Vous êtes sur la page 1sur 242

CHOISIS LA VIE...

H
A
R
T
E

Jacques-Daniel Rochat

CHOISIS LA VIE...
Charte+

Jacques-Daniel Rochat

ditions
ENTRAID

ditions ENTRAID

CH-1071 Chexbres, Suisse, www.entraid.org

Couverture, illustrations et mise en page


CREA-7, Jacques-Daniel Rochat, CH-1071 Chexbres, Suisse, www.crea-7.com
Citations
Les citations bibliques sont tires des versions
Nouvelle dition de Genve et Louis Segond.
Les citations des proverbes rfrences avec un astrisque (*) sont des traductions dAlfred Kuen.
Droits
Reproductions et traductions des textes autorises
(pour autant que les articles gardent leur intgrit et la mention de lauteur).
Les reproductions des images ou les rditions de cet ouvrage
sont soumises lobtention dune autorisation de lauteur.
Avec le soutien initial de
GLIFA (Bonne littrature pour tous), Rudy Lack
Impression
CPI books GmbH, Deutschland
Editions
Premires ditions : 2010, 2012, 2013 : 27000 exemplaires, version 1F
Quatrime dition : janvier 2015 : 12000 exemplaires, version B4F
ISBN : 9782970068501

9 782970 068501

TABLE DES MATIRES


PRFACE _____________________________________________ 7
INTRODUCTION ______________________________________ 9
Un monde immense
9
prouver les promesses

La Charte+

10

13

1. ENGAGEMENT _____________________________________ 15
Les fondements spirituels de la cration
16
La rupture
22
La stratgie du diable
Limportance de ladoration

23
24

Dmarches concernant notre engagement

33

Les maldictions de lidoltrie


Le besoin dune nouvelle naissance

Citations bibliques: lengagement spirituel

25
29
34

2. VIE PERSONNELLE _________________________________ 35


Quest-ce que lhomme?
35
Une sauvegarde pour lavenir

38

Une semence qui apporte la vie


Lenjeu du cur

44
45

La Bible
La prire
Les autres

47
55
58

Lexprience de Salomon
Quelques pistes pratiques

63
63

Laide de lEsprit
Lcoute de Dieu

tre un modle

Citations bibliques: la vie personnelle

40
46

59
64

3. RESPECT DU PROCHAIN ____________________________ 65


Une vision nouvelle
Les expressions du mal

65
67

Dmarche vivre en groupe

89

Les niveaux du mal


Quel impact dans la socit?
Un quilibre vital
Un vangile qui fait la diffrence

Citations bibliques: le respect du prochain

74
77
79
88
90

4. COUPLE ET FAMILLE ________________________________ 91


La famille: le jardin du dveloppement
91
Les diffrentes formes familiales et du couple
92
La forme islamique
La forme animiste
Les flaux de la polygamie

95
102
106

Le besoin dune rupture


Une unit retrouve

107
109

Pourquoi la sexualit doit-elle se vivre dans le mariage?


La planification des naissances

122
122

La forme biblique de la famille


La sexualit

La ncessit dduquer les enfants


Quelques pistes pratiques sur le thme de la famille
Citations bibliques : le couple et la famille

107
119
124
126
127

5. GLISE __________________________________________ 129


Le tmoignage de lglise
129
Les fondements de lglise
130
La puissance de la communion avec le Pre

137

1. Prendre garde ses faiblesses


2. Vivre selon un principe dgalit
3. Bien grer les ressources

154
157
159

Lglise: le corps du Christ


Le rle de lglise
La vraie onction
Trois conseils suivre

Dmarches pratiques
Citations bibliques: le service dans lglise

144
146
151
154

162
163

6. TRAVAIL _________________________________________ 165


Le travail
165
Limportance du travail
La cration de richesses
La nature de largent
Deux confusions opposes

167
168
172
173

La capacit de travailler ensemble


Lexemple de la banque

178
181

Dfinition de lintgrit
Des principes universels

185
186

La cration de richesses
Le besoin dintgrit

174
184

Exercer un travail dans les services de sant

187

vangile et services de sant


Quelques pistespour le travail dans les services de sant

191
196

Citations bibliques sur lassistance

198

Citations bibliques: le travail

197

7. SOCIT _________________________________________ 199


Les profits sociaux de lvangile
199
Le potentiel de lvangile
200
Lvangile et lorganisation sociale
203
Les cercles dinfluences
206
Des proverbes et des citations mditer

207

Prendre une part dans les mdias


Les fondements dune bonne politique
Le miracle de la collgialit
Le tyran type
Une rforme du pouvoir
Un exemple

212
213
214
217
219
220

1. Choisir les bonnes personnes


2. Avoir un sens aigu de la justice
Quelques paroles du livre des Proverbes sur la justice

222
225
226

Racisme et frustrations
Contexte corrompu

227
228

Homme dpendant ou rayonnant?


Deux conseils pour gouverner

229
230

Lvangile et la politique

Quelques rgles pour bien gouverner

Quelques conseils sur la gouvernance

Le monde a besoin de bons responsables

Citations bibliques : le chrtien dans la socit

208

222

227
229
231

LA CHARTE+ _______________________________________ 233


Les trois lments de la charte
234
Un engagement de bonne volont

235

Prix de la charte
Port de linsigne

236
236

Qualification des signataires


Pour aller plus loin...

236
238

CHOISIS LA VIE...
PRFACE
Ce livre tombe pic ! Spcialement pour celles et ceux qui se
rendent compte quel point lglise a besoin de changements
GUDVWLTXHVSRXULQXHQFHUSRVLWLYHPHQWOHPRQGHHWDSSRUWHUOH
tmoignage de laction du Christ vivant !
lorigine, ce livre visait expliquer les divers engagements
proposs par la CHARTE+ qui est diffuse dans plusieurs pays.
0DLVQDOHPHQWFHOLYUHHVWEHDXFRXSSOXVTXHFHOD
Dans un langage simple, document avec comptence et illustr
pdagogiquement, ce livre dpeint la mission des chrtiens dans
un ensemble de domaines essentiels qui touchent lhumain et
son environnement.
Cet ouvrage permet douvrir le vaste horizon que rvle la Parole
de Dieu, il veut encourager des changements tous les niveaux
chez les peuples souffrants et accabls. Mais je crois quil est
tout aussi ncessaire pour les glises et les dirigeants des pays
dvelopps dOccident, tant sest perdue la vision holistique de
ce que le Christ appelle le Royaume de Dieu ! Cest lui quil faut
chercher dabord .
&HTXLHVWWRXWSDUWLFXOLqUHPHQWDSSUpFLDEOHDXOGHOH[SRVp
est que la pratique de la vie nouvelle senracine dans une
rvlation que lon sent vcue par lauteur du dessein originel
et fondateur de Dieu pour lhumanit. Les changements familiaux,
sociaux, ecclsiaux, culturels, juridiques et mme politiques
frmissent de cette inspiration venue du cur et de la pense de
Dieu. Il en rsulte une logique spirituelle qui a lair de couler
de source. Ainsi, les paroles de la Bible sont mises en rseau avec
OHVGUDPDWLTXHVSUREOqPHVSUDWLTXHVGHQRWUHpSRTXHDXFRQXHQW
des cultures animistes, religieuses et modernistes scularises.
/$IULTXHSDUWLFXOLqUHPHQWO$IULTXHFHQWUDOHYLWFHWWHFRQXHQFH
douloureusement. Pour ces nations, cest la survie physique de
leurs socits qui est en jeu, ou tout au moins la sant morale et
conomique des classes majoritaires qui sont les plus opprimes
et les plus pauvres.
7

Prface

Choisis la vie...

Quant aux nations dites dveloppes, il en va de leur avenir


VSLULWXHOHWGRQFGHOHXUGHVWLQQDOHWpWHUQHO6HSHUGURQWHOOHV
GDQV XQ FRQIRUW pJRwVWH WRXMRXUV SOXV IHUPp DX VRXIH GLYLQ "
2XOHVFKUpWLHQVGHFHVQDWLRQVVHOqYHURQWLOVFRPPHXQSHXSOH
OXPLQHX[ HW SURSKpWLTXH JrQDQW SHXWrWUH SRXU FHUWDLQV PDLV
GLVSHQVDQWOD9LH"
Les divers voyages que nous avons faits en quipe avec lauteur
lui ont permis de discerner les enjeux dans lesquels se trouvent
de nombreux pays. Ainsi, cet ouvrage commence par aborder la
GLPHQVLRQ VSLULWXHOOH HW OHV LQXHQFHV GHV HVSULWV HVFODYDJLVWHV
domaine que lhomme moderne, aussi aveugl quinconsciemment
idoltre, essaie dignorer. Cette conqute vitale se poursuit en
abordant les racines du cur de lhomme et ses effets sur la vie
psychique et relationnelle. Ensuite, cest la vision de la famille et
de lglise qui est confronte aux fondements bibliques et ses
implications dans les socits traditionnelles.
Le cercle slargit encore en abordant les domaines du travail, du
rapport largent, de la cration de richesses et des soins de sant.
Ces sujets dlicats ne sont pas traits de manire moralisante,
mais selon une vision positive centre sur Jsus serviteur et Roi.
Louvrage se termine en dmontrant que, lorsque les dirigeants
et les citoyens se laissent conduire par lEsprit du Christ, cela
entrane un renversement des mentalits qui permet de dvelopper
EpQpTXHPHQWODVRFLpWp
Toutes ces dimensions jaillissent de cette rvolution intrieure qui
SHUPHWGDLPHU'LHXGHWRXWVRQrWUHHWVRQSURFKDLQFRPPHVRL
mme, sans tromperie ni domination.
Que ce livre permette ceux qui sengageront avec la CHARTE+
de vivre en vrit ce quelle implique ! Il est absolument vital que
dans toutes nos nations le bon Rgne de Dieu soit perceptible,
librateur et convaincant, source de Vie et puissance de
rconciliation ! Le Seigneur ternel na pas dit son dernier mot !
La semence, plante en terre la croix o Jsus sest donn et
rvle dans sa rsurrection, va accomplir ses effets plus srement
que le soleil qui se lve au matin ! Il est urgent de le suivre et de
collaborer avec lui !
-HDQ3LHUUH%HVVH
Pasteur, vangliste et formateur itinrant

CHOISIS LA VIE...
INTRODUCTION
Un monde immense
La Terre est un grand jardin extraordinaire qui accueille des
milliards dhommes et de femmes. Aujourdhui, plus de
350 000 bbs verront le jour alors que les yeux denviron
150 000 personnes se fermeront jamais. Chaque jour ce sont
plus de 200 000 personnes qui sajoutent lhumanit.
Le monde tel quil est !
Si nous comparons lhumanit entire un village de
100 habitants, et si nous tenons compte de tous les
peuples existants, ce village serait compos de :



61 Asiatiques.
13 Africains.
13 Amricains (8 au sud, 5 au nord).
12 Europens.

Notons aussi que :


80 nauraient pas de logements salubres.
48 ne seraient pas libres de croire ou de sexprimer.
20 vivraient dans la crainte de violences ou de la guerre.
17 nauraient pas accs de leau potable.
11 souffriraient de la faim
14 seraient illettrs.
10 possderaient ~80 % de la richesse mondiale.

7 auraient un ordinateur, 1 serait diplm dune universit.
Statistiques : Unesco, PAM, divers

Avec ces chiffres, il nous est pourtant impossible de saisir


ltendue des peuples et des nations qui rassemble des milliards
de destins et dans laquelle chaque personne a son cercle familial,
ses amis et ses activits. Pour le plus grand nombre dhabitants, la
vie nest pas un chemin de facilit, mais un parcours de souffrance
sur lequel frappent la maladie, la violence et la pauvret. Sur notre
plante, la moiti des habitants na pas accs des services de
VDQWpHIFDFHVRXjGHOHDXSRWDEOHHWXQWLHUVGHVKDELWDQWVYLW
dans un contexte de guerre ou dinscurit.
9

Introduction

Choisis la vie...

Chaque anne, ce sont 740 000 personnes qui sont tues par la
violence, dont les deux tiers lors dagression hors des zones de
FRQLW
Les cris et les souffrances de ce monde permettent de mesurer combien
lhumanit est trouble par la mchancet et la folie diabolique du
mal qui la ravage. Incapables de saimer et de grer la cration avec
sagesse, les hommes ont sombr dans un chaos catastrophique dans
lequel le meilleur est sans cesse mis en pril par le pire.
Devant ce sombre tableau, peut-on encore avoir de lesprance ?
Dans le monde, la
souffrance se mle
aux larmes et le
sang la terre.

Est-ce encore raisonnable de croire quil


existe des solutions mme de soulager les
souffrances et dapporter un dveloppement
salutaire lhumanit ?

prouver les promesses


Face ltat du monde, de nombreuses religions ou idologies
politiques prtendent dtenir le bon modle qui pourra sortir
lhumanit de ses problmes.
Qui faut-il croire et do peut venir laide dont le monde a tant
besoin ?

la place de se perdre dans les thories propres chaque idologie


ou religion, il est plus ais de juger ces ides ou ces croyances
selon ce quelles apportent dans les socits qui les pratiquent.
Cest exactement ce que Jsus demandait ceux qui lentouraient.
Ou dites que larbre est bon et que son fruit est bon, ou dites
que larbre est mauvais et que son fruit est mauvais ; car on
connat larbre par le fruit. Matthieu 12.33

Selon ce conseil, cest ce que lon cueille qui permet dvaluer la


valeur de larbre. Celui-ci, aussi majestueux soit-il, a de la valeur
sil donne de bonnes choses.
Apporte-t-il la vie ou rend-il malade ? Cet examen judicieux
sapplique aux hommes, aux idologies, la politique et aux
religions.
valuer avec honntet les consquences des idologies ou des
10

Choisis la vie...

Introduction

religions1 HVW OD PDQLqUH OD SOXV HIFDFH GH MXJHU GH VD YDOHXU
Toutes prtendent logiquement tre la voie royale suivre mais
quen est-il dans la ralit ?
Lorsquune religion prtend tablir une connexion avec la
puissance qui a construit ce monde, nest-il pas lgitime de
sattendre ce que ce lien privilgi apporte un substantiel
avantage ses cratures ?
Comment pourrions-nous accorder du crdit un dieu qui
prtendrait amliorer notre destin quand les prires de ses
QRPEUHX[GqOHVQHSURGXLUDLHQWDXFXQLPSDFWEpQpTXHGDQVXQ
pays ?
Qui peut le plus peut le moins, et la religion qui prtend offrir
XQ DYHQLU UDGLHX[ j VHV GqOHV GDQV ODXGHOj pWHUQHO  GHYUDLW
logiquement dmontrer quelle peut crer un monde meilleur.
Une religion ne peut promettre le paradis dans le Ciel et semer
la dsolation sur la Terre.

Cest avec cette exigence de vrit que cet ouvrage dsire inviter
le lecteur dcouvrir le fabuleux potentiel de transformation que
lvangile2 possde.
En effet, si le Christ est venu pour sauver les hommes de la
perdition, son uvre saccompagne aussi dune puissance capable
de transformer les vies et la socit.
Lvangile est la source qui a la capacit dapporter un fabuleux
SURW DX PRQGH HW ORQ SHXW REMHFWLYHPHQW VH GHPDQGHU VL OH
monde existerait encore sans lui.
Depuis des sicles, lvangile est la voix qui dnonce les abus
de lorgueil humain et des pouvoirs tyranniques. Avec lvangile,
Dieu sapproche de tous les hommes en faisant tomber de leur
pidestal ceux qui se donnaient la fonction dintermdiaires.
1

Notons que cet examen sapplique aussi aux philosophies qui prtendent ouvrir
le salut aux civilisations. Par exemple, lchec cuisant et cruel du communisme
athe qui a conduit lappauvrissement et au massacre de millions de
SHUVRQQHVQHVWLOSDVVXIVDQWSRXUGLVTXDOLHUOHVLGpHVOXPLQHXVHVTXL
lont engendr ?



'DQVFHOLYUHTXDQGOHPRWeYDQJLOHHVWpFULWDYHFXQHPDMXVFXOHLOQH
concerne pas les rcits des quatre vangiles bibliques mais dsigne la rvlation
apporte par la Bible et la venue de Jsus sur la Terre.

11

Introduction

Choisis la vie...

Le modle du Christ donnant sa vie nest-il pas lorigine dun


SURIRQGWUDYDLOGHVFXUVHWGHVSHQVpHVTXLDSHUPLVGHGLVTXDOLHU
la violence et dtablir des principes de justice dans le monde ?
La rvlation du Dieu damour a aussi sorti des millions
dhommes de leurs cruelles et stupides superstitions. Ainsi
librs de leurs peurs ancestrales, les hommes ont pu fonder des
familles harmonieuses et crer des entreprises de qualit. Par
ses encouragements rechercher la sagesse et la connaissance,
la Bible a ouvert lesprit humain et lui a donn laudace de la
UHFKHUFKHVFLHQWLTXH
/HFRPPDQGHPHQWGDLPHUVRQSURFKDLQFRPPHVRLPrPHHVW
le fondement de la reconnaissance de lgalit des hommes. Cette
prise de conscience de la valeur de lautre a permis de combattre
lesclavage et de donner naissance des structures dassistance
(hpitaux, assurances sociales, actions humanitaires, etc.).
Oui, lvangile a la capacit de changer le monde et un examen
objectif de son impact dans lHistoire permet de mesurer
OH[WUDRUGLQDLUHEpQpFHTXLODDSSRUWpjOKXPDQLWp
Certes, tout nest pas parfait et il est aussi juste de mentionner que
le monde a fortement souffert des drives chrtiennes. Combien
dabominations ou de mchancets ont t indment signes avec
la croix du Christ ?
Dieu est amour et ceux qui Par une sauvage trahison, le message de
laccueillent sont appels celui qui a offert sa vie pour les autres
tre les porteurs de cette a t brandi comme un drapeau par des
affection divine, une denre
essentielle et prcieuse dont hommes aux ambitions sanguinaires et
ce monde a besoin.
cupides.
Toutes ces drives ont prouv, sil le fallait, le terrible danger de
ne prendre dans lvangile que lemballage et de se draper dans un
FKULVWLDQLVPHGDSSDUHQFH,OQHVXIWSDVj'LHXGHGRQQHUODYLH
pour que celle-ci sapplique dans le monde. Cette vie, lhomme
doit encore la dsirer et la suivre :
Jai mis devant toi la vie et la mort, la bndiction et
OD PDOpGLFWLRQ &KRLVLV OD YLH DQ TXH WX YLYHV WRL HW WHV
descendants. Deutronome 30.19

12

Choisis la vie...

Introduction

Oui, le Christ de lvangile est capable de changer, de transformer,


de dvelopper et mme de ressusciter. Mais pour cela, il faut
encore que nous soyons disposs le suivre.
Cest avec ce dsir de marcher sur le bon chemin que ce livre vous
invite approfondir les valeurs de lvangile.
Cet ouvrage est organis de manire aborder les diffrents aspects
qui concernent les valeurs de lvangile. Le dcoupage est fait
de faon largir progressivement le cercle de rayonnement. Les
thmes commencent par aborder certains fondements spirituels et
personnels pour ensuite aborder les sujets du couple, de la famille,
de lglise, du travail et de la socit.
Cette succession de thmes
rejoint les sept engagements de
la CHARTE+ qui apparaissent en
introduction des chapitres.

La croix sur laquelle Jsus sest


donn pour le salut des hommes
est devenue le signe qui marque un
plus pour le monde.

La Charte+
La CHARTE+ est un moyen
de souligner les diffrentes
dimensions dans lesquelles
lvangile peut et doit
apporter un plus.
En consquence, la charte
vise nous encourager
tre des serviteurs de Dieu
consquents et que les valeurs
de lvangile portent leurs
fruits au sein de la socit.
Vous trouverez davantage
dinformations
sur
la
CHARTE+ en consultant les
renseignements
pratiques
TXLVHWURXYHQWjODQGHFHW
ouvrage.
13

Notes personnelles

14

CHOISIS LA VIE...
1. ENGAGEMENT
Je crois au Dieu damour et crateur qui agit par son Esprit
Saint. Il sest rvl et a manifest sa grce par loeuvre de Jsus-
Christ. Par cette charte, je mengage chercher grandir dans
lamour du prochain et dans le respect de la justice. Conscient
de mes limites, je prends cet engagement en invoquant laide
de Dieu et je promets de refuser tout recours la sorcellerie,
aux pratiques occultes et aux superstitions qui enchanent les
consciences et perturbent les relations.
Lorsque javais environ 18 ans, jtais trs impliqu dans un
groupe qui rassemblait de nombreux jeunes. Grce diverses
activits sportives, spirituelles et fraternelles, le groupe exerait
un rayonnement dans toute la rgion. Pour prsenter lvangile
aux jeunes de la rue, nous avions amnag un ancien magasin
donnant sur la rue pour en faire un lieu daccueil. Plusieurs soirs
par semaine, nous invitions les jeunes venir nous rejoindre pour
aborder les questions de la foi autour dune petite collation.
Lors dune de ces soires, un jeune homme dorigine africaine
est venu nous rencontrer car il dsirait en savoir plus sur la foi.
$XOGXSDUWDJHQRXVSRXYLRQVYRLUVRQLQWpUrWJUDQGLVVDQWSRXU
lvangile. Pour rpondre son dsir de connatre Dieu, nous
lavons invit nous suivre dans un petit salon que nous avions
amnag lcart. Dans cet endroit plus calme, nous pouvions
prier.
Aprs un court partage, nous avons commenc prier en demandant
lEsprit de Dieu dagir dans sa vie. cet instant, quelque chose
de surprenant sest pass ; lhomme, jusque-l parfaitement
normal, sest subitement jet sur le sol et a commenc gmir
et ramper comme un serpent. Par les rcits des vangiles, nous
savions que Jsus avait t confront des personnes agites par
des forces spirituelles et nous en avions aussi dj vu pousser des
FULVHWSHUGUHOHXUFRQWU{OHjFDXVHGLQXHQFHVGLDEROLTXHV
Mais ce qui tait impressionnant avec cet homme, ctait le
passage brutal entre une condition normale et une vie domine.
15

Engagement
Introduction

Choisis la vie...

Lorsque nous priions, il tombait par terre et rampait et, lorsque


nous arrtions, il se relevait et redevenait normal.
4XHOOHVpWDLHQWOHVUDLVRQVGXQWHOFKDQJHPHQWGDWWLWXGH"
Aprs lavoir interrog sur son pass, nous avons appris que cet
homme avait t gravement malade et que ses parents lavaient
emmen vers un sorcier. Celui-ci avait pratiqu plusieurs
LQFDQWDWLRQV HW VDFULp XQ DQLPDO SRXU VD JXpULVRQ 'HSXLV FH
jour-l, sa sant stait amliore mais il navait plus le droit de
manger de la viande de cet animal.
Par les ractions tonnantes que suscitait la prire chez cet homme,
il apparaissait clairement que ce qui stait pass avec le sorcier
avait des consquences beaucoup plus profondes dans sa vie.
Sur le plan spirituel, cet homme ntait pas libre et la force qui le
tenait ragissait lorsque nous demandions Dieu dagir dans sa
vie. Cette exprience est reste grave dans ma mmoire comme
une illustration du combat qui se joue lintrieur de notre vie.
Pour comprendre les enjeux lis ces aspects spirituels, il nous
faut revenir aux origines.

Les fondements spirituels de la cration


Ds ses premires pages, la Bible nous apprend que Dieu a initi
la cration par sa Parole. Lautorit et la sagesse contenue dans sa
volont ont conduit un processus de dveloppement qui a cr
lunivers, la matire et toutes les espces vivantes qui peuplent la
Terre.
Au commencement tait la Parole,
et la Parole tait avec Dieu, et la
Parole tait Dieu. Elle tait au
commencement avec Dieu. Toutes
choses ont t faites par elle, et rien
de ce qui a t fait na t fait sans
elle. Jean 1.1-3
La foi est une ferme assurance des choses quon espre, une
dmonstration de celles quon ne voit pas. (). Cest par la foi
que nous reconnaissons que lunivers a t form par la parole
de Dieu, en sorte que ce quon voit na pas t fait de choses
visibles. Hbreux 11.1-3

16

Choisis la vie...

Engagement
Introduction

Cette rvlation du Dieu crateur est lun des principaux


fondements de la foi, cest pourquoi la CHARTE+ commence
par nous inviter confesser que Dieu est la source de tout. Cest
lui qui a conu et cr lunivers dans lequel nous sommes. En
consquence, toutes les belles choses qui nous entourent et nous
constituent sont issues de ses paroles cratrices initiales.
Cet acte de foi nous amne reconnatre que Dieu est le fondement
indispensable toute vie : lhomme, quil soit athe ou croyant, est
totalement suspendu au bon vouloir de Dieu ! Cest une situation
de dpendance quil est bon de mditer.
Prendre conscience de la suprmatie de Dieu est une dmarche
indispensable pour nous, les hommes, car nous ne sommes pas
des cratures comme les autres. Certes, nous partageons avec
les animaux une condition biologique ; comme eux, nous avons
besoin de respirer et de nous nourrir Mais toutes ces choses
terrestres ne sont quune facette de notre nature humaine car nous
avons t crs pour un projet bien plus ambitieux.

LE PROCESSUS DE CRATION

Du nant la vie...
La rvlation biblique prsente lextraordinaire impulsion des paroles de Dieu.
Celles-ci lancent la naissance de lunivers et dirigent lvolution de la vie.

Pour les hommes limits que nous sommes, il est impossible


GLPDJLQHUHWGHFRQFHYRLUFHTXLDSUpFpGpODFUpDWLRQORUVTXLO
nexistait ni temps, ni univers, ni vie, ni matire. Dans cette
dimension, rien de ce nous connaissons nexistait. Cependant le
Saint-Esprit qui sonde tout, mme les profondeurs de Dieu,1 a pris
1

Voir 1 Corinthiens 2.10.

17

Engagement
Introduction

Choisis la vie...

la peine de nous dvoiler une partie de ces mystres. Par la Bible,


il nous apporte des rvlations sur les raisons qui ont conduit
notre cration.
Au commencement Dieu cra les cieux et la terre Gense 1.1

Comme le dvoile le premier chapitre de la Bible, notre monde est


le fruit de neuf paroles divines donnes dans un espace symbolique
de sept jours1&HWWHSURJUHVVLRQSDUWGXGpVRUGUHLQLWLDOGXWRKX
ERKX 2, traverse les tapes de la matire et du monde vgtal
et animal pour aboutir la cration de lhumanit. Notons que
FH SURFHVVXV HVW HQ DFFRUG DYHF OHV GpFRXYHUWHV VFLHQWLTXHV
TXL FRQUPHQW TXH OD PDWLqUH HW OD YLH VH VRQW IRUPpHV SDU XQ
mouvement complexe dvolution. Cependant, tout cela ne sest
pas fait par hasard ou par des mcanismes dadaptation. Lorsque
'LHXDODQFpODFUpDWLRQGHOXQLYHUVLODYDLWGpMjXQHYLVLRQ
prcise de lobjectif quil dsirait atteindre. Selon son dsir, la
cration serait lcrin lui permettant de dposer une part de lui-
mme.
Cest pour rvler ce projet dimplication de Dieu que la Bible
SUpFLVHTXHOKRPPHWLUpGHODSRXVVLqUHGHOD7HUUHUHoRLW
une dimension spirituelle et divine. Ce privilge lui est donn
SDUOLQWHUYHQWLRQVSpFLTXHHWSHUVRQQHOOHGX&UpDWHXU'DQVOD
Gense, cette implication a lieu lorsque Dieu donne lhomme
VRQVRXIHSDUXQEDLVHUUHPSOLGDIIHFWLRQ
Lternel Dieu forma lhomme de la poussire de la terre, il
VRXIDGDQVVHVQDULQHVXQVRXIHGHYLHHWOKRPPHGHYLQWXQH
me vivante. Gense 2.7
1

Ces jours de la cration ne sont pas des priodes de 24 heures car ce nest que
le quatrime jour que le soleil apparat et que le septime jour (qui est celui du
UHSRVGH'LHX QDSDVGHQ&HVSUpFLVLRQVLQGLTXHQWTXHOHVVHSWMRXUVTXL
servent de cadre la cration, ne sont pas temporels mais symboliques ; ils font
UpIpUHQFHjODSXLVVDQFHTXLpPDQHGH'LHX&HVVHSWOXPLqUHVTXLpFODLUHQW
successivement la cration, sont un processus divin qui permet de former
lunivers, la vie et lhomme (voir Jean 1.4). Cette rvlation spirituelle sur la
FUpDWLRQQHVRSSRVHDXFXQHPHQWDX[GpFRXYHUWHVVFLHQWLTXHVTXLGpPRQWUHQW
que lunivers sest form durant plusieurs milliards dannes.

&HVPRWVKpEUHX[FLWpVGDQVOHSUHPLHUYHUVHWGHOD*HQqVHVLJQLHQWLQIRUPH
YLGHQpDQWDEVHQFH

18

Choisis la vie...

Engagement
Introduction

3DU FH  ERXFKHjERXFKH  YLWDO OKRPPH UHoRLW OD IDFXOWp


daccueillir lEsprit de Dieu. Cette capacit spirituelle transcende
sa dimension charnelle et terrestre et lui permet dtablir une
communion directe et personnelle avec son Crateur.
Comme il est ais de le comprendre,
les dimensions matrielles et biolo-
giques de lhomme (la poussire)
ne sont que dhumbles supports
compars lextraordinaire capa-
cit qui lui permet de vivre une
dimension spirituelle. Cest pour-
quoi, dans la Bible, lhomme nest
SDVGpQLSDUVHVGLPHQVLRQVSK\-
VLTXHVRXSDUFHTXLOSURWHGXQH
intelligence suprieure aux autres
espces ; son statut repose sur un
privilge unique et prcieux : tre
une crature qui accueille en son
sein une part de son Crateur.

LESPRIT
Le souffle qui
vient de Dieu
apporte la vie
spirituelle.

Cest donc lEsprit qui vient de Dieu qui donne lhomme son
sens existentiel1. Cet Esprit divin est au-dessus de la cration et
nest pas soumis aux lois de la physique et de la matire. LEsprit
nest donc pas une prsence que lon peut observer avec le regard
RXGHVDSSDUHLOVVFLHQWLTXHVLOHVWOHIRQGHPHQWKRUVGXWHPSV
et de lespace, qui supporte la cration. Pour nous aider saisir
la nature et limportance de lEsprit invisible, la Bible utilise le
V\PEROH GX  VRXIH  6XU XQ SODQ ELRORJLTXH QRWUH SUHPLHU
VRXIH D HX OLHX ORUV GH QRWUH QDLVVDQFH HW UpSRQG j XQ EHVRLQ
essentiel de notre organisme ; quelques minutes sans respirer
seraient fatales.

Lhistoire dAdam et ve fait rfrence au premier couple qui a reu cette


dimension spirituelle. Une vocation bien suprieure celle des autres hominids
qui taient aussi prsents sur la terre et que la Bible mentionne, par exemple,
dans Gense 4.11.

19

Engagement
Introduction

Choisis la vie...

&HWWH SDUW YLWDOH GX VRXIH ELRORJLTXH SHUPHW GH FRPSUHQGUH


limportance de lEsprit qui vient de Dieu. Lorsque lhomme
reoit cette prsence divine, il obtient une part de lextraordinaire
SXLVVDQFHTXLDFUppOXQLYHUV$YHFFHVRXIHOKRPPHQDvW
HW UHVSLUH VHORQ O(VSULW HW LO GHYLHQW XQ rWUH  FRQQHFWp  j OD
source spirituelle qui domine toutes les dimensions matrielles.
En Christ, Dieu nous a lus avant la fondation du monde, pour
que nous soyons saints et irrprochables devant lui. phsiens 1.4

Quel mystre et quelle grandeur pour lhomme qui est, ds lors,


QRQ VHXOHPHQW FUpp VHORQ XQH OLDWLRQ WHUUHVWUH HW ELRORJLTXH
mais aussi avec un patrimoine venu directement de Dieu. Cette
vocation extraordinaire donne lhomme lhonneur de devenir
OVGH'LHX1&HWWHGLJQLWpGrWUHHQIDQWGH'LHXVXUSDVVH
WRXWHVOHVDXWUHV3DUHOOHOKRPPHUHoRLWOHVTXDOLFDWLRQVSRXU
grer la cration et vivre en communion avec Dieu par lEsprit ;
cette position de ltre humain saccompagne dune autorit sur
les cratures physiques et spirituelles qui lenvironnent.
Soulignons que, si lhomme est invit vivre en communion avec
Dieu, cette relation nest pas force. Lhomme na pas t conu
comme un robot ; il est un tre libre.
Cette autonomie est lune des prcieuses expressions
de lamour de Dieu. Elle sapparente lengagement
qui lie un homme et une femme dans le mariage.
Pour vivre une relle communion damour, le lien
qui unit le couple doit tre librement consenti.
Sans libert, la relation se rsume une domination. En accordant
son esprit lhomme, Dieu fait de lui un vis--vis sans chanes.
L o est lEsprit, l est la libert. 2 Corinthiens 3.17

Dans le jardin dden, cette libert sexprime par la possibilit


de rompre la communion avec Dieu. Lhomme a linterdiction
GHWRXFKHUDX[IUXLWVGHODUEUHGHODFRQQDLVVDQFHGXELHQHW

20

Luc 3.28 : $GDPOVGH'LHX

Choisis la vie...

Engagement
Introduction

GXPDO1. Cependant il ne sagit pas ici dune rgle alimentaire


car cet arbre reprsente un espace dautonomie situ hors de la
volont de Dieu. Cela pourrait tre rsum en disant que lhomme
peut faire tout ce quil veut dans le jardin qui lui est donn (la
Terre), except une chose : casser le lien qui le maintient dans la
communion avec son Crateur.
Dans lexercice de cette libert, deux voies soffrent lhomme :
soit progresser dans la communion avec Dieu en reconnaissant
sa sagesse et sa grandeur, soit rgresser en considrant que la
cration est plus importante que le Crateur.
Avec ces deux options, lhomme peut choisir de respecter
lautorit juste et aimante exprime par la Parole de Dieu ou
DORUVURPSUHVDFRPPXQLRQDYHF'LHXSRXUSURWHUVDQVDXFXQH

*HQqVH  ,O QHVW SDV IDFLOH GH FRPSUHQGUH OD VLJQLFDWLRQ GH  OD
FRQQDLVVDQFH GX ELHQ HW GX PDO  'DQV OD *HQqVH FHWWH FRQQDLVVDQFH HVW
prsente comme le fruit de lun des arbres du jardin. Elle fait donc partie
de la cration et se trouve proximit de lhomme. Elle nest cependant pas
EpQpTXHSRXUOXLHWSHXWOHFRQGXLUHjODPRUW4XHVWFHTXHFHODYHXWGLUH"

Linterprtation qui parat la plus plausible est que cette connaissance reprsente
une charge morale et spirituelle que lhomme ne peut et ne doit pas porter.
'pQLUFHTXLHVWELHQHWFHTXLHVWPDODSSDUWLHQWj'LHX6LOKRPPHGpQLW
lui-mme ce qui lui semble bon, il va le faire selon ses propres intrts. Le droit
jODYRUWHPHQWSUpVHQWpSDUFHUWDLQVFRPPHXQGURLWERQSRXUOHVIHPPHVHVW
OH[HPSOHW\SHGXQHYDOHXUGpIHQGXHFRPPHXQELHQDORUVPrPHTXHOOH
conduit au massacre de millions de vies (dont plus de la moiti sont des femmes
en devenir !). Remarquons que dans le rcit de la Gense, la consquence de
goter larbre de la connaissance conduit lhomme et la femme se sentir nus
et chercher un vtement capable de cacher leur condition devant Dieu. Ce
besoin de vtement sexprime dans le monde par la multitude de religions qui
visent calmer la profonde culpabilit de lhomme. Une personne religieuse
sera persuade que ses rites et ses offrandes lui permettent de se prsenter
dignement devant Dieu. Mais toutes ces choses ne peuvent pas vtir lhomme.
Pour chapper lemprise de ces vaines religions, lhomme doit recevoir
un vtement de grce. Cest ce vtement, apport par Dieu, qui permettra
lhomme dtre digne devant lui.

21

Engagement
Introduction

Choisis la vie...

rgle, de la cration.1 Notons que ce chemin, qui nous loigne de


Dieu, va forcment du ct du nant, vers le WRKXERKX originel
et chaotique.2

La rupture
Dans le jardin, lhomme tait dj en face de la vie et de la mort
et linvitation divine ne pas cder la tentation est dj un
UHWHQWLVVDQWDSSHOjFKRLVLVODYLH
Mais, comme dans le cas dAdam et dve, lhomme ne suit pas
ce conseil et cde la tentation qui linvite suivre le chemin de
la mort.
Pour sengager dans cette voie, lhomme choisit de se dissocier
de son Crateur pour se livrer la cration. Ce terrible processus
conduit ltre humain mpriser sa royaut et son autorit
spirituelle pour sasservir son environnement.
Ainsi, ce nest pas sans raison que la Bible reprsente le diable
sous la forme symbolique dun serpent. Il est lune des cratures
du jardin places sous la gestion de lhomme. Avec son autorit,
lhomme pouvait facilement rejeter toutes les tentatives visant
lloigner de Dieu. Mais lhomme choisit daliner sa
VRXYHUDLQHWp HQ FpGDQW j OLQYLWDWLRQ UHEHOOH TXL  PRQWH  GH
son royaume. Par ce choix, il devient lacteur dune tonnante
conspiration contre Dieu.
1

,O HVW ELHQ GLIFLOH SRXU QRXV OHV KRPPHV GH FRPSUHQGUH FH TXH VLJQLH
la Parole de Dieu. Celle-ci ne consiste pas en des mots et ne se limite pas
aux prcieux textes bibliques. Avec les progrs de la science nous avons pu
dcouvrir lextraordinaire intelligence qui se cache aux curs des semences
terrestres. Ainsi, chaque tre humain est, avant sa naissance, une minuscule
cellule dans laquelle sont inscrites les informations qui vont permettre de
le dvelopper. Chaque tre est donc lorigine un message qui, comme un
logiciel, abrite la facult de lancer un processus complexe. Cet exemple, qui
ne concerne que la vie biologique, nous donne un aperu des proprits dun
PHVVDJH XQH  SDUROH  TXL DEULWH XQH SXLVVDQFH FDSDEOH GDFFRPSOLU XQH
cration. La capacit de la Parole de Dieu, qui abrite sa sagesse et sa volont,
surpasse les merveilles biologiques et les possibilits de notre comprhension.

Ne vous en dtournez pas ; sinon, vous iriez aprs des choses de nant, qui
QDSSRUWHQWQLSURWQLGpOLYUDQFHSDUFHTXHFHVRQWGHVFKRVHVGHQpDQW
1 Samuel 12.21. Comme lindique cette rfrence biblique, cest bien vers le
mme nant prcdant la cration (tohou en hbreu) vers lequel les hommes se
dirigent en dsobissant Dieu.

22

Engagement
Introduction

Choisis la vie...

La stratgie du diable
Le rcit de la Gense met en lumire le mystrieux processus du
PDOTXLSHUPHWDXVHUSHQWGHSUHQGUHDXWRULWpVXUQRWUHYLH
Dans un premier temps, lhomme se laisse sduire par un mensonge
diabolique qui lui fait croire quil peut saffranchir de sa condition
de crature pour devenir un dieu. Cet lan dorgueil conduit ltre
humain couper lalliance qui lunit son Crateur pour suivre
docilement linvitation de Satan.1

LE CHOIX DE ROMPRE LALLIANCE


LA CRATION

DIEU
Alliance RESTE

VIENS...
Nant
Tentation

POUSSIRE

Communion

ESPRIT

Le rcit de la Gense prsente le choix fondamental entre la vie et la mort.


Lhomme est invit et non forc rester dans la communion avec Dieu. La
tentation diabolique vise lloigner de la prsence divine.

Lacte qui consiste cder la tentation a des consquences


terribles et lorsque la rupture est consomme, lEsprit de Dieu
ne saurait rester dans lhomme. Ds lors, celui-ci retombe dans
une condition quasi animale. Cette mort spirituelle est illustre
dans les paroles donnes par Jsus lorsquil invite un disciple le
suivre : Laisse les morts enterrer les morts. 2
1

/HVWDWXWDFFRUGpjOKRPPHGrWUHOHPDvWUHGHODFUpDWLRQHVWXQHSRVLWLRQ
enviable et lobjet de la convoitise de Satan. Cest pourquoi ce dernier cherche
prendre le rle de Dieu pour obtenir une autorit dans la cration. Lorsque
lhomme se spare de lautorit de Dieu, il permet Satan de prendre une place
centrale dans son cur et de diriger son environnement.

Matthieu 8.22, Luc 9.60.

23

Engagement
Introduction

Choisis la vie...

Limportance de ladoration
Le processus de rupture entre les hommes et Dieu concerne le
lien privilgi qui relie lhomme son Crateur. Ce lien vital et
prcieux est en relation troite avec la personne de Dieu, car Dieu
est amour.
Ce grand mystre mditer permet de comprendre que lattache
essentielle entre lhomme et Dieu rside dans lamour.
Aimer Dieu, cest le centre, le lien essentiel et vital autour duquel
va se jouer et se joue encore le destin de lhomme.
Cet amour spirituel se manifeste par ladoration que lhomme
adresse son Crateur. Lexercice de cette communion librement
consentie est dpourvu de contrainte. Lhomme choisit dadorer
Dieu parce quil laime.
Grce ce rle essentiel, ladoration permet dtablir un lien
spirituel privilgi qui tablit une autorit divine sur lhomme.
Ladoration est par consquent semblable la dcision dlecteurs
TXLYRWHQWSRXUFKRLVLUFHOXLTXLH[HUFHUDODUR\DXWpVXUHX[
Tout lenjeu entre lhomme et Dieu se joue dans lamour qui les
unit.

Le dsir du diable est de prendre une place divine dans le cur


des hommes. Son objectif vise donc forcment de sattaquer
ladoration qui monte vers Dieu pour se lapproprier et cest
pourquoi il invite les hommes se dtourner de Dieu pour se
prosterner devant lui.1
&HGpWRXUQHPHQWGHQRWUHDGRUDWLRQYHUVODFUpDWXUHDFFRUGH
un droit Satan, ce dernier pouvant ds lors nous dominer.
Comme lillustre la spirale indique dans notre schma, en offrant une
crature ladoration qui revient Dieu, lhomme a introduit un scandale
WHUULDQWGDQVQRWUHXQLYHUVDXOLHXGrWUHWRXUQpHYHUVODVRXUFHGHYLH
HWGDPRXUODFUpDWLRQVHVWHQIHUPpHVXUHOOHPrPH
1

24

Le diable le transporta encore sur une montagne trs leve, lui montra
WRXVOHVUR\DXPHVGXPRQGHHWOHXUJORLUHHWOXLGLW-HWHGRQQHUDLWRXWHVFHV
FKRVHVVLWXWHSURVWHUQHVHWPDGRUHV-pVXVOXLGLW5HWLUHWRL6DWDQ&DULO
HVWpFULW7XDGRUHUDVOH6HLJQHXUWRQ'LHXHWWXOHVHUYLUDVOXLVHXO$ORUVOH
diable le laissa. Et voici, des anges vinrent auprs de Jsus, et le servirent.
Matthieu 4.8-11 (voir aussi Luc 4.5-8).

Engagement
Introduction

Choisis la vie...

LE PROCESSUS DE DOMINATION

Emprise
Adoration

Puissance diabolique

Masque religieux

Homme prostern

Celui que tu adores et qui tu reconnais le pouvoir de conduire ta vie spirituelle


aura un droit sur toi. Pour comprendre cette ralit spirituelle, il faut se rappeler
que le diable fait partie de ce monde, il est une crature. Son seul moyen dobtenir
un droit sur lhomme est de le conduire ladorer. Ce mcanisme de sduction
conduit lhomme se prosterner (souvent son insu) devant Satan.

Les maldictions de lidoltrie


Beaucoup de personnes considrent la tentation du jardin dden
comme une histoire ancienne ou imaginaire et qui na donc
aucune implication dans la vie actuelle. Pourtant, cet pisode, qui
a touch lhumanit ses origines, nest pas enferm dans le pass.
En effet, lacte qui a conduit casser la communion entre Dieu et
les hommes est le premier maillon dune longue chane dactions
similaires qui ne cessent de se reproduire dans lhumanit. Cest
SDUFHVDFWHVTXHOHVHUSHQWVpGXFWHXUH[HUFHFRQVWDPPHQWVRQ
LQXHQFHGDQVO+LVWRLUH
Concrtement, cette stratgie se manifeste par les nombreuses
expressions de lidoltrie qui conduisent les hommes se dtourner
spirituellement du vrai Dieu. Par ces cultes, le lien entre lhomme
HW'LHXHVWURPSXOD3DUROHGH'LHXHVWEULVpHHW6DWDQREWLHQW
un droit sur les vies.1 La perte de la connexion entre lhomme et
son Crateur entrane toute la cration dans une errance de vanit.2
1

Les consquences du pch sur la Parole sont par exemple observables lorsque
Mose reoit les tables de la loi crites par Dieu. Lidoltrie du peuple casse
lalliance et les paroles sont brises : Et, comme il approchait du camp, il vit
OHYHDXHWOHVGDQVHV/DFROqUHGH0RwVHVHQDPPDLOMHWDGHVHVPDLQVOHV
tables, et les brisa au pied de la montagne. Exode 31.19.

Voir Romains 8.20.

25

Engagement
Introduction

Choisis la vie...

Par consquent, chaque fois quune personne rend un culte un


autre que Dieu, elle cautionne la rupture consomme lors du pch
RULJLQHOHWFUpHXQHRXYHUWXUHjGHVIRUFHVPDOpTXHV
Satan a tout intrt nous loigner de notre Crateur car plus nous
sommes loigns de Dieu, plus nous sommes faibles et sa merci.

UNE ALLIANCE AVEC LE MAL


DIEU

Alliance
Rupture

CRATION
Dchance

Nant

POUSSIRE

ESPRIT

Comme le montre ce dessin, la capacit de lhomme exercer lautorit sur la


cration dpend de sa proximit avec le Crateur.
/RUVTXHOKRPPHHVWHQFRPPXQLRQDYHF'LHXOHVHUSHQWSHUGVRQSRXYRLU
mais lorsque lhomme est en rupture, le diable peut le dominer et lentraner dans
la dchance.

Lemprise diabolique qui sexerce dans le monde est proportion-


nelle lidoltrie et la mchancet des hommes, cest pourquoi
le simple fait de vnrer les astres, des lieux, des objets, des ani-
maux ou des tres humains est un moyen daccorder un pouvoir
Satan.
Les pratiques occultes, la sorcellerie et toutes les activits qui
consistent faire le mal ou sopposer la volont de Dieu crent
des ouvertures qui permettent Satan dagir et de contrler nos
ambitions.
Cette domination conduit progressivement les hommes ne plus
tre matres de leurs sentiments, de leurs penses et de leurs actes.
,QXHQFpVSDUFHVIRUFHVREVFXUHVLOVGHYLHQQHQWYLROHQWVIRQWGX
mal, vivent dans la peur, terrorisent leur entourage et deviennent
leur tour des instruments qui sduisent les autres et les invitent
rendre des cultes au prince des tnbres.
26

Engagement
Introduction

Choisis la vie...

LIDOLTRIE

DIEU

Nant

Toute adoration tourne vers un autre que Dieu conduit soumettre sa vie des
forces de nant. Sans vie et sans force, elles ne peuvent sauver et conduisent
lhomme lignorance et la stupidit.

Veille sur ton me, de peur que, levant tes yeux vers le ciel, et
voyant le soleil, la lune et les toiles, toute larme des cieux, tu
ne sois entran te prosterner en leur prsence et leur rendre
un culte. Deutronome 4.19

Lorsque la communaut humaine se laisse entraner dans cette


idoltrie, la sduction contamine ses croyances et dtruit les
fondements qui permettent lhomme de grer la socit et son
environnement. Le monde est malheureusement rempli dexemples
dans lesquels les processus de dveloppement sont mis en chec
par des superstitions cruelles et stupides.1
8QH IRLV SODFp VRXV OD GRPLQDWLRQ GX  3KDUDRQ  GLDEROLTXH
lhomme perd ses capacits de grant et devient un esclave domin
et soumis.2 Par cette situation, Satan obtient le droit dhabiter
les curs et de contaminer la culture sociale par le mal. Cette
maldiction dtruit les vies, les familles, les villages et les pays.
Cest pour contrer ce processus de destruction que la Bible
dnonce fermement toutes les pratiques occultes, linvocation
GHV PRUWV OHV VDFULFHV DQLPLVWHV OHV VXSHUVWLWLRQV ODPRXU GH
1

Notons que la sduction peut aussi prendre la forme dun orgueil spirituel par
lequel quelquun prtendrait faire le bien en sappuyant entirement sur sa
propre vision de la justice.

Lesclavage des Juifs sous la domination du pharaon gyptien est un bon


exemple de la mainmise exerce par le diable pour dominer lhumanit. cette
poque, les Juifs choisis pour vivre dans la relation avec Dieu ne pouvaient plus
lui rendre un culte car ils taient asservis aux volonts et projets de Pharaon.

27

Engagement
Introduction

Choisis la vie...

largent, etc. Toutes ces choses sont des portes qui souvrent sur
un monde de maldictions.
 4XRQ QH WURXYH FKH] WRL SHUVRQQH TXL IDVVH SDVVHU VRQ OV
RX VD OOH SDU OH IHX SHUVRQQH TXL H[HUFH OH PpWLHU GH GHYLQ
dastrologue, daugure, de magicien, denchanteur, personne
qui consulte ceux qui voquent les esprits ou disent la bonne
aventure, personne qui interroge les morts. Car quiconque fait
ces choses est en abomination lternel ; et cest cause
de ces abominations que lternel, ton Dieu, va chasser ces
nations devant toi. Tu seras entirement lternel, ton Dieu.
Deutronome 18.10-13

Par ces avertissements, Dieu cherche nous mettre en garde


contre les terribles mcanismes dasservissement qui conduisent
rduire lhomme en esclavage.
Car, dans ce monde, personne nchappe lemprise du mal et il
nexiste aucun individu mme daccueillir par lui-mme lEsprit
de Dieu. Dans cette situation, les hommes se retrouvent donc
privs de la force et de la sagesse qui leur permettraient de bien
grer la cration.1
Un diamant
/DYLHKXPDLQHVDQV'LHXHVWVHPEODEOHjXQPDJQLTXHpFULQGDQVOHTXHOOH
prcieux diamant est remplac par un scorpion. Certes, la bote est toujours
luxueuse et la forme intrieure a toujours lempreinte du bijou, mais le contenu
est laid et venimeux.
De mme, lorsque lhomme na pas lEsprit de Dieu, il perd le sens mme
de son existence, sa vie biologique (la bote) est souille et il na aucun moyen
de changer le contenu de son cur. Pour que les choses changent, il a besoin que
Dieu cre et dpose un nouveau diamant.

Je suis une crature phmre, passant dans la vie comme une


hirondelle du ciel. Je suis un esprit venu de Dieu et retournant
Dieu, apparaissant un instant avant de basculer dans lternit
LPPXDEOH -H QH YHX[ FRQQDvWUH TXXQH FKRVH  OH FKHPLQ GX
ciel. Dieu a bien voulu me montrer ce chemin, cest pourquoi il
GHVFHQGLWVXUODWHUUH&HVWpFULWGDQVXQOLYUH'RQQH]PRLOH
livre de Dieu ! Il contient tout ce que jai besoin de savoir. Que
je sois lhomme de ce seul livre ! John Wesley (1703-1791), fondateur
de lglise mthodiste.

28

Voir Romains 3.23, 5.12.

Engagement
Introduction

Choisis la vie...

Le besoin dune nouvelle naissance


La vie humaine dconnecte de Dieu est semblable celle dun
embryon dans le ventre de sa mre. Enferm dans la matrice, le
ftus est totalement connect sa mre et considre que cest elle
la source et le sens de son existence.
Pourtant, lenfant ne doit pas rester dans cet espace ferm et, par
sa naissance, il peut entrer dans la vie et faire la connaissance de
son pre, qui est aussi lorigine de sa conception.
Dans lvangile de Jean, Jsus parle un religieux en indiquant
que lhomme a besoin de passer par ltape de la naissance pour
voir le royaume de Dieu. Pour rpondre ltonnement de son
interlocuteur, il souligne que cette nouvelle naissance spirituelle
est le seul moyen dentrer dans la dimension du Royaume de
Dieu.
En vrit, en vrit, je te le dis, si un homme ne nat deau et
dEsprit, il ne peut entrer dans le royaume de Dieu. Ce qui est
n de la chair est chair, et ce qui est n de lEsprit est Esprit.
Jean 3.4

Dans la rvlation biblique, Dieu nous est prsent comme notre


Pre cleste, ce titre affectueux souligne la distance entre la
dimension maternelle de la cration, qui donne la vie biologique,
et le Crateur qui donne la vie par lEsprit. Pour rencontrer et
connatre Dieu, lhomme doit natre spirituellement.
Sans cette tape, il demeure enferm dans la cration et considre
que la nature qui laccueille et le nourrit est le centre de tout. Il
ignore quil est le fruit du dsir de Dieu.
Un Sauveur connect
Pour percer ce mystre de la nouvelle naissance, il est ncessaire
de comprendre la nature spirituelle du Christ. Car, contrairement
aux autres hommes, Jsus nest pas venu parmi les hommes dans
une condition de rupture, il tait au contraire en totale communion
avec Dieu.
Il ny a pas de pire menace
pour le diable que celui qui
est avec Dieu et qui suit sa
volont.

29

Engagement
Introduction

Choisis la vie...

UN SAUVEUR EN COMMUNION
LES HOMMES
Rupture

AMOUR
DE DIEU

CHRIST
Union

VIE
Christ est celui
qui apporte le
Salut au monde
Cest parce que Jsus-Christ est en communion avec son Pre cleste quil peut
exercer un rle dambassadeur et apporter la rconciliation avec Dieu.

3DU FH OLHQ DYHF VRQ 3qUH FpOHVWH OH &KULVW SURWH GRQF GXQ
privilge unique : il est connect la source vivante et il est donc
le seul homme que lon puisse considrer comme pleinement
vivant. Cest un statut enviable quil aurait pu garder gostement
pour lui-mme.
Mais Dieu est amour et la venue du Christ sur la Terre ne visait
pas faire une dmonstration de sa supriorit. Jsus est venu
UpVROXPHQWDYHFOHGHVVHLQGHVHGRQQHUDQTXHO(VSULWGH9LH
qui lhabite nous habite aussi.
Quelle gnrosit ! Car, pour partager ce privilge, le Christ va
devoir accepter que le trsor de sa vie soit distribu lhumanit.
Plusieurs symboles bibliques cherchent nous faire comprendre
le mystre de loeuvre que le Christ a d accomplir en soffrant
au monde.
Jsus incarne lagneau de la Pque qui sera mang.

Lors de la cne, il devient le Pain de vie qui doit tre rompu
et partag.
Le Christ partage la coupe (symbole de son sang qui
reprsente sa Vie donne aux hommes).
30

Choisis la vie...

Engagement
Introduction

Toutes ces choses soulignent que le Christ est venu pour distribuer
ses richesses.
Toutefois, cause du mal et de la sduction, le cur des hommes
HVWWRXUQpYHUVXQGLHXUDPSDQWTXLOHVGRPLQHHWOHVUpGXLWHQ
esclavage. Dans ces conditions, la Terre nest pas un lieu daccueil
pour celui qui vient de Dieu et la venue de Jsus sest heurte
une profonde hostilit venant du diable et des hommes.1
Jsus a d constamment affronter cette puissance qui domine les
hommes et qui cherchera par tous les moyens le faire mourir.
Malgr tout, le Christ affrontera rsolument cette adversit pour
ouvrir une brche de libration. Sa vie offerte sur la croix devient
le point de convergence qui permet aux hommes de voir lamour
et la bont de Dieu.2
Or Dieu nuse pas de sduction pour obtenir ladoration de ses
cratures ! Mais lhomme trouve par la croix un tmoignage qui
met en lumire son idoltrie et qui linvite adorer le vrai Dieu.
La croix est comme une entaille dans le mur de sparation,
elle est louverture qui me permet de sortir de ma prison
pour entrer dans le royaume de Dieu.
Comme le montre le dessin de la page suivante, pour passer de la
mort la vie, il est ncessaire de rejeter rsolument la sduction
TXLPLQYLWHjYpQpUHUODFUpDWLRQDQGH UH WRXUQHUPRQFXU
vers Dieu. Par ce processus de conversion, il mest alors possible
de reconnatre la supriorit et lautorit de Dieu sur la cration.
Grce laccueil bienveillant de Dieu, je peux tisser un nouveau
lien de communion et chapper lemprise de la mort.
1

Voir lexpression de cette hostilit dans le chapitre sur la famille (page 93).

/D VLJQLFDWLRQ GX VDOXW DSSRUWp SDU -pVXV j OD FURL[ HVW VRXOLJQpH GDQV
un rcit du livre des Nombres (2.4-9). Lors de cet pisode, le peuple
juif soppose Dieu et parle contre lui. Cette attitude libre des serpents
venimeux qui mordent et font mourir le peuple. Face cette menace, Dieu
GHPDQGHj0RLVHGHIDLUHXQVHUSHQWHQEURQ]HTXLOGRLW[HUVXUXQHSHUFKH
Quiconque regardait ce serpent tait sauv. Dans les vangiles, Jsus indique
que la dmarche spirituelle qui consiste regarder le serpent sapplique aussi
OXL-pVXVYDrWUHpOHYpVXUODFURL[DQGRIIULUVRQVDOXWjFHX[TXLVHWRXUQHQW
vers lui : Et comme Mose leva le serpent dans le dsert, il faut de mme
TXH OH )LOV GH OKRPPH VRLW pOHYp DQ TXH TXLFRQTXH FURLW HQ OXL DLW OD YLH
ternelle. Jean 3.14-15.

31

Engagement
Introduction

Choisis la vie...

UNE RVLATION QUI SAUVE

Se tourner vers
la lumire
La
dmonstration
de lamour de
Dieu
La mort de Jsus sur la croix est le signe de lamour de Dieu que je dois regarder.
Cette rvlation me dsigne la porte que je dois traverser pour natre la nouvelle
vie.

La mort de Jsus la croix constitue le cur de la rvlation


biblique et de lhistoire humaine ; elle est la porte qui dbouche
dans une nouvelle dimension.
Comme le mentionne la CHARTE+, la croix est le signe
SOXVTXH'LHXDSODFpGDQVOHPRQGHSRXUOHVDXYHU

Cest par cette uvre extraordinaire que nous pouvons chapper
lemprise du mal pour appliquer lamour de Dieu dans notre vie
et dans notre entourage. Car, lorsque le Christ offre sa vie sur la
croix, il ouvre le passage qui me permet de natre et daller dans
la prsence de Dieu.
La rvlation de luvre du Christ sur la croix fait rfrence
une dmarche spirituelle profonde qui ne peut tre rsume en
quelques lignes. Cest un mystre que lon peut mditer sans
jamais toutefois en saisir la grandeur.
Car la prdication de la croix est une folie pour ceux qui
prissent ; mais pour nous qui sommes sauvs, elle est une
puissance de Dieu. 1 Corinthiens 1.18

32

Choisis la vie...

Engagement
Introduction

Dmarches concernant notre engagement


Comme nous lavons vu dans ce chapitre, notre vie est au centre
denjeux spirituels trs importants. Lengagement propos par
la CHARTE+ nous invite donc reconnatre que ce nest pas
par nos propres forces que nous pouvons choisir la Vie. Nous
avons besoin de la grce de Dieu et donc de suivre ces tapes
essentielles :
Reconnatre notre condition de mort spirituelle (absence de
lEsprit de Dieu).
Tourner notre cur vers Dieu et sappuyer avec foi sur
luvre de libration du Christ.
Confesser nos fautes et toutes les choses qui donnent un
droit au mal et sopposent la prsence de Dieu dans notre
vie.
Cesser radicalement toutes pratiques idoltres (sorcellerie
par exemple).
Invoquer la grce et le pardon apports par le Christ nous
SHUPHW GH SXULHU QRWUH FXU HW GRQF GRIIULU XQ HVSDFH
pour le Saint-Esprit).
Inviter Dieu venir habiter et animer notre vie par son
Esprit.

Ce chemin, qui permet de construire notre vie en Dieu, devrait


nous conduire manifester publiquement notre engagement dans
la mort et la rsurrection du Christ par le baptme deau et vivre
un revtement du Saint-Esprit.
Paul, aprs avoir parcouru les hautes provinces de lAsie,
arriva phse. Ayant rencontr quelques disciples, il leur
GLWDYH]YRXVUHoXOH6DLQW(VSULWTXDQGYRXVDYH]FUX",OV
OXLUpSRQGLUHQWQRXVQDYRQVSDVPrPHHQWHQGXGLUHTXLO\
DLWXQ6DLQW(VSULW,OGLWGHTXHOEDSWrPHDYH]YRXVGRQFpWp
EDSWLVpV"(WLOVUpSRQGLUHQWGXEDSWrPHGH-HDQ$ORUV3DXO
GLW-HDQDEDSWLVpGXEDSWrPHGHUHSHQWDQFHGLVDQWDXSHXSOH
GH FURLUH HQ FHOXL TXL YHQDLW DSUqV OXL FHVWjGLUH HQ -pVXV
Sur ces paroles, ils furent baptiss au nom du Seigneur Jsus.
/RUVTXH3DXOOHXUHXWLPSRVpOHVPDLQVOH6DLQW(VSULWYLQWVXU
eux, et ils parlaient en langues et prophtisaient. Ils taient en
tout environ douze hommes. Actes 19.1b-7

33

Engagement
Introduction

Choisis la vie...

Citations bibliques: lengagement spirituel


Veille sur ton me, de peur que, levant tes yeux vers le ciel, et voyant le
soleil, la lune et les toiles, toute larme des cieux, tu ne sois entran
te prosterner en leur prsence et leur rendre un culte. Deutronome 4.19
6RXYLHQVWRLGHO(WHUQHOWRQ'LHXFDUFHVWOXLTXLWHGRQQHUDGHOD
IRUFHSRXUOHVDFTXpULUDQGHFRQUPHUFRPPHLOOHIDLWDXMRXUGKXL
son alliance quil a jure tes pres. Si tu oublies lEternel, ton Dieu, et
que tu ailles aprs dautres dieux, si tu les sers et te prosternes devant
eux, je vous dclare formellement aujourdhui que vous prirez.
Deutronome 8.17-19

6LQRXVFRQIHVVRQVQRVSpFKpV'LHXHVWGqOHHWMXVWHSRXUQRXVOHV
SDUGRQQHUHWSRXUQRXVSXULHUGHWRXWHLQLTXLWp1 Jean 1.9
Lamour de Dieu a t manifest envers nous en ce que Dieu a envoy
VRQ)LOVXQLTXHGDQVOHPRQGHDQTXHQRXVYLYLRQVSDUOXL1 Jean 4.9
Tous ont pch et sont privs de la gloire de Dieu ; et ils sont
JUDWXLWHPHQWMXVWLpVSDUVDJUkFHSDUOHPR\HQGHODUpGHPSWLRQTXL
HVWHQ-pVXV&KULVW Romains 3.21
Que le Dieu de lesprance vous remplisse de toute joie et de toute
paix dans la foi, pour que vous abondiez en esprance, par la puissance
GX6DLQW(VSULW Romains 15.13
Si quelquun est en Christ, il est une nouvelle cration. Les choses
anciennes sont passes ; voici, toutes choses sont devenues nouvelles.
2 Corinthiens 5.17

9HLOOH]GHPHXUH]IHUPHVGDQVODIRLVR\H]GHVKRPPHVIRUWLH]YRXV
Que tout ce que vous faites se fasse avec amour ! 1 Corinthiens 16.13-14
Rendez grces au Pre, qui vous a rendus capables davoir part
lhritage des saints dans la lumire ; il nous a dlivrs de la puissance
GHVWpQqEUHVHWQRXVDWUDQVSRUWpVGDQVOHUR\DXPHGHVRQ)LOVELHQDLPp
en qui nous avons la rdemption, le pardon des pchs. Colossiens 1.12-14
Prenez garde, frres, que quelquun de vous nait un cur mauvais
HWLQFUpGXOHDXSRLQWGHVHGpWRXUQHUGX'LHXYLYDQW0DLVH[KRUWH]
YRXVOHVXQVOHVDXWUHVFKDTXHMRXUDXVVLORQJWHPSVTXRQSHXWGLUH
DXMRXUGKXL$QTXDXFXQGHYRXVQHVHQGXUFLVVHSDUODVpGXFWLRQ
du pch. Car nous sommes devenus participants de Christ, pourvu que
QRXVUHWHQLRQVIHUPHPHQWMXVTXjODQODVVXUDQFHTXHQRXVDYLRQVDX
commencement. Hbreux 3.12-14

34

CHOISIS LA VIE...
2. VIE PERSONNELLE
Sachant que ma vie est fragile et que je suis de passage sur la
terre, je mengage mettre mon identit et mes valeurs en Dieu
et faire appel son secours pour quil massiste face aux
tentations, aux vanits et lemprise du mal.
Avec laide de lEsprit saint, je choisis de mappuyer sur la
rvlation biblique pour trouver sa volont et user de mes biens
et de mes capacits avec sagesse.
Conscient de ma vocation de tmoin, je veillerai tre un bon
exemple pour exprimer lamour de Dieu dans le monde.

La Suisse (o jhabite) est un pays de montagnes et, lors des belles


MRXUQpHVEHDXFRXSGHSHUVRQQHVSURWHQWG\IDLUHGHVH[FXUVLRQV
RXGXVNLSRXUEpQpFLHUGHODLUSXUHWGHODYXHPDJQLTXHTXL
dvoile les sommets. Aprs tre mont sur les hauteurs, il est
toujours impressionnant de regarder dans les valles qui abritent
les villages et les signes de la civilisation.
Maison, routes, champs, tout parat si petit et les voitures
qui avancent pourtant rapidement semblent se traner sur de
SHWLWV UXEDQV JULV ,O HVW GLIFLOH GH GLVWLQJXHU OHV KDELWDQWV TXL
ressemblent de petites poussires mouvantes.

Quest-ce que lhomme?


Cette question, cite cinq fois dans la Bible, fait partie des
interrogations fondamentales sur la dimension humaine. Ainsi,
lchelle des montagnes, de la Terre ou de lunivers, nous sommes
SHWLWVHWLQVLJQLDQWV$ORUVTXHFHVJUDQGHXUVQRXVpFUDVHQWSDU
leurs dimensions, nous sommes aussi dpasss par lhumiliante
chelle du temps. Par exemple, les montagnes qui nous permettent
de surplomber les horizons ont mis des millions dannes slever
alors que notre temps de vie se compte en quelques dizaines
dannes. Ce temps est bien plus court que la majorit des arbres,
dont certains vivent plusieurs milliers dannes !
Quest-ce que lhomme ?
35

Vie
Introduction
personnelle

Choisis la vie...

La Bible ne nous berce pas dillusions et rappelle son lecteur


son humble condition. Nous sommes phmres et de nombreux
textes soulignent la fragilit des hommes ; la vie humaine est
comme une ombre qui passe1, une herbe qui fane2, une vapeur qui
se dissipe3XQVRXIHUDSLGH4, une tincelle fugace5. Le prophte
sae est encore plus radical et annonce que toutes les nations de
la Terre sont comme une goutte deau ou de la poussire6
Bref, malgr ses prtentions orgueilleuses, lhumanit nest pas
grand-chose quand on la compare son environnement matriel
et temporel. Selon lchelle du temps et des grandeurs qui
nous entourent, ce nest videmment pas dans notre dimension
biologique que nous pouvons esprer lavenir. Ainsi, tel un
voyageur qui a reu un billet pour un court voyage, nous devons
prendre conscience quil viendra un jour o nous ne pourrons plus
SURWHUGHQRWUHYLH&HMRXUOjQRWUHFRUSVQRVULFKHVVHVHWWRXW
ce que nous aurons amass disparatront dans la mort.
Prendre conscience de sa mort future nest pas trs agrable et
beaucoup de personnes essaient de ne pas y penser. Leur attitude
sapparente celles des autruches qui cachent leur tte dans le
sable lorsque survient un danger. Certes, elles ne voient plus la
menace mais celle-ci ne disparat pas et pourra dautant mieux
les surprendre.
Affronter la question de la mort est salutaire car cest le chemin
que tous les hommes doivent suivre un jour. Face cette dure
ralit, la foi chrtienne surpasse toutes les philosophies ou les
religions. Car, dans lvangile, il ne sagit pas de dissertations
ou dides, mais de la rencontre dcisive qui conduit le Christ
mourir sur la croix. Cette mort violente qui frappe linnocent
envoy par Dieu est le centre de la rvlation biblique, le pivot de
lhistoire du monde.
1

Psaume 102.11, 144.4, Chroniques 29.15, Job 14.2.

sae 40.6-8, Jacques 1.10, Psaume 90.6, Job 14.2, 1 Pierre 1.24.

Jacques 4.14.

Job 7.7.

Job 5.7.

sae 40.15.

36

VieIntroduction
personnelle

Choisis la vie...

LES DEUX FACETTES DE lHOMME


LA POUSSIRE

Vie biologique

LESPRIT

Vie spirituelle
AMOUR DU
PRE

Minuscule

Visible

Petit, faible, phmre

Invisible

Grand, fort, ternel

Comme le montre ce schma, la particularit de lhomme est dtre une crature


biologique et spirituelle. Avec ces deux natures, il est en lien avec la cration et
le Crateur.

/KRPPH HVW LQQLPHQW SHWLW HQ FRPSDUDLVRQ GH OXQLYHUV GDQV


OHTXHOLOHVWSODFp3DUFRQWUHLOHVWLQQLPHQWJUDQGVHORQODPHVXUH
de lamour de Dieu. Cet amour est le sens de son existence.

Alors que lamour de Dieu lavait dj conduit descendre dans


ce monde corrompu et mchant, Christ a volontairement choisi de
suivre les hommes dans leur ultime chemin. Pour cela, le Christ
VH ODLVVH HPSRUWHU LQMXVWHPHQW GDQV OD PRUW DQ GDIIURQWHU OD
maldiction de ceux qui ont perdu leur corps et qui sont bannis
de la cration. Par cette descente aux enfers, il plonge lui-mme
GDQVODQRLUFHXUpWRXIIDQWHGXQpDQWDQGHUHMRLQGUHOHVSHUGXV
la multitude de ceux qui sont enferms pour toujours. Tous sont
tombs sans corde dans ce puits de tnbres, do personne ne
peut remonter de lui-mme.
Mais le Christ ne tombe pas comme les autres. Fidle et juste, il na
pas coup le lien qui lunit son Pre. Cette corde damour le relie
la seule puissance capable daffronter les terribles barrires de la
mort. Jsus, en plongeant dans la mort, vient de faire descendre la
Vie parmi ceux qui en taient privs pour toujours.
Quelle lumire pour ces captifs plongs dans lobscurit et la
solitude ternelle !
37

Vie
Introduction
personnelle

Choisis la vie...

La mort, construite sur labsence de vie, sursaute ; peut-elle


accueillir le prince de la vie sans perdre ses fondements ? Le sjour
GHODPRUWWUHPEOHVHVPXUDLOOHVVHVVXUHQWOHVYHUURXVLQYLRODEOHV
se cassent alors que la voix du Crateur se fait entendre dans le
silence morbide. Face une telle puissance, la mort impitoyable
aimerait bien retenir ses prisonniers, mais le combat est ingal et
ODPRUWVXFFRPEHHOOHDEGLTXHHWODIRXOHGHVFDSWLIVVRUWHQQ
la tte de cette multitude, un librateur fait sortir les esclaves ;
comme Mose, il ouvre pour toujours le chemin de la libert.
Comme lannoncent les vangiles, la rsurrection du Christ est
une extraordinaire victoire sur la maldiction de la mort. Cest ce
que Paul souligne par ces paroles :
PRUWRHVWWDYLFWRLUH"PRUWRHVWWRQDLJXLOORQ"
1 Corinthiens 15.55

Grce au salut apport par le Christ, la mort nest plus le terrible


terminus de la vie humaine, mais une tape vers une cration
nouvelle
Une sauvegarde pour lavenir
Si vous travaillez sur un ordinateur, tout ce vous faites peut
disparatre subitement. Cest ce qui est arriv lun de mes amis
qui dirige une entreprise de graphisme. Il a perdu plus de 15 000
dollars lorsque le disque dur qui contenait son travail sest bloqu.
En une seconde, toutes les informations et les centaines dheures
passes pour des clients ont disparu ; il a bien tent de faire rparer
le disque, mais tout tait dtruit, il ny avait plus aucune donne.
Sil avait copi son travail sur un autre support, la panne naurait
pas eu ces terribles consquences et il aurait pu tout retrouver.
Faire une sauvegarde que lon place dans un lieu sr est un
principe trs important en informatique mais encore plus en ce qui
concerne notre vie. Cette sauvegarde ultime et essentielle consiste
j LQVFULUH PRQ LGHQWLWp HQ 'LHX &HWWH  FRSLH  GH VpFXULWp PH
garantit que rien ne sera dtruit. Aujourdhui, dans le monde,
beaucoup de personnes rvent dtre connues et que leur nom soit
inscrit dans les dictionnaires mais tout cela fait partie des choses
qui passent. Ce qui, en revanche, est important pour chacun de
nous, cest que nous soyons connus de Dieu et que, comme pour
OHEULJDQGVXUODFURL[OH&KULVWVHVRXYLHQQHGHQRXV

38

Choisis la vie...

VieIntroduction
personnelle

(WLOGLWj-pVXV6RXYLHQVWRLGHPRLTXDQGWXYLHQGUDVGDQV
ton rgne. Luc 23.42

Cest parce que le brigand a demand Jsus de faire cette


VDXYHJDUGHTXHOH&KULVWOXLSURPHWGrWUHDYHFOXLQRWUH
tour nous pouvons suivre cette dmarche en ayant lesprance que
notre vie aura un avenir en Dieu. Cette assurance nous permet
denvisager la disparition de notre corps avec (une certaine)
srnit.
Car, la cl pour vivre la rsurrection, cest que notre identit soit
inscrite en Dieu, que notre nom soit crit dans le Livre de vie.1
En tant que chrtiens, nous sommes inscrits dans une dimension
ternelle tout en habitant une demeure temporaire incapable de
traverser la mort. Cette fragilit biologique nous invite rester
humbles et garder du recul envers nos richesses, notre prestige
et nos russites.
Ds lors, il ne sagit plus dexploiter chaque instant en cherchant
j SURWHU DX PD[LPXP GHV SODLVLUV HW GHV ULFKHVVHV PDLV
daccomplir la vocation qui nous est donne en tant des hommes
et des femmes de qualit, qui vivent de manire quilibre dans ce
PRQGHWRXWHQVDFKDQWTXLOQHVWSDVODQDOLWpGHQRWUHYLH
On pourrait rsumer cette attitude par ce clbre verset biblique
du livre de Miche :
On ta fait connatre, homme, ce qui est bien ; et ce que
lternel demande de toi, cest que tu pratiques la justice,
que tu aimes la misricorde, et que tu marches humblement avec
ton Dieu. Miche 6.8

Cette invitation solennelle nous permet de comprendre que la


vraie puissance ne repose pas sur notre pouvoir ou nos moyens
matriels. Si le Dieu ternel est lorigine de notre monde, il
en est aussi le prsent et lavenir. Marcher avec lui est la seule
manire de construire un avenir capable de rsister lpreuve
du temps. Grce lesprance de la rsurrection, notre vision
du monde peut nous conduire considrer notre entourage avec
bienveillance en sachant que ceux qui le composent sont fragiles et
quils disparatront un jour. Leurs imperfections et leurs faiblesses
font partie de ce monde qui passe.
1

Voir Apocalypse 20.12-15, 21.27.

39

Vie
Introduction
personnelle

Choisis la vie...

La mort sapplique tous


La fragilit de la vie humaine est triste car elle conduit a disparition des tres
aims. La mort sme ainsi la souffrance et le vide. Mais cette fragilit humaine
a aussi un ct trs utile, elle permet de limiter les nuisances de ceux qui sont
PpFKDQWVYLROHQWVHWDUURJDQWV$XVVLSXLVVDQWVVRLHQWLOVLOVQHSHXYHQWUpVLVWHUj
la mort et doivent lcher prise. Ces personnes, avides de pouvoir et qui mprisent
leur prochain, se retrouveront un jour toutes petites devant le Crateur quelles
auront mpris.

Laide de lEsprit
Beaucoup de chrtiens ont encore la pense paenne que Dieu
habite dans des lieux particuliers et que, par exemple, il est surtout
prsent dans les temples construits pour les clbrations du
dimanche. Pourtant, les vangiles sont clairs : Dieu nhabite pas
dans les constructions faites par la main des hommes et aucune
ralisation issue de la matire de la cration ne peut prtendre
contenir le Crateur.
Dieu est Esprit, et il faut que ceux qui ladorent, ladorent en
esprit et en vrit. Jean 4.24

Le temple de Jrusalem, construit par


6DORPRQpWDLWXQpGLFHXQLTXHTXLDQQRQoDLW
le ministre que le Christ accomplirait en
venant offrir sa vie pour le Salut des hommes.1
Jsus soulignera ce rle prcurseur du Temple en se prsentant
comme le vrai temple, dtruit et reconstruit en trois jours.
-pVXVOHXUUpSRQGLWGpWUXLVH]FHWHPSOHHWHQWURLVMRXUVMH
le relverai. Jean 2.19

Selon cette juste comprhension du Temple, il ny a aucun texte


dans le Nouveau Testament qui indique que les chrtiens doivent
raliser des constructions spciales pour rendre un culte Dieu.
Les premiers disciples du Christ se runissaient dans des maisons
1

40

Salomon avait conscience que le majestueux temple de Jrusalem quil avait


construit ne pouvait prtendre contenir Dieu. Ce btiment unique et au centre
du judasme tait un lieu de prire et une illustration du chemin faire pour
aller vers Dieu. Dans 1 Rois 8.27 Salomon sexprime ainsi : Mais quoi ! Dieu
KDELWHUDLWLOYpULWDEOHPHQWVXUODWHUUH"9RLFLOHVFLHX[HWOHVFLHX[GHVFLHX[
QHSHXYHQWWHFRQWHQLUFRPELHQPRLQVFHWWHPDLVRQTXHMHWDLEkWLH

VieIntroduction
personnelle

Choisis la vie...

et des lieux communs, mais jamais avec le sentiment que ces


endroits taient particulirement sacrs.1
Aujourdhui, de nombreuses communauts considrent comme
essentiel le fait davoir un btiment ddi au culte et dans lequel la
SUpVHQFHGH'LHXVHUDSOXVIRUWH&HGpVLUGHFUpHUXQHpJOLVH
de pierre conduit souvent engager beaucoup de dpenses.
Cette attitude nest malheureusement pas conforme la rvlation
et ils ignorent le changement radical apport par Christ.

LE CULTE

Par la cration

Par lEsprit
Culte du
cur

Cultes dans
des lieux et
par des rites

Paganisme

AMOUR

Christianisme

La sduction diabolique conduit toujours les hommes offrir des cultes qui
passent par la cration. Cela se traduit par la sacralisation des lieux, des prtres ou
des sorciers, des objets, des rites, etc. La rvlation divine dnonce ces idoltries
en soulignant que le vrai culte doit se vivre dans une relation directe avec Dieu
et par son Esprit.

Selon lvangile, le vrai culte ne peut se raliser avec les lments


matriels de la cration ; la relation doit se faire spirituellement.
Cest pourquoi la vocation principale de lhomme rside dans le
fait daccueillir la prsence de Dieu en lui ; par cela, il devient lui-
PrPHXQWHPSOH
1

Lorsque les aptres et les chrtiens de Jrusalem allaient au Temple, comme


dans Actes 3, ils navaient pas le droit dy pntrer car lintrieur tait rserv
H[FOXVLYHPHQW DX[ VDFULFDWHXUV HW DX[ /pYLWHV /HV FKUpWLHQV SRXYDLHQW
donc uniquement se runir sur le parvis. Cette place tait un lieu de prire,
de rencontre et un espace privilgi pour enseigner et apporter lvangile aux
Juifs.

41

Vie
Introduction
personnelle

Choisis la vie...

 1H VDYH]YRXV SDV TXH YRXV rWHV OH WHPSOH GH 'LHX HW TXH
O(VSULWGH'LHXKDELWHHQYRXV"1 Corinthiens 3.16
 1H VDYH]YRXV SDV TXH YRWUH FRUSV HVW OH WHPSOH GX 6DLQW
(VSULWTXLHVWHQYRXVTXHYRXVDYH]UHoXGH'LHXHWTXHYRXV
QH YRXV DSSDUWHQH] SRLQW j YRXVPrPHV " &DU YRXV DYH] pWp
UDFKHWpVjXQJUDQGSUL[*ORULH]GRQF'LHXGDQVYRWUHFRUSV
et dans votre esprit, qui appartiennent Dieu. 1 Corinthiens 6.19

Avec une telle prsence, il est vident que la foi chrtienne ne


consiste pas accomplir des rites ou honorer des btiments de
pierres. Le vrai culte se passe lintrieur de lhomme et le conduit
clbrer le Dieu vivant par une union de cur.
Grce ce lien spirituel, il ne sagit pas de rendre un culte la
manire des paens, mais dtre un culte.
Ce culte du cur est le centre de la foi chrtienne ; il sexprime
dans la relation personnelle avec Dieu et avec ceux qui cultivent
une relation avec Dieu.
Car l o deux ou trois sont assembls en mon nom, je suis au
milieu deux. Matthieu 18.20

Comme le soulignent ces paroles de Jsus, la communion entre


deux personnes permet dj lEsprit de se manifester dans la
relation.
Laptre Pierre est certainement la personne qui sera la plus
concerne par la question du culte. lorigine, il sappelait
Simon, mais, alors quil confesse publiquement que le Christ est
le Messie, Jsus lui donne le nom de Pierre en lui indiquant que
sur cette pierre Dieu construirait son glise.1
Avec une telle promesse, Pierre sait que Dieu nhabite pas les
EULTXHV RX OH FLPHQW PDLV TXH VRQ pGLFH VH FRQVWUXLW DYHF
les hommes et les femmes qui le connaissent. Cette parole de
vocation, grave dans son nouveau nom, accompagnera laptre
tout au long de sa vie et sexprime dans les lettres quil adresse
DX[FKUpWLHQVSRXUOHVHQFRXUDJHUjFRQVWUXLUHOHYUDLpGLFHGH
Dieu.
(WYRXVPrPHVFRPPHGHVSLHUUHVYLYDQWHVpGLH]YRXVSRXU
former une maison spirituelle (...). 1 Pierre 2.5
1

42

Voir Matthieu 16.16-19.

Choisis la vie...

VieIntroduction
personnelle

Un culte qui gurit

Dans les cultes paens et animistes, lhomme cherche sattirer


lattention et la bienveillance des dieux ou des esprits par toutes
sortes de pratiques religieuses ; cest un peu comme si lhomme
devait faire de grands efforts pour quon sintresse lui et lui
rponde. Cette distance est aussi prsente dans lislam qui prsente
un Dieu puissant et autoritaire.
Lvangile est totalement diffrent puisque la rvlation quil
apporte est celle dun Dieu rempli damour et qui dsire vivre en
communion avec nous. Dans ce sens, ce nest pas lhomme de
monter vers Dieu, mais lui qui a choisi de descendre parmi les
siens.
Ce mouvement qui part de Dieu pour rejoindre les hommes se
manifeste par une extraordinaire rvlation de ladoption de notre
Pre cleste.
 (W SDUFH TXH YRXV rWHV OV 'LHX D HQYR\p GDQV QRV FXUV
O(VSULWGHVRQ)LOVOHTXHOFULH$EED3qUH Galates 4.6

Beaucoup de chrtiens ne prtent malheureusement pas attention


ce message de lEsprit qui atteste quils sont dignes et aims par
leur Pre cleste. Cest pourtant le meilleur remde pour gurir
notre identit et nous conduire dans une vie chrtienne joyeuse et
solide. Le plus bel exemple nous est offert par le Christ qui vivait
en intime communion avec son Pre. Ce lien damour, par lEsprit,
OXLGRQQDLWXQHFRQDQFHSDLVLEOH6RQDVVXUDQFHGrWUH)LOVGH
'LHX  OXL D SHUPLV GDIIURQWHU OHV DGYHUVLWpV DYHF ODVVXUDQFH
dtre aim et soutenu.
Le Pre aime le Fils, et il a remis toutes choses entre ses
mains. Jean 3.35
&UR\H]PRLMHVXLVGDQVOH3qUHHWOH3qUHHVWHQPRLJean 14.11

43

Vie
Introduction
personnelle

Choisis la vie...

Une semence qui apporte la vie


Comme le dmontre la vie de Jsus, le secret de la vie chrtienne
ne repose pas sur des connaissances intellectuelles ou sur la
religiosit ; son fondement sappuie sur ce que Dieu dpose en
nous par son Esprit :
Vous avez t rgnrs non par une semence corruptible,
mais par une semence incorruptible, par la parole vivante et
permanente de Dieu. Car toute chair est comme lherbe, et toute
VDJORLUHFRPPHODHXUGHOKHUEH/KHUEHVqFKHHWODHXU
tombe ; mais la parole du Seigneur demeure ternellement. Et
cette parole est celle qui vous a t annonce par lvangile.
1 Pierre 1.23-25

Cette semence qui vient de Dieu nest pas soumise la fragilit


biologique et aux limites du temps, elle a la capacit de simplanter
dans notre cur et de tisser des racines en Dieu.
Jean, qui tait le disciple le plus proche du Christ, a peru la
capacit extraordinaire de cette semence qui permet de rtablir la
OLDWLRQHQWUHOKRPPHHW'LHX
0DLVjWRXVFHX[TXLORQWUHoXH OD3DUROHIDLWHFKDLU jFHX[
qui croient en son nom, elle a donn le pouvoir de devenir enfants
de Dieu, lesquels sont ns, non du sang, ni de la volont de la
chair, ni de la volont de lhomme, mais de Dieu. Jean 1.12-13

Comme nous le savons, le pouvoir dune semence est suspendu


laccueil quon lui fait. Par exemple, la semence dun grand arbre
na aucune possibilit de manifester sa force en labsence dune
terre accueillante. Il en est de mme avec la semence spirituelle
que le Christ a apporte. Celle-ci doit tre accueillie et alimente
par la terre de notre cur.
La clbre parabole du semeur et des terrains qui rsistent ou
accueillent la semence est une illustration des enjeux qui reposent
sur la manire daccueillir lvangile.1 La Parole, aussi puissante
soit-elle, nagit pas avec violence : elle soffre lhomme et
cest lui de lui faire une place et de lui permettre de grandir. Ce
processus nest pas instantan et nous devons veiller ce que la
semence qui vient de Dieu puisse crotre dans notre vie.
1

44

Cette parabole est prsente dans trois vangiles : Matthieu 13.4-9 et 18-23,
Marc 4.3-20, Luc 8.5-15.

VieIntroduction
personnelle

Choisis la vie...
Lenjeu du cur

&H TXL HVW DX FHQWUH GH OKRPPH QLW WRXMRXUV SDU VH[SULPHU GXQH
manire ou dune autre. Ainsi, nos paroles, nos attitudes et ce que nous
faisons sont des rvlateurs indiscrets de ce qui nous habite.
Garde ton cur plus que toute autre chose, car de lui viennent les sources de
la vie. Proverbes 4.23
Lhomme bon tire de bonnes choses du bon trsor de son cur, et le mchant tire
de mauvaises choses de son mauvais trsor ; car cest de labondance du cur
que la bouche parle. Luc 6.45
Si mon cur est rempli de convoitises et de haines, ces choses vont logiquement
me conduire agir avec mchancet envers mon entourage. Je naurai aussi aucun
scrupule faire souffrir, dominer et craser. Face lattrait des richesses, je
VHUDLSUrWjIDLUHYLROHQFHSRXUHQSURWHUpJRwVWHPHQW6LGDQVFHFDVMHWURXYH
des collaborateurs qui partagent mes convictions de cur, je pourrai crer une
petite arme de mchants utilisant la corruption et chercher me procurer des
armes qui maideront semer la dsolation et la guerre.
Dans ma main, une arme pourra tuer en quelques secondes et rduire nant les
annes de travail quune mre aura consacr lever et prendre soin de son
enfant. De mon cur sortira le venin qui contaminera le pays et rendra impossible
la paix et le dveloppement.
Si en revanche mon cur est rempli des penses du Dieu damour, ces valeurs
me conduiront appliquer cette bont de manire concrte dans mon entourage.
Grce la rvlation de lamour de Dieu, je serai conduit considrer lautre selon
un principe dgalit et respecter son avis ; sa souffrance sera ma souffrance, et
je deviendrai un instrument dassistance. Ainsi, linvitation divine daimer mon
prochain me conduira consoler, apporter des paroles de rconciliation ou
trouver des solutions quitables.
Si je trouve des collaborateurs qui partagent ces valeurs de cur, nous pourrons
crer une socit fonde sur la justice et vivre en paix.
Beaucoup de personnes pensent que les grands chantiers susceptibles dapporter
des changements et du dveloppement relvent du domaine de la politique ou
concernent les infrastructures sociales et matrielles. Certes, ces choses sont
importantes, mais, comme le dcrivent les deux exemples ci-dessus, la qualit de
vie et la construction sociale dpendent avant tout de notre vision du monde et des
valeurs qui nous habitent.
$LQVLOHFDUUHIRXURVHFDFKHODEpQpGLFWLRQRXODPDOpGLFWLRQVHVLWXH
dans lendroit secret de nos curs. Il est par consquent important que le centre
stratgique de notre cur soit habit par la prsence et la sagesse de Dieu.
En proclamant dans notre cur notre foi et notre adoration au Crateur nous
SRUWRQVXQFRXSIDWDOjOpGLFHGLDEROLTXHTXLFKHUFKHjQRXVSULYHUGHODVVLVWDQFH
de Dieu. Une louange sincre et active qui sadresse Dieu est donc une arme
redoutable pour briser les piges qui nous environnent selon cette merveilleuse
parole :
Je mcrie lou soit lternel et je suis dlivr de mes ennemis.
2 Samuel 22.4, Psaume 18.4

45

Vie
Introduction
personnelle

Choisis la vie...

LE TERRAIN DU CUR
La semence divine

Contact

Accueil

Fruits

/LPSDFWEpQpTXHGHOD3DUROHGpSHQGGHODFFXHLOTXHQRXVOXLIDLVRQV

Lcoute de Dieu
Lenfant dune famille nest pas forcment trs attentif la sagesse
de ses parents... et cette rgle sapplique aussi dans le cadre de
notre relation avec Dieu ; ds lors, et mme si nous avons t
ramens spirituellement vers le Pre par le Christ, nous restons
immergs dans un monde de violences et de mensonges ; nous
avons donc besoin de cultiver une attitude dcoute pour recevoir
la sagesse de notre Crateur.
Cette coute essentielle est la premire chose que mentionne
-pVXVORUVTXRQOXLGHPDQGHGHGpQLUOHFRPPDQGHPHQWOHSOXV
important :
-pVXVUpSRQGLW9RLFLOHSUHPLHUeFRXWH,VUDsOOH6HLJQHXU
notre Dieu, est lunique Seigneur. Marc 12.29 (Deutronome 6.4)

Cultiver lcoute de Dieu nest pas facile car, dans ce monde


PRGHUQHOHVPpGLDVDPSOLHQWGHQRPEUHXVHVFUR\DQFHVLGpHV
SKLORVRSKLHV &HV  EUXLWV  DPELDQWV VRQW GH SOXV IRUWHPHQW
DPSOLpV SDU GHV WKqPHV IXWLOHV TXL QRXV LQYLWHQW j VXLYUH OHV
prouesses sportives, les modes ou les actualits.
Toutes ces choses ne sont pas forcment mauvaises, mais elles
peuvent facilement nous carter de lcoute prcieuse et intime
laquelle nous invite notre Crateur.
Celui qui mcoute reposera avec assurance, il vivra tranquille
et sans craindre aucun mal. Proverbe 1.33
)LOVGHOKRPPHUHoRLVGDQVWRQFXUHWpFRXWHGHWHVRUHLOOHV
toutes les paroles que je te dirai ! zchiel 3.10

46

Choisis la vie...

VieIntroduction
personnelle

En vrit, en vrit, je vous le dis, celui qui coute ma parole, et


qui croit celui qui ma envoy, a la vie ternelle et ne vient point
en jugement, mais il est pass de la mort la vie. Jean 5.24

Pratiquement, il existe trois axes principaux qui permettent


dcouter Dieu :
Le message contenu dans les critures (la Bible).
Lcoute intime de Dieu dans la prire.
Lapport des autres (les ministres).
La Bible
Ce livre est un recueil qui rassemble des rcits et des paroles
inspires capables de nous transmettre la pense de Dieu. Ralise
par plus de 40 auteurs et couvrant plusieurs millnaires dHistoire,
la Bible rassemble des textes qui ont t rdigs et soigneusement
collects par des hommes inspirs. Ce merveilleux tmoignage,
HQFDSVXOpGDQVXQOLYUHHVWXQH[WUDRUGLQDLUHRXWLOSRXUFHX[
qui dsirent comprendre le sens de la vie et lamour de Dieu.
Ce contact direct et rgulier avec la pense de Dieu a permis des
millions dhommes de comprendre et dappliquer concrtement
la sagesse divine dans leur entourage. En effet, lorsque la Bible
HVW OXH HW PLVH HQ SUDWLTXH HOOH SRUWH GHV IUXLWV EpQpTXHV GDQV
la vie personnelle et communautaire. Dans de nombreux cas, le
SRXYRLUGHOD%LEOHDFRQGXLWjGHVWUDQVIRUPDWLRQVQRWDEOHV
que lon peut mesurer dans lhistoire humaine. Par exemple,
limpression de la Bible par Gutenberg en 1453 a permis la
diffusion des crits bibliques large chelle. Limpact de son
message a entran de profondes rformes dans la manire de
vivre et dans la socit. Dans de nombreux pays, lcoute de
la Bible est la source des principes qui ont permis lexercice de
la justice, de lassistance aux dmunis, des services de sant, etc.
Heureux lhomme qui trouve son plaisir dans la loi de lternel et
qui la mdite jour et nuit ! Il est comme un arbre plant prs dun
courant deau, qui donne son fruit en sa saison et dont le feuillage
QHVHpWULWSRLQWWRXWFHTXLOIDLWOXLUpXVVLWPsaume 1.2-3

Lire la Bible de manire rgulire est un moyen de rester proche


GHODUpYpODWLRQYLYLDQWHGHODSHQVpHGH'LHX
Pour cette raison, la CHARTE+ nous rappelle quil est bien de
47

Vie
Introduction
personnelle

Choisis la vie...

consacrer du temps lcouter. Celle-ci est lun des moyens que


Dieu a mis notre disposition pour nous permettre de comprendre
son amour.
Comment lire la Bible?
Cette question est trs importante, car la Bible est un ouvrage qui
rassemble plus dune soixantaine de livres rdigs sur environ
16 sicles ! La Bible nest donc pas un livre comme les autres,
FHVWXQHELEOLRWKqTXHXQJUDQGpGLFHGHSOXVGHTXDWUHPLOOLRQV
de caractres formant environ 770 000 mots disposs en plus de
1 000 chapitres ! Pour cette raison, la Bible ne se lit pas comme
un roman, mais par un processus de dcouvertes rgulires. Ainsi,
pour explorer et comprendre la pense de Dieu travers la Bible,
il est donc ncessaire de saisir le sens de ses crits.

Malheureusement, beaucoup de lecteurs lisent la Bible en prenant


un passage par-ci ou par-l. Pour eux, la Bible est comme une
banque de paroles que lon peut utiliser dans les situations de
la vie. Cela est trs risqu, et lors dun reportage sur une rgion
en guerre du Congo, lun des chefs militaires impliqus dans les
FRQLWV MXVWLDLW OHV PDVVDFUHV TXLO DYDLW FRPPLV VXU GDXWUHV
tribus en utilisant des paroles de lAncien Testament. Sa manire
GHOLUHOD%LEOHOHFRQGXLVDLWjVLGHQWLHUjGHVFKHIVGHJXHUUH
bibliques. Il se vantait de ne pas cder la piti et de ne laisser
aucun survivant !
Comme le montre ce terrible exemple, la Bible peut devenir le
MXVWLFDWLIGHODYLROHQFHHWGXPDO&RPPHFHOLYUHFRPSWHSOXV
de 31 000 versets, il est facile de tirer telles ou telles paroles
SRXUMXVWLHUODYLROHQFHOHVJXHUUHVODSRO\JDPLH SUDWLTXpHSDU
FHUWDLQVKRPPHVELEOLTXHV OHVFODYDJHOHVVDFULFHVGDQLPDX[
des rites religieux, des prescriptions alimentaires, etc.
Certes, ces choses sont mentionnes dans certains rcits bibliques,
mais elles ne constituent pas SON message. Car la Bible est
comme un chemin qui nous invite suivre la longue aventure de
la rvlation divine travers lhistoire des hommes.
Dans ce cheminement laborieux, Dieu a travaill pour prparer les
WHPSVHWOHVFLUFRQVWDQFHVDQTXHOHPRQGHSXLVVHDFFXHLOOLUVD
rvlation suprme. Cette rvlation, prpare patiemment avec
48

Choisis la vie...

VieIntroduction
personnelle

les patriarches et le peuple juif, sera le processus ncessaire pour


que Dieu puisse introduire son Salut dans lhumanit.
Lorsque lon construit une maison, le chantier est bruyant et
poussireux car on creuse le sol et lon apporte des briques, du
bton, du bois et toutes sortes de matriaux. Pour accomplir ces
travaux, on utilise des vhicules, des chafaudages et divers outils.
Toutes ces choses sont indispensables mais, lorsque la maison est
QLHHWTXHOHVpOpPHQWVGHFRQVWUXFWLRQVRQWHQSODFHFHTXLD
servi construire doit quitter le chantier.
Il en est de mme avec la longue prparation que Dieu a d
DFFRPSOLU SRXU FRQVWUXLUH OpGLFH TXL SHUPHW DX[ KRPPHV
dentrer dans sa prsence. Le cur de la rvlation, cest le Christ.
,OHVWOHFHQWUHOpGLFHTXLUHVWHDSUqVODFRQVWUXFWLRQ
Vous sondez les critures, parce que vous pensez avoir en
HOOHVODYLHpWHUQHOOHFHVRQWHOOHVTXLUHQGHQWWpPRLJQDJHGH
moi. Jean 5.39

Comme le Christ claire toute la rvlation, ses uvres agissent


tels des verres correcteurs de lunettes qui permettent des yeux
malades de voir le centre de la rvlation ; la Bible doit se lire
travers le Christ et la lumire du don de sa vie.
Grce cette lecture centre sur luvre du Christ, nous pouvons
faire la distinction entre le processus de construction que Dieu a
PLVHQSODFHGDQVOHVSpULRGHVGHO$QFLHQ7HVWDPHQWHWOpGLFH
abouti et majestueux que nous prsente le Nouveau Testament.
Cette lecture claire toute la Bible
et permet de comprendre lobjectif
des paroles et des instructions
prparatoires donnes par Dieu en
vue de laccomplissement en Jsus.
3DU H[HPSOH OHV pYpQHPHQWV GH OD 3kTXH HW OHV VDFULFHV
danimaux de lAncien Testament sont des fondements qui
permettent de comprendre que nos fautes conduisent la mort et
quelles doivent tre couvertes par le don dune vie. Cette vrit
VHFRQUPHORUVTXH-pVXVDFFRPSOLWWRWDOHPHQWOHVHQVGHOD3kTXH
en offrant sa vie la croix. Mettre de nos jours des animaux mort
pour accomplir une parole biblique de lAncien Testament serait
donc un dramatique retour en arrire.
La bonne lecture consiste
couter les textes de lAncien
Testament la lumire du sens
quils ont pris dans le Nouveau
Testament.

49

Vie
Introduction
personnelle

Choisis la vie...

Mais alors, que reste-t-il?


Cette question importante a t la proccupation des aptres
lorsque lvangile a commenc se rpandre parmi les peuples
paens. Jusque-l, les alliances entre Dieu et les hommes taient
rserves quelques personnes et plus tard au peuple juif. Cest
GDQVFHSHWLWHVSDFHUpVHUYpTXHOH6DOXWHQ&KULVWHVWYHQX
cette poque, les premiers chrtiens taient exclusivement des
Juifs qui connaissaient et pratiquaient les commandements et les
traditions de lAncien Testament.
Heureusement pour nous, si Dieu a choisi le peuple juif pour
FRQVWUXLUHODPDLVRQFpWDLWHQYXHGLQYLWHUWRXWHVOHVQDWLRQVj
lhabiter. Cette invitation universelle dsire par Dieu va conduire
O(VSULWGH'LHXjSRXVVHULQH[RUDEOHPHQWOeYDQJLOHKRUVGX
cercle des Juifs.1
Ce passage de lvangile vers les non-juifs sera lune des tapes
cruciales pour apporter le salut de Dieu tous les hommes. Cette
transition entre la pit juive et celle des chrtiens de cultures
paennes reprsente cependant une tape dlicate qui conduira les
aptres sinterroger sur ce que les nouveaux croyants devaient
pratiquer.
Les nouveaux chrtiens devaient-ils appliquer les lois et les ordres
de lAncien Testament ? Devaient-ils pratiquer la loi et les rites
religieux, notamment la circoncision ? Comment devaient-ils
couter et mettre en pratique les textes bibliques disponibles (le
Nouveau Testament nexistait pas encore) ?

Ces questions taient primordiales pour lavenir de lglise et


elles seront lobjet dimportantes discussions.
Dans ces dbats, que relate le livre des Actes au chapitre 15,
plusieurs chrtiens juifs trouvaient logique dimposer la loi de
Mose tous les nouveaux convertis.
Mais les aptres, qui taient pourtant des Juifs pratiquants, avaient
compris quun temps nouveau avait commenc ; alors quils
auraient pu facilement imposer aux convertis les nombreuses lois
et coutumes de lAncien Testament, ils donnent les directives
suivantes :
1

50

Dans Actes 10, laptre Pierre est invit apporter lvangile un chef militaire
romain.

Choisis la vie...

VieIntroduction
personnelle

 LODSDUXERQDX6DLQW(VSULWHWjQRXVGHQHYRXVLPSRVHU
dautre charge que ce qui est ncessaire, savoir, de vous
DEVWHQLUGHVYLDQGHVVDFULpHVDX[LGROHVGXVDQJGHVDQLPDX[
touffs, et de la dbauche, choses contre lesquelles vous vous
trouverez bien de vous tenir en garde. Adieu. Actes 15.28-29

La sobrit de la rponse des aptres est tonnante lorsquon la


compare aux trs nombreuses rgles imposes dans la vie juive.
Selon les crits et la loi de Mose, les rabbins ont dnombr
613 commandements observer !
Au vu de ce nombre, il est impressionnant de voir que les aptres
ne gardent que trois axes, soit : ne pas succomber lidoltrie,
garder les rgles de lAncien Testament concernant le sang et ne
pas cder la dbauche.
Dans la suite du Nouveau Testament, les commandements imposs
aux serviteurs de Dieu seront encore plus sommaires, Jacques,
Pierre et Jean donnant pour seule instruction de prendre en charge
les malheureux.
Ils nous recommandrent seulement de nous souvenir des
pauvres, ce que jai eu bien soin de faire. Galates 2.10

Ces quelques exigences imposes aux nouveaux chrtiens ne


VLJQLHQWSDVpYLGHPPHQWTXHOHFRQWHQXGHO$QFLHQ7HVWDPHQWHVW
inutile et que lon peut tout faire au nom de la libert chrtienne.

Dans les temps anciens, Dieu navait pas encore pu apporter son
salut et dverser sa prsence dans le cur des hommes. Il tait
donc forc de les conduire depuis lextrieur en leur donnant des
commandements observer. Cette phase de la rvlation tait
comme lenfance dans laquelle les parents doivent dire : ne touche
pas le feu, ne mange pas de la terre, fait attention
Comme lenfant ne comprend pas les dangers, on le protge par
des commandements. Toutefois, cela est provisoire, car lobjectif
est que lenfant devienne adulte et quil soit capable de se grer
lui-mme.
La venue du Christ marque ce changement par lequel lhomme
nest plus conduit par une loi extrieure, mais par une orientation
spirituelle place lintrieur de sa vie. Marcher selon Dieu ne
51

Vie
Introduction
personnelle

Choisis la vie...

se fait donc plus avec une liste de contraintes, mais en suivant les
conseils de lEsprit de Dieu.1
De nombreuses personnes nont malheureusement pas compris
que la foi chrtienne repose sur la conduite du Saint-Esprit.
Leur lecture des anciens textes bibliques les conduit croire que
Dieu dsire imposer toutes sortes de rgles. Les interdictions
qui en dcoulent prennent de nombreuses formes, par exemple,
dans telle communaut, il sera interdit aux femmes de porter un
pantalon, ailleurs elles devront se couvrir la tte ; dans dautres
communauts, fumer, boire un verre de vin2, couter de la musique
mondaine sera considr comme des pchs Progressivement,
un carcan de traditions, de lois et de coutumes viendra touffer la
foi chrtienne en crant une atmosphre sche, triste et incapable
de tmoigner de lamour de Dieu.
Face ces drives, il est ncessaire de rappeler que le chrtien
est appel vivre par lEsprit et selon un principe de libert dans
lequel il collabore avec la volont divine.3
Pour cela, il ne sagit plus de tu ne dois pas faire le mal , mais
de par mon Esprit, je te donne la capacit de faire le bien .
En effet, le projet divin vise nous permettre daimer et daccomplir
de bonnes uvres.
Lorsque lhomme vit cette collaboration avec Dieu, il surpasse les
lois anciennes et rigides ; il nest donc plus soumis aux rgles et
aux exigences du judasme.
1

Plusieurs livres du Nouveau Testament traitent de la juste manire darticuler


les pratiques juives avec la vie chrtienne. Cest le cas en particulier des ptres
aux Romains et aux Galates. Dans ces textes, Paul prsente la supriorit de la
foi et de la conduite par lEsprit sur la loi. Le livre des Hbreux est aussi une
PHUYHLOOHXVHH[SOLFDWLRQGXVHQVGHVVDFULFHVGDQLPDX[HWGHODSUrWULVHjOD
lumire des bouleversements apports par le Christ.

Certes, il nest pas bon pour la sant de fumer et la Bible nous met en garde
contre le fait de devenir esclave de lalcool, toutefois aucun texte biblique
nimpose ce type dinterdictions.

Or, le Seigneur cest lEsprit ; et l o est lEsprit du Seigneur, l est la


libert. 2 Corinthiens 3.17.

52

VieIntroduction
personnelle

Choisis la vie...

Limage du th
/RUVTXHORQIDLWGXWKpRQODLVVHWUHPSHUGHVIHXLOOHVGDQVGHOHDXFKDXGHDQ
den tirer la substance prcieuse. Ensuite, on spare les feuilles du breuvage. Les
feuilles de th contiennent la source prcieuse que lon carte pourtant lorsque le
th est prt. Il en est de mme avec la Bible ; le Nouveau Testament tire sa substance
de lAncien Testament en mettant en vidence le cur de son message. Pour cette
raison, la bonne coute de la Bible consiste soumettre sa comprhension des
textes la lumire de lenseignement du Christ et des aptres.

Le tableau ci-dessous illustre comment les rvlations donnes


par Dieu dans lAncien Testament trouvent leur accomplissement
HQ &KULVW /HV VDFULFHV OHV ULWHV HW OHV ORLV pWDLHQW QpFHVVDLUHV
pour poser les fondements de la rvlation. Cette tape prparatoire
englobe aussi des lments matriels et le tabernacle ou le temple
de Jrusalem ont t construits pour nous permettre de comprendre
des ralits spirituelles invisibles. Sans la longue prparation
ralise par Dieu travers lhistoire du peuple juif, nous naurions
jamais pu comprendre la nature de Dieu et son amour.

LE SENS DE LA RVLATION BIBLIQUE


Ancien

CENTRE

Nouveau

Lois-rgles

Esprit

Temple

glise

Sacrifices
Prparatoire

Christ

Grce
Accomplie

La loi et les rites de lAncien Testament sont des tapes prparatoires qui
saccomplissent en Christ (voir Hbreux 10.1-18). Voir aussi le tableau des
DOOLDQFHVSUpVHQWpjODQGHFHOLYUH
Larticulation entre la loi et la grce est dj symbolise dans les vnements de
lexode. Ainsi, Mose fait sortir le peuple de loppression du Pharaon, il ne pourra
toutefois pas faire entrer le peuple dans le Pays promis. Cette promesse sera
DFFRPSOLHSDU-RVXp PrPHQRPTXH-pVXVHWTXLVLJQLHOeWHUQHOHVWVDOXW 
Voir Deutronome 3.23-28.

53

Vie
Introduction
personnelle

Choisis la vie...

Garder le sens des priorits


Certains pasteurs et prdicateurs construisent malheureusement de
grandes thories spirituelles en utilisant des textes bibliques pour
servir leurs ides en les prsentant comme des aspects essentiels
la foi. Selon eux, la rvlation quils ont reue est centrale ; ils
vont par exemple parler de choses caches dans le monde spirituel,
mettre un trs fort accent sur le rle des dmons, prtendre tre les
dtenteurs de nouvelles rvlations. Pourtant, lorsque lon cherche
dans la Bible, on dcouvre que ces lments sont exagrment
DPSOLpVRXQRQWSDVpWpUHSULVVSpFLTXHPHQWSDU-pVXVRXSDU
les aptres. Si ceux qui sont le fondement de lglise nont pas
ou peu trait certains sujets, nous devons logiquement considrer
quils ne sont pas au centre de la rvlation.
Lors de notre coute biblique, accordons beaucoup dimportance
ce qui tait primordial pour le Christ et les aptres et moins pour ce
qui ne ltait pas. Par cette dmarche, il ne sagit pas dcarter des
textes de lAncien Testament ou de se fermer aux trsors que nous
apportent les sciences, mais dappliquer un principe de priorit de
faon discerner lessentiel ncessaire la vie chrtienne.

Ce qui a beaucoup dimportance pour Dieu est forcment transmis


par le Christ et les aptres, alors que ce qui nest pas ou peu
mentionn dans la Bible est forcment secondaire et doit tre
considr comme tant la priphrie de la rvlation.
Ce principe de proportionnalit permet daccorder la priorit
des aspects tels que la mort du Christ pour le pardon des pchs,
la vie par lEsprit, lamour du prochain, le tmoignage de la foi, la
prire, le partage, la joie, les dons spirituels, le respect de lautre,
lassistance, le service
Toutes ces choses, enseignes par les aptres, sont au cur de
lcriture et simposent comme tant lexpression centrale de la
volont de Dieu pour notre vie personnelle et communautaire.
Ces points importants soulignent combien il est ncessaire de lire
la Bible la lumire de luvre du Christ et sous linspiration de
son Esprit. Dans cette coute, il est trs prcieux dutiliser des
aides de lecture ou des ouvrages qui contiennent des conseils et
54

Choisis la vie...

VieIntroduction
personnelle

des informations.1 Cest par cette assistance divine que les auteurs
du Nouveau Testament ont t conduits dlaisser des lments
secondaires pour mettre en lumire les points essentiels de la vie
chrtienne.
La prire
Ma tante, maintenant ge, a toujours t trs accueillante et lon
ne compte plus le nombre de personnes quelle a aides en offrant
lhospitalit ou son assistance. Elle sest de plus occupe durant
de nombreuses annes de son mari gravement malade. Alors que
nous parlions de la prire, elle ma racont ltonnante histoire qui
lui tait arrive lorsquelle tait plus jeune. cette poque, elle
tait active dans lassistance sociale et soccupait de personnes
ges. Son travail consistait leur apporter des repas, parler
avec elles, les aider, etc.
Une nuit, il lui est arriv une tonnante aventure. Alors quelle
dormait profondment, elle sest soudainement rveille avec une
pense surprenante :
Tu devrais aller maintenant chez la vieille dame dont tu
toccupes.
Encore embrume par le sommeil, elle regarde le rveil ; il est
peine quatre heures du matin. Quelle ide !
Mais la pense revient :
Tu dois aller visiter cette dame maintenant.
Elle regarde dehors, il fait nuit, cest lhiver et la maison de la
vieille dame se trouve plusieurs kilomtres pied.
Mais la pense revient encore :
Va chez cette dame maintenant.
Ma tante simagine alors arrivant tard dans la nuit et frappant la
porte de la maison. Que dire pour expliquer cette visite nocturne ?
/DVWXSLGLWpGHODVLWXDWLRQODFRQGXLWHjUHQRQFHUGpQLWLYHPHQW
ce projet et elle se recouche en se forant dormir.
Le lendemain, elle apprend que lon a retrouv la vieille dame au
milieu de sa cuisine.
Celle-ci stait cruellement blesse en tombant ; lune de ses
1

Le livre $LGHFRQVHLO  OLUH HW pWXGLHU OD %LEOH  ralis par lauteur, offre
une aide prcieuse la lecture de la Bible. Voir les ouvrages prsents dans les
dernires pages de ce livre.

55

Vie
Introduction
personnelle

Choisis la vie...

jambes tait casse et elle avait pass une nuit dhorreur et de


souffrance seule et sans secours.
Lorsque ma tante la rencontre lhpital, la vieille dame lui dit :
Jai pri toute la nuit pour que Dieu envoie quelquun
Ma tante comprend alors que Dieu a bien fait suivre cette prire
PDLVTXHFHOOHTXLGHYDLWOHQWHQGUHQDSDVVXIVDPPHQWSULVDX
srieux linvitation divine.
Comme le montre cet exemple, la prire est un moyen privilgi
GHFRPPXQLFDWLRQTXLSHXWWUDYHUVHUOHVGLVWDQFHVHWPRGLHUOHV
situations. Prier, cest dune part un moyen de parler Dieu et
cest aussi une attitude qui permet dtre lcoute de sa pense
et de sa volont.
Mais comme le souligne laventure de ma tante, lcoute dans la
prire nest pas facile et le message de Dieu peut aisment tre
ignor ou touff par des considrations humaines.
Lhomme a donc besoin de grandir dans lcoute de Dieu en
apprenant discerner sa voix. Cette croissance se fait par
lexprience de la foi qui permet progressivement de discerner
entre ce qui vient de Dieu et ce qui vient de nos penses. Lun des
beaux exemples de cette croissance dans lcoute est donn par le
roi David. Cet homme choisi pour gouverner Isral sillustrera lors
dun spectaculaire combat contre le gant Goliath. David tait-il
un surhomme ? Non ; au contraire, il tait jeune et inexpriment.
Quel est donc le secret qui mnera cet adolescent vaincre un
terrible ennemi ?
La rponse se trouve dans le rcit biblique, lorsque David est
interrog sur sa dcision daller se battre :
 6DO GLW j 'DYLG  7X QH SHX[ SDV DOOHU WH EDWWUH DYHF FH
Philistin, car tu es un enfant, et il est un homme de guerre
GHSXLVVDMHXQHVVH'DYLGGLWj6DO7RQVHUYLWHXUIDLVDLWSDvWUH
les brebis de son pre. Et quand un lion ou un ours venait en
enlever une du troupeau, je courais aprs lui, je le frappais, et
jarrachais la brebis de sa gueule. Sil se dressait contre moi,
je le saisissais par la gorge, je le frappais, et je le tuais. Cest
ainsi que ton serviteur a terrass le lion et lours, et il en sera
du Philistin, de cet incirconcis, comme de lun deux, car il a
insult larme du Dieu vivant. 1 Samuel 17.33-36

56

VieIntroduction
personnelle

Choisis la vie...

Ces versets soulignent que David naffronte pas Goliath par


audace ou par vantardise. Lorsquil tait berger, il a dvelopp
une intimit avec Dieu qui lui a permis daffronter ladversit
et de voir des exaucements. Cette cole de la foi lui a donn de
lassurance, il savait donc que Dieu rpondrait.
Cette communion spirituelle est la bonne manire de vivre lcoute
de la prire. En effet, il ne sagit pas de rpter des phrases en pensant
que Dieu va les accomplir. La vraie coute est un dialogue, un change
constant qui permet de comprendre et de suivre la volont de Dieu.
Cette coute intime et relationnelle apporte une denre
fondamentale lquilibre de notre vie intrieure. Elle nous permet,
par exemple, de prendre une saine autorit sur la convoitise, la
colre ou le ressentiment.

LA PRIRE, UN ACTE DE COMMUNION


PRIRE: SENS UNIQUE

Demande

PRIRE EN COLLABORATION

coute
Demande

La prire chrtienne nest pas limite transmettre des demandes Dieu. Elle
permet de vivre un change fond sur lcoute de lEsprit de Dieu.

Lexemple de David rappelle que la prire est une source de


VROXWLRQV SRXU UpSRQGUH DX[ GpV HW DX[ SUREOqPHV TXL QRXV
entourent. Par notre communion avec Dieu, nous avons aussi accs
jVDFUpDWLYLWpHWjVDVDJHVVHLQQLH/pFRXWHGH'LHXSDUODSULqUH
est la source privilgie qui nous permet de trouver des rponses
avises en lien avec les aspects relationnels, organisationnels,
techniques, environnementaux, mdicaux, politiques, etc.
Dieu connat toute chose, cest donc aussi par lui que nous pouvons
recevoir une sagesse mme de nous aider grer la cration avec
intelligence.
57

Vie
Introduction
personnelle

Choisis la vie...

Selon ce modle, la CHARTE+ nous invite cultiver une relation


de cur avec Dieu, en sefforant de garder ce lien dans nos
activits et nos relations.
Les autres
Le Crateur a conu les hommes pour quils puissent porter sa
lumire et sa sagesse. Ceux qui lont accueilli dans leur cur et
qui vivent selon son amour sont appels devenir des canaux qui
permettent lEsprit saint de rayonner sur leur entourage. Dieu
parle aux hommes par les hommes. La majorit des personnes
qui ont rencontr Dieu ont trouv la foi par le tmoignage des
croyants.

Reconnatre que Dieu peut nous enseigner et nous parler par ceux
qui laiment permet dtre lcoute des autres en considrant que
OHSOXVSHWLWSHXWDYRLUGHVSDUROHVMXVWHVHWLQVSLUpHV&HWWH
attitude dhumilit nous conduit reconnatre la diversit et la
complmentarit des vocations qui sont donnes lglise pour
enseigner, conduire et partager la pense de Dieu (voir ce propos
le chapitre consacr lglise).
Il y a diversit de dons, mais le mme Esprit ; diversit de
ministres, mais le mme Seigneur ; diversit doprations,
mais le mme Dieu qui opre tout en tous. Or, chacun la
manifestation de lEsprit est donne pour lutilit commune.
1 Corinthiens 12.4-7

Dans ce sens, la CHARTE+ nous invite cultiver une coute


des autres sans parti pris et en reconnaissant que Dieu inspire de
nombreuses personnes. Si sa rvlation est distribue dans son
glise, la pense de Dieu nest pas limite cet espace ; ainsi dans
la Bible, Dieu utilise de nombreux canaux pour parler et plusieurs
de ses paroles sont donnes par des paens ou par ses adversaires
(parfois linsu de celui qui sexprime).1 Dieu va mme utiliser
une nesse pour parler un homme qui pensait connatre les
penses de Dieu.2 Comme le montrent ces exemples, la pense de
Dieu peut passer par des voies inhabituelles et surprendre.
1

Par exemple Cyrus (2 Chroniques 36.22), Pilate (Marc 15.2), Caphe


(Jean 11.51), Jthro (Exode 18.13-24).

Voir Nombres 22.28.

58

Choisis la vie...

VieIntroduction
personnelle

Dieu ne se plat-il pas confondre les puissants en utilisant la


bouche des enfants ?1 Tout cela doit nous rendre humbles et
attentifs.
Dieu a choisi les choses folles du monde pour confondre les
sages ; Dieu a choisi les choses faibles du monde pour confondre
les fortes. 1 Corinthiens 1.27

Le verdict des fruits


9RXVOHVUHFRQQDvWUH]jOHXUVIUXLWV&XHLOOHWRQGHVUDLVLQVVXU
GHVpSLQHVRXGHVJXHVVXUGHVFKDUGRQV"Matthieu 7.16

Selon ces paroles de Jsus, la vraie manire dprouver les choses


consiste observer le rsultat et non les apparences. Ce principe
peut sappliquer dans de nombreuses situations et permet, par
exemple, dprouver les qualits dun ouvrier, dun patron,
dun homme politique, dune mthode ducative, dun systme
technique ou autre.
Car lapparence et le prestige sont trompeurs et lon ne compte
plus le nombre dentreprises ou de projets mis mal par des
personnes qui faisaient pourtant bonne impression par leurs titres,
leurs habits ou leur position sociale.
Or, selon la sagesse divine exprime par limage de larbre, le
fruit donne un verdict limpide qui permet de voir comment les
ressources prises par larbre ont t valorises. Savoir ce quune
SHUVRQQHDIDLWDYHFFHTXLOXLpWDLWFRQpGpYRLOHVDYDOHXUHWVHV
FDSDFLWpVGXQHPDQLqUHELHQSOXVHIFDFHTXHGHOLQWHUURJHUVXU
ce quelle prtend pouvoir faire.
Cest donc la lumire de ce qui est rellement produit que nous
devons prouver notre foi et nos capacits ou celles de ceux qui
nous entourent.

tre un modle
En tant que chrtiens, nous avons reu le mandat dapporter un
message qui surpasse tous les autres et qui a la capacit transformer
des vies et dapporter une esprance ternelle. Mais la question se
pose alors de savoir comment faire connatre ce trsor ceux qui
nous entourent.
1

Voir Psaumes 8.2.

59

Vie
Introduction
personnelle

Choisis la vie...

Ce souci de rpandre lvangile a de tout temps conduit les


chrtiens utiliser divers supports de communication. Le message
biblique sest ainsi propag travers le monde par des prdications,
des livres, la radio, la tlvision, linformatique. Tous ces moyens
pour rejoindre les hommes et apporter le message du Salut sont
bons. Toutefois, le meilleur moyen pour tmoigner de lvangile
est, et restera toujours, lincarnation de ses valeurs dans les vies.
Car, nen dplaise certains, lvangile nest pas un concept
intellectuel que lon dveloppe par des mots ou des crits, cest
une puissance qui se rvle entirement par la vie. Dans lAncien
Testament, Dieu a crit des paroles sur la pierre, mais cette
UpYpODWLRQ QpWDLW TXXQ UHHW SUpFXUVHXU GH OD YUDLH OXPLqUH HW
cest par le Christ que Dieu dpose sa rvlation suprme sur la
7HUUH3DUVDPDQLqUHGHYLYUHHWVRQVDFULFH-pVXVHVWOHOLYUHGH
chair qui permet de lire le message central de Dieu.
Le coeur de lvangile nest pas une liste de rgles religieuses,
ce nest pas une morale ni mme le texte de la Bible mais une
personne. Aucun autre support ne peut accueillir et transmettre la
rvlation suprme de lamour de Dieu.
Face cette ralit, il est vident que le rayonnement de lvangile
ne peut se contenter des moyens de communication qui propagent
des paroles, des images ou des crits. Le support principal offert
au monde pour lire lvangile, cest notre vie.
Cest pourquoi lengagement de la CHARTE+ nous invite
tre un modle. En cela il se fait cho des textes bibliques qui
soulignent limportance de traduire les valeurs de lvangile dans
notre vie quotidienne.
 6RLV XQ PRGqOH SRXU OHV GqOHV HQ SDUROH HQ FRQGXLWH HQ
amour, en foi, en puret. 1 Timothe 4.12

Si un chrtien est violent, colrique, fourbe, il pourra dire tout


ce quil veut, sa manire de vivre dsavouera ses paroles.
linverse, une personne aimante et sur laquelle on peut compter
sera considre par son entourage et son tmoignage rayonnera
mme sans quelle dise un mot. Laptre Pierre souligne cet
impact des gestes en disant des femmes quelles peuvent amener
leur mari la foi sans paroles mais par leur conduite.1
1

60

Voir 1 Pierre 3.1.

Choisis la vie...

VieIntroduction
personnelle

Notre manire de vivre constitue lenjeu le plus crucial de notre


tmoignage car il en dit plus que nos paroles. Par exemple, si je dis
que Dieu aime les hommes et que je passe mon temps critiquer
les autres, limage qui simprimera dans mon entourage ne sera
pas le message damour du Christ, mais mon attitude mchante.
Cest pour cette raison que beaucoup denfants de pasteurs se sont
loigns de la foi et sont devenus dsabuss, ils pouvaient voir
mieux que personne la diffrence entre les prdications donnes
par leur pre et la vie familiale de tous les jours.
De nombreuses personnes sloignent aussi de lglise lorsquelles
voient lamertume, la mdisance ou la cupidit sexprimer dans
lassemble. On peut imaginer leur dsillusion, quand elles
dcouvrent une foi chrtienne vide et thorique.
Bien sr, il nest pas possible dtre parfaits et nous ne pourrons
MDPDLVUHpWHUWRXWHODERQWpGH'LHX'HSOXVFHX[TXLVHFURLHQW
irrprochables sont souvent insupportables.
Dans ce domaine il y a un juste quilibre trouver et, tout en
sachant que nous sommes sauvs par la grce et imparfaits, nous
devons chercher appliquer les valeurs de lvangile dans notre
vie et nos relations.
Ce travail pour ressembler au Christ est particulirement important
dans le cadre de la famille ou avec nos voisins. Ces personnes
nous voient vivre : elles vont peut-tre nous couter, mais avant
WRXWHOOHVYRQWOLUHQRWUHPDQLqUHGHYLYUH
Connatre la Bible, avoir une fonction importante, exercer un
ministre... Toutes ces choses sont prcieuses, mais elles ne
sont pas le centre. Ce qui est crucial, cest de vivre selon le juste
modle : Christ. Dans ce sens, nous avons tous progresser et
cest dans la mesure o nous prenons conscience de nos dfauts
que nous pouvons aller plus loin.
Nous pourrions conclure sur ce texte de laptre Pierre qui
rappelle que notre mission envers ceux que nous avons charge
est dtre un modle. Par un bon exemple, nous pourrons recevoir
une couronne ternelle !
Paissez le troupeau de Dieu qui est sous votre garde, non
par contrainte, mais volontairement, selon Dieu ; non pour un
gain sordide, mais avec dvouement ; non comme dominant sur

61

Vie
Introduction
personnelle

Choisis la vie...

ceux qui vous sont chus en partage, mais en tant les modles
du troupeau. Et lorsque le souverain berger paratra, vous
obtiendrez la couronne incorruptible de la gloire. 1 Pierre 5.2-4

Quelques bonnes attitudes pour tre un modle



Tenir sa langue en bride pour ne pas critiquer et dire du mal
(selon Jacques 1.26, 3.2-10).

Respecter sa parole et accomplir ses promesses.

tre doux et patients, en particulier pour viter de cder
la colre.

couter les autres et prendre garde aux enfants et aux
faibles.

Faire attention lexemple que nous donnons dans notre
manire de vivre.

Rester humbles en ce qui concerne nos capacits, mme
quand elles dpassent celles des autres.

Ne pas avoir peur de travailler pour les autres et de les servir.

tre positifs, joyeux et ne pas se prendre au srieux.

LES CARACTRISTIQUES DUN BON MODLE

Assistance

Justice

Srieux
Rigueur

Travail

Un modle conforme lvangile se manifeste dans sa manire de vivre, en


travaillant, en tant rigoureux et prcis, en ayant un fort sens de la justice et
en portant assistance son prochain.

62

Choisis la vie...

VieIntroduction
personnelle

Lexprience de Salomon
'HPDQGHPRLFHTXHWXYHX[MHWHOHGRQQH1 Rois 3.5

Ce sont ces paroles tonnantes que le roi Salomon a entendues de


la part de Dieu lorsquil a commenc rgner en Isral.
Salomon pouvait tout avoir quelle promesse ! Mais aussi quelle
preuve du cur que dentendre le Dieu puissant et crateur vous
proposer dexaucer tous vos souhaits !
Cette exprience de Salomon nous invite nous poser ces
questions :
Que ferions-nous si quelquun nous proposait de rpondre
tous nos dsirs ?
Que choisirions-nous, la sant, la richesse, le grand
pouvoir ?
Que se passerait-il si nous devenions le roi du pays ?
Les rponses que nous pouvons donner ces questions dvoilent
nos motivations relles.
Aujourdhui, un grand nombre de personnes utilisent leur pouvoir
et leurs richesses pour devenir des tyrans effroyables. Mais les
autres ne sont pas forcment meilleurs, que feraient-ils si le
pouvoir et la richesse leur taient offerts ?
Salomon a demand la Sagesse pour exercer la justice. Par cette
demande, il a montr quil avait un sens aigu des responsabilits
et quil se souciait rellement de son peuple. Dieu a exauc sa
demande et la accompagne de bndictions et de richesses.
Quelques pistes pratiques
Vivre une relation avec Dieu, par lcoute de sa Parole et
par la communion.
Marcher dans la volont de Dieu et accomplir la vocation
qui nous est donne.
*****
La langue qui fourche fait plus de mal que le pied qui
trbuche. Proverbe africain

63

Vie
Introduction
personnelle

Choisis la vie...

Citations bibliques: la vie personnelle


Fuis les passions de la jeunesse, et recherche la justice, la foi, lamour,
la paix, avec ceux qui invoquent le Seigneur dun cur pur. Repousse les
discussions folles et inutiles, sachant quelles font natre des querelles.
Or, il ne faut pas quun serviteur du Seigneur ait des querelles ; il doit, au
contraire, tre affable pour tous, propre enseigner, dou de patience ; il
doit redresser avec douceur les adversaires () 2 Timothe 2:22-25
 /D VDJHVVH GHQ KDXW HVW SUHPLqUHPHQW SXUH HQVXLWH SDFLTXH
modre, conciliante, pleine de misricorde et de bons fruits, exempte
de duplicit, dhypocrisie. Le fruit de la justice est sem dans la paix par
ceux qui recherchent la paix. Jacques 4.17-18
Naimez point le monde, ni les choses qui sont dans le monde. Si
quelquun aime le monde, lamour du Pre nest point en lui ; car tout
ce qui est dans le monde, la convoitise de la chair, la convoitise des
yeux, et lorgueil de la vie, ne vient point du Pre, mais vient du monde.
Et le monde passe, et sa convoitise aussi ; mais celui qui fait la volont
de Dieu demeure ternellement. 1 Jean 2.15-17
3UHQH]JDUGHjYRXVPrPHVDQTXHYRXVQHSHUGLH]SDVOHIUXLWGH
votre travail, mais que vous receviez une pleine rcompense. 2 Jean 1.8
Ayez du zle, et non de la paresse. Soyez fervents desprit. Servez le
Seigneur. Romains 12.11
Ayez les mmes sentiments les uns envers les autres. Naspirez pas ce
TXLHVWpOHYpPDLVODLVVH]YRXVDWWLUHUSDUFHTXLHVWKXPEOH1HVR\H]
point sages vos propres yeux. Romains 12.16
4XDVWXTXHWXQDLHVUHoX"(WVLWXODVUHoXSRXUTXRLWHJORULHVWX
FRPPHVLWXQHODYDLVSDVUHoX"1 Corinthiens 4.7
Cest pour la libert que Christ nous a affranchis. Demeurez donc
fermes, et ne vous laissez pas mettre de nouveau sous le joug de la
servitude. Galates 5.1
$WWDFKH]YRXV DX[ FKRVHV GHQ KDXW HW QRQ j FHOOHV TXL VRQW VXU OD
terre. Car vous tes morts, et votre vie est cache avec Christ en Dieu.
Quand Christ, votre vie, paratra, alors vous paratrez aussi avec lui dans
la gloire. Faites donc mourir ce qui, dans vos membres, est terrestre, la
dbauche, limpuret, les passions, les mauvais dsirs, et la cupidit, qui
est une idoltrie. Colossiens 3.2-5

64

CHOISIS LA VIE...
3. RESPECT DU PROCHAIN
Que, par le Christ qui a donn sa vie pour les hommes, je
puisse recevoir une vision nouvelle sur la valeur de ceux qui
mentourent et vivre dans une attitude dhumilit, de pardon et
en agissant avec gnrosit envers les pauvres. Je mengage
user de tolrance et respecter les autres sans tenir compte de
leur religion, origine, ethnie, nationalit ou couleur de peau.
Je promets de respecter le bien dautrui, et, par exemple, de ne
pas prlever de part sur largent ou sur les choses que lon me
FRQH
3RXUrWUHXQHSHUVRQQHGHFRQDQFHMHPHQJDJHjDJLUGDQVXQ
climat de vrit, tre consquent avec ma parole et respecter
mes promesses. Je refuse aussi de recourir la vengeance et
toute forme de violence sortant du cadre de la lgitime dfense.
Une vision nouvelle
Il y a quelques annes, je donnais un sminaire de formation dans
un pays dAfrique. Lassemble se composait de pasteurs, de
responsables sociaux et de diverses personnalits.
Parmi les auditeurs, javais remarqu la prsence dun chef mili-
taire. Vtu de son uniforme, il suivait les cours avec attention.
$X O GH OD IRUPDWLRQ QRXV DYRQV pWXGLp FRPPHQW OD SUpVHQFH
de Dieu pouvait nous gurir et combler nos besoins affectifs.
Chaque jour, les enseignements se poursuivaient par des moments
de prires durant lesquels on pouvait sentir la prsence de Dieu.
Aprs avoir vcu toutes ces choses, plusieurs personnes ont donn
un tmoignage de ce quelles avaient prouv dans leur cur.
La rencontre est devenue particulirement mouvante lorsque le
militaire, qui avait un grade lev, sest lev pour demander la
parole.
Visiblement mu, il a avou que, jusqu ce jour, il avait pris du
SODLVLUjYRLUVRXIIULUFHX[TXLpWDLHQWVHVHQQHPLV$XOGHVRQ
tmoignage, on pouvait comprendre que sa fonction lui permettait
denfermer et de maltraiter des prisonniers et, comme il y trouvait
du plaisir, il ny avait aucune limite leur faire subir un enfer de
souffrance.

65

Respect du prochain

Choisis la vie...

-XVTXHOjVDIRLFKUpWLHQQHQDYDLWSDVGLQXHQFHGDQVVDPDQLqUH
dexercer ses fonctions dans larme. Cependant, en coutant la
Bible et en laissant Dieu agir dans son cur, il venait de sentir un
profond changement sur le regard porter sur les autres. Grce
laction de Dieu, cet homme qui jusque-l prenait plaisir faire du
mal ses ennemis venait de dcouvrir une vision nouvelle.
&RPPHOHPRQWUHFHWWHKLVWRLUHLOQHVXIWSDVGHGHYHQLUFKUpWLHQ
pour accomplir automatiquement la volont de Dieu. Selon
lexemple de ceux qui nous entourent et les penchants de notre
cur, nous sommes le plus souvent tourns vers lignorance,
le mpris et la violence. Cette tendance qui conduit lhomme
pratiquer le mal est universelle et touche aussi les croyants. Avec
son souci de vrit, la Bible prsente de nombreux cas o de
mauvaises actions ont t commises par des personnes qui priaient,
chantaient et confessaient leur amour de Dieu. Parmi ces croyants
entrans dans le mal, on trouve mme le clbre roi David ! Cet
homme, choisi par Dieu et plac la tte du pays dIsral, va
cder par exemple ladultre et senfoncer dlibrment dans la
mchancet en commanditant un meurtre.1
Cette drive nest pas unique et lhistoire de lglise travers les
sicles atteste que de nombreux chrtiens ont jet le discrdit sur
lvangile en faisant des horreurs quils allaient parfois jusqu
MXVWLHU DX QRP GH OD ERQQH QRXYHOOH  'H FHWWH PDQLqUH RQ D
perscut, tortur et tu au nom du Christ. Aujourdhui encore ce
dcalage entre le message de lvangile et lattitude des chrtiens
se manifeste de plusieurs manires et parfois sous des formes les
plus abominables. Ces scandales du pass et du prsent constituent
mme lun des plus grands obstacles la diffusion de lvangile.
Comment ceux qui ont t mchants
avec les hommes au nom du Christ
SRXUURQWLOVVHMXVWLHUGHYDQWFHOXL
TXLDGRQQpVDYLHSRXUHX["

Tout cela doit nous rendre


attentifs, car il serait bien
prtentieux de penser que nous
sommes meilleurs que les autres.

Reconnatre notre faiblesse et notre tendance vivre en dcalage


avec le modle du Christ nous permet de prter une attention
prudente sur la manire dont le mal exerce son emprise sur notre
vie.
1

66

Voir 2 Samuel 11.2-27.

Choisis la vie...

Respect du prochain

Les expressions du mal


3RXU OD PDMRULWp GHV SHUVRQQHV OH PDO VH GpQLW GDQV VHV
H[SUHVVLRQVWUDJLTXHV2QSHXWDORUVIDFLOHPHQWLGHQWLHUOHPDO
commis lors dun meurtre. Au moment du crime, il y a des coups,
du sang, de la souffrance et la mort ; le mal est indiscutable. Il
serait toutefois bien naf de croire que le mal commence agir
lorsquune personne passe lacte ; lorsque le mal parat dans des
gestes concrets, cest le signe quil a dj fait sa place lintrieur
dune vie.

Cette progression du mal est trs bien dcrite dans la Bible, en


particulier lorsque le meurtre vient bouleverser la famille dAdam
et dve. Alors que le projet de Dieu tait que les hommes saiment,
&DwQOHOVDvQpYDVDXYDJHPHQWWXHUVRQMHXQHIUqUH1 Ce crime
abominable commis au sein dune famille ne se fait pas sur un
coup de tte et la Bible dvoile que lassassinat dAbel dbute par
la frustration de Can qui est jaloux du regard favorable que Dieu
porte sur les offrandes de son frre.
Cette approbation divine fait natre en lui une profonde irritation.
Can fut trs irrit, et son visage fut abattu. Gense 4.3

Ces sentiments et lattitude de Can nchappent pas Dieu et


celui-ci sapproche de lui avec sollicitude. Aprs lavoir interrog
sur les raisons de sa tristesse, il lui transmet ce message :
Certainement, si tu agis bien, tu relveras ton visage, et si tu
agis mal, le pch se couche la porte, et ses dsirs se portent
YHUVWRLPDLVWRLGRPLQHVXUOXLGense 4.7

Par ces paroles, Dieu fait comprendre Can quil est menac
par un mal pernicieux qui dsire prendre le contrle de sa vie.
&HW  rWUH  FRXFKp HW j ODIIW VXU OH SDV GH VD SRUWH FKHUFKH
loccasion dentrer dans sa vie.
Notons que, dans le contexte biblique, cette prsence rappelle
lattitude du serpent rampant et sducteur qui, dans le chapitre
prcdent, obtient un pouvoir en sduisant les hommes.

Voir Gense 4.1-10.

67

Respect du prochain

Choisis la vie...

LINVITATION RSISTER

DOMINE...

Can

La tentation
du pch
Diable
Dsirs
meurtriers
Avec lpisode de Can, la Bible met en vidence les enjeux spirituels et humains
qui se jouent face la haine et aux dsirs meurtriers de Satan.

Avec cette sournoise prsence, la situation de Can est critique


et celui-ci doit prendre autorit sur ce mal, do cette invitation
divine : Mais toi, domine sur lui ! 1
Can est un carrefour important : soit il est fort et il domine le
mal en cartant sa haine envers son frre, soit il succombe la
faiblesse et laisse la force rampante le dominer.
Malheureusement, le conseil donn par Dieu nest pas suivi et
&DwQQHVRSSRVHSDVjODIRUFHPDOpTXHTXLSHXWGqVORUVHQWUHU
dans son cur.
Cette conqute permet Satan de lentraner dans le mal ultime :
la mise mort de son prochain :
Can se jeta sur son frre Abel, et le tua. Gense 4.8

68

Notons que lappel fait Can de dominer le pch va dans le sens de la


promesse faite la femme que sa postrit (ses enfants) crasera la tte du
serpent (Gense 3.15). Can na pas cette autorit et se laisse habiter par le
mal.

Respect du prochain

Choisis la vie...

Un mcanisme frquent
Remarquons que ce processus qui conduit Can tuer Abel (celui
que Dieu avait agr) sapplique aussi dans le processus qui
conduira Judas trahir Jsus.
Ce disciple suivait le Christ et faisait partie de lquipe charge
de faire rayonner lvangile. Judas a donc enseign et exerc un
ministre en Isral. Comme les autres disciples, il a pri pour les
malades, dlivr des personnes domines par des esprits mauvais
et proclam la bonne nouvelle de lvangile.
Cependant, Judas nest pas totalement au service de Dieu, car
il nourrit aussi un fort intrt pour largent et cette sduction va
progressivement contaminer son cur. Dans un premier temps, sa
soif de richesses le conduit voler dans la caisse communautaire.1
Par la suite, son ambition de senrichir change son regard et il
considre son entourage selon la valeur quil peut en tirer. Dans ce
processus cupide, lautre nest plus une personne, mais un capital
quil faut rentabiliser Mme lorsquil regarde son matre, il a
des dollars dans les yeux.

LES LUNETTES DE JUDAS

/D%LEOHVRXOLJQHFHWWHLQXHQFHGX
regard dans la tentation du jardin
dden, lorsque le fruit dfendu
est vu comme bon manger (voir
Gense 3.6). Ainsi, lun des plus
sournois buts de la tentation consiste
transformer notre vision pour nous
faire sombrer dans la convoitise (voir
Jacques 1.14-15).

Finalement, la sduction fait entirement son uvre et celui qui


attendait le moment favorable peut entrer
Les rcits des vangiles rvlent cette terrible progression du mal
qui aboutit son paroxysme lors du dernier repas de la Pque :
Satan entra dans Judas. Luc 22.3, Jean 13.27

La suite ne se fait pas attendre et, comme Can qui tue son jeune
frre, Judas joue un rle dcisif dans la mise mort de Jsus.
Finalement, cette force de mort npargnera pas Judas et ce dernier
HVWjVRQWRXUHQWUDvQpGDQVOHJRXIIUHLOPHWQjVHVMRXUV
1

Voir Jean 12.5-6.

69

Respect du prochain

Choisis la vie...

Cet exemple tragique nous permet de discerner quil y a en Satan


un profond dsir de mettre mort le juste. Jsus le dcrira des
religieux qui taient srs dtre des hommes de Dieu.
Vous avez pour pre le diable, et vous voulez accomplir les
dsirs de votre pre. Il a t meurtrier ds le commencement, et
il ne se tient pas dans la vrit, parce quil ny a pas de vrit en
lui. Lorsquil profre le mensonge, il parle de son propre fonds ;
car il est menteur et le pre du mensonge. Jean 8.44

Ces paroles dvoilent la nature du diable et dnoncent lesprit


PHXUWULHUTXLDXFRPPHQFHPHQWDFRQGXLW&DwQjWXHUVRQIUqUH
Cest aussi selon ce mme dsir diabolique que la mchancet
sexprimera travers lhistoire humaine par dinnombrables
crimes, perscutions, guerres, massacres ou gnocides.
Cet clairage doit nous rendre attentifs ; le mal nest pas seulement
un mauvais choix, il sagit dune volont dlibre qui vise
entraner lhomme dans la destruction de son entourage et des
autres.
Heureusement, cette force nest pas toute-puissante et tous les
hommes ne deviennent pas des meurtriers. Lordre tabli par Dieu
dans la cration a donn lhomme une position qui lui lhabilite
exercer une autorit naturelle. Cette force permet beaucoup de
gens de faire le bien sans ncessairement connatre Dieu.
Cette rsistance naturelle de lhomme face aux forces du mal
VH YpULH PrPH GDQV OH FDV H[WUrPH GHV SHUVRQQHV SRVVpGpHV
par des esprits mauvais. Dans les vangiles, Jsus rencontre un
homme habit par une lgion de dmons. Cet homme est devenu
fou et violent, attir par la mort, il est asocial et habite prs des
tombeaux.1
Lorsque Jsus sapproche, il prend autorit et chasse ces mauvais
esprits dans un troupeau de porcs. La raction ne se fait pas
attendre, les cochons habits par ces forces de mort plongent
immdiatement dans la mer et se noient. La rapidit avec laquelle
les cochons se laissent emporter par les esprits mauvais souligne
que lhomme tourment trouvait encore la force de rsister
lobjectif des puissances qui voulaient lentraner dans la mort.
1

70

Voir Luc 8.27-38.

Choisis la vie...

Respect du prochain

&HW H[HPSOH H[WUrPH QRXV FRQUPH TXH OKRPPH QHVW SDV XQ
pantin dmuni et condamn cder aux projets diaboliques. Cr
limage de Dieu, il est pourvu dune muraille spirituelle.
Les histoires de Can et de Judas soulignent que cest uniquement
par un habile processus de conqute que le diable peut prendre le
contrle et conduire au crime. Can tait invit dominer le mal ;
VLOODYDLWIDLWLODXUDLWUHOHYpVDWrWHHWGRQFUHSULVDXWRULWp
sur sa vie.
6RXPHWWH]YRXVGRQFj'LHXUpVLVWH]DXGLDEOHHWLOIXLUDORLQ
de vous. Jacques 4.7

La force du diable cest la faiblesse de lhomme. Celui qui tue,


qui vole, qui fait le mal son prochain est un faible qui a perdu
sa capacit de grer et de dominer son entourage. Celui qui fait
le bien exerce, au contraire, une saine autorit dans sa vie et son
entourage. Cest pourquoi la stratgie du diable consiste affaiblir
les dfenses humaines pour prendre progressivement le contrle.

UNE QUESTION DAUTORIT


LE BIEN

LE MAL
Domination

Autorit

Puisque la domination du diable repose sur la faiblesse humaine, le diable cherche


priver lhomme de sa capacit dominer la cration. Comme lhomme tire son
DXWRULWpGX&UpDWHXUVDVWUDWpJLHPDOpTXHYLVHjOpFDUWHUGH'LHX

/pTXDWLRQIRUFH ELHQHWIDLEOHVVH PDOHVWIDFLOHjSURXYHU


dans notre vie quotidienne ; pardonner demande une grande force,
alors que har est la porte de tous.
71

Respect du prochain

Aimer, cest exercer une force contraire au


mal. Ainsi, ce qui soppose lamour de
Dieu et du prochain conduit toujours une
domination du mal.

Choisis la vie...
carter lhomme de
la connaissance de
Dieu est la premire
action du diable.

Dans le cas de Can, ce sont les ressentiments et la haine qui


font un nid au serpent meurtrier. Can aurait pu suivre la parole
divine et rsister, mais il se laisse emporter par la sduction qui
lui propose de rgler son problme en mettant lautre mort. Par
ce choix, il casse le lien essentiel de lamour et plonge dans la
violence.
Dans le cas de Judas, cest lamour de largent qui le conduit se
dtourner de Dieu. Cette cupidit, dnonce comme une forme
didoltrie,1 rige progressivement un obstacle lamour pour
Dieu et cela entrane Judas dans la mort.
Heureux lhomme qui supporte patiemment la tentation ; car,
aprs avoir t prouv, il recevra la couronne de vie, que le
Seigneur a promise ceux qui laiment. Que personne, lorsquil
HVWWHQWpQHGLVH&HVW'LHXTXLPHWHQWH&DU'LHXQHSHXWrWUH
WHQWpSDUOHPDOHWLOQHWHQWHOXLPrPHSHUVRQQH0DLVFKDFXQ
est tent quand il est attir et amorc par sa propre convoitise.
3XLVODFRQYRLWLVHORUVTXHOOHDFRQoXHQIDQWHOHSpFKpHWOH
pch, tant consomm, produit la mort. Jacques 2.12-15

Ces deux exemples bibliques mettent en lumire les mcanismes


qui conduisent tuer son prochain. Ils rvlent que le mal qui
sexprime dans la socit commence par une subtile conqute des
curs et des penses.
Lidoltrie, la superstition, lamour des richesses sont des
mensonges qui dtruisent les capacits de rsistance de lhomme
et qui lentranent faire du mal son prochain. Par exemple,
le racisme ou lasservissement des femmes tirent leur venin de
concepts, dides et de croyances habilement construites sur le
mpris de lautre. Ce mal