation d'un double brin ou duplex.
Cette association s'effectue par l'établissement de liaisons
hydrogènes spécifiques entre les bases puriques et
pyrimidiques,

Chapitre 2 - Rappels de BM 74
L’hybridation moléculaire est spécifique sous certaines conditions expérimentales
(température, PH, stringence), une séquence d’ADN monobrin ne peut s’apparier
qu’à la séquence qui lui est complémentaire dans le génome.

Chapitre 2 - Rappels de BM 75
IV.Enzymes du génie génétique

1. Enzymes de restriction

2. Ligase

3. Enzymes de polissage

4. Transcriptase inverse

Chapitre 2 - Rappels de BM 76
Le génie génétique
 Génie génétique = ingénierie génétique.
 Le génie génétique est l’ensemble des outils et techniques de biologie
moléculaire qui permettent d’étudier et de modifier les gènes dans des buts de
recherche fondamentale (compréhension des mécanismes de fonctionnement des
êtres vivants) ou de recherche appliquée (utilisation des mécanismes du vivant
pour des productions d’intérêt).
 Le génie génétique a débuté à partir des années 1970 avec les avancées dans la
compréhension de la structure et du fonctionnement des molécules du vivants
(ADN, ARN, protéines).
 La découverte des enzymes de restriction en 1970 a permis un bon considérable
à l’ingénierie génétique. Chapitre 2 - Rappels de BM 77
Applications du génie génétique
 Le génie génétique rend possible aujourd’hui la création d’organismes génétiquement
modifiés (OGM), la caractérisation génétique des individus afin de diagnostiquer des maladies
génétiques, et la thérapie génique.
 Le génie génétique est un champ très actif de la recherche avec des applications dans plusieurs
domaines:
• santé humaine et animale (correction d’un gène porteur d’une mutation délétère, production
de protéines thérapeutiques, diagnostic, etc.);
• agriculture (mise au point de nouvelles générations de plantes génétiquement, etc.) ou encore
pour la mise au point d’outils destinés à la recherche (par exemple pour explorer la fonction
d’un gène);
• environnement
• etc.
Chapitre 2 - Rappels de BM 78
IV.Enzymes du génie génétique

1. Enzymes de restriction

2. Ligase

3. Enzymes de polissage

4. Transcriptase inverse

Chapitre 2 - Rappels de BM 79
Les enzymes de restriction
Ce sont des endonucléases produites par les bactéries.
Coupent les liaison phospho-diester 3’-5’ des 2 brins d’ADN en
des sites spécifiques.
Les plus utilisées sont les enzymes de restriction de type II
qui reconnaissent des séquences palindromiques.
Peuvent générer des molécules
à bouts francs
bouts cohésifs
Chapitre 2 - Rappels de BM 80
Les enzymes de restriction (ER) sont des endonucléases produites par les bactéries

 Endonucléases: coupent l’ADN à l‘intérieur de la molécule; exonucléases digèrent l’ADN à


partir d’extrémités libres.
 Il existe 3 types d’ER:
 Type I: coupent l’ADN à des distances très éloignées de leur site de reconnaissance
(1000-5000 pb).
 Type II: reconnaissent des séquences palindromiques (même séquence sur les 2 brins) et
coupent l’ADN à ce niveau.
 Type III: coupent l’ADN à un vingtaine de pb de leur site de reconnaissance.
 Les ER font en fait partie d’un système de restriction/modification qui protège l’ADN de la
bactérie productrice: la méthylation du site reconnu par l’enzyme empêche la coupure de
l’ADN.

Chapitre 2 - Rappels de BM 81
Les enzymes de restriction (ER) de type II

Les ER de type II sont les plus utilisées.


Elles reconnaissent des séquences palindromiques de 4 à 8 pb
de long.
Statistiquement, plus un site d’ER est court plus il en existe
de copie sur un ADN donné. Inversement plus un site est long
moins il y en a de copies.

Chapitre 2 - Rappels de BM 82
Nomenclature et extrémités générées par les enzymes de restriction

 Première ER découverte en 1970: HindII (= HincII), produite par Haemophilus


influenzae (d’où le nom)
 ER de type II qui reconnait la séquence GTPyrPurAC (GTYRAC).
 Coupe entre Pyr et Pur et génère des bout francs.
 EcoRI: produite par Escherichia coli
 ER de type II qui reconnait la séquence GAATTC.
 Coupe entre G et A (G/AATTC) et génère des bouts cohésifs 5’ débordant.
 KpnI: produite par Klebsiella pneumonia
 ER de type II qui reconnait la séquence GGTACC.
 Coupe entre les 2 C (GGTAC/C) et génère des bout cohésifs 3’ débordant.

Chapitre 2 - Rappels de BM 83
Extrémités générées par les enzymes de restriction

Chapitre 2 - Rappels de BM 84
Enzymes de restriction compatibles

Ce sont des ER dont les extrémités qu’elles génèrent peuvent


s’hybrider.
Exemple: SalI (G/TCGAC) et XhoI (C/TCGAG)
1. Montrer les extrémités produites par chaque.
2. Dessiner le produit de l’hybridation des extrémités générées
par les 2 ER.

Chapitre 2 - Rappels de BM 85
Travaux dirigés
Parmi les enzymes suivant y en a-t-il qui sont
compatibles? Si oui dessiner les extrémités qu’elles
génèrent ainsi que le produit de ligation de ces
extrémités,
1.BamHI:G/GATCC
2.BanI: G/GTACC
3.BglII: A/GATCT
4.BsiWI: C/GTACG
Chapitre 2 - Rappels de BM 86
IV.Enzymes du génie génétique

1. Enzymes de restriction

2. Ligase

3. Enzymes de polissage

4. Transcriptase inverse

Chapitre 2 - Rappels de BM 87
La ligase
 Enzyme capable de raccorder des extrémités libres d’ADN = établissement d’une liaison
phospho-diester entre 3’-OH et 5’-P.
 Par exemple, dans l’hybridation des extrémités SalI et XhoI précédemment décrite,
l’action de la ligase va permettre de raccorder de façon covalente les extrémités 5’ et 3’ de
chaque brin.
 Réaction de ligation: NNN-OH3’ + 5’P-NNN NNN-O-P-NNN

Chapitre 2 - Rappels de BM 88
Réaction catalysée par la ligase

Chapitre 2 - Rappels de BM 89
Ligation de produits d’ER compatibles

Montrer les produits de ligation de molécules digérées par les ER


suivant:
NdeI (CA/TATG) + AseI (AT/TAAT)
BamHI (G/GATCC) + BglII (A/GATCT) = DpnII (/GATC)

Chapitre 2 - Rappels de BM 90
IV.Enzymes du génie génétique

1. Enzymes de restriction

2. Ligase

3. Enzymes de polissage

4. Transcriptase inverse

Chapitre 2 - Rappels de BM 91
Enzymes de polissage

Transforment les ADN à extrémités cohésives en molécules à


bout franc.
Utiles lorsque des ER compatibles ne sont pas disponibles lors des
clonages.
2 types: polymérases et nucléases.

Chapitre 2 - Rappels de BM 92
Polissage de l’extrémité de l’ADN avec une polymérase

1. Digestion par EcoRI


3’ 5’
G A A T T C
C T T A A 5’ G
3’

2. Polissage par une polymérase (T4 DNA polymérase, fragment de Kleenow, et.)

3’ 5’
G A A T T A A T T C
C T T A A 5’ T T A A 3’G

Chapitre 2 - Rappels de BM 93
Polissage de l’extrémité de l’ADN avec une nucléase

1. Digestion par KpnI (GGTAC/C)


3’ 5’
G G T AC C
C C A T GG
5’ 3’

2. Polissage par la Mung Bean nucléase (exonucléase qui reconnait les parties simple brin)

3’ 5’
G G T AC C
C C A T GG
5’ 3’

Chapitre 2 - Rappels de BM 94
IV.Enzymes du génie génétique

1. Enzymes de restriction

2. Ligase

3. Enzymes de polissage

4. Transcriptase inverse

Chapitre 2 - Rappels de BM 95
Transcriptase inverse

C’est une ADN polymérase ARN-dépendante:


synthétise de l’ADN à partir d’une matrice ARN.
Utilisée pour produire de l’ADN complémentaire
(ADNc) par exemple lorsque l’on souhaite exprimer
un gène eucaryote chez un procaryote.

Chapitre 2 - Rappels de BM 96
Travaux dirigés
Parmi les enzymes de restriction suivantes quelles
sont celles qui sont compatibles? Dessiner les
produits de ligation de fragments qu’elles ont
digéré.
BamHI : G/GATCC MfeI : C/AATTG
KasI : G/GCGCC BglII : A/GATCT

Chapitre 2 - Rappels de BM 97
Travaux dirigés
Il vous est demandé d’analyser un plasmide par restriction
en utilisant 2 enzymes, PvuII et SimI. Les digestions du
plasmide donnent les résultats suivants.
• PvuII, 7125 pb, 2002 pb
• SimI, 7799 pb, 1328 pb
• PvuII + SimI, 4765 pb, 2002 pb, 1328 pb, 1032 pb
Donner la taille du plasmide et dessiner sa carte de
restriction (positionnement des sites des 2 enzymes)
Chapitre 2 - Rappels de BM 98
Travaux dirigés
Il vous est demandé d’analyser un plasmide par restriction
en utilisant 2 enzymes, EcoRI et XbaI. Les digestions du
plasmide donnent les résultats suivants.
• EcoRI, 4000 pb, 2000 pb
• XbaI, 3000 pb, 1500 pb
• EcoRI + XbaI, 3000 pb, 1500 pb, 500 pb
Donner la taille du plasmide et dessiner sa carte de
restriction (positionnement des sites des 2 enzymes)
Chapitre 2 - Rappels de BM 99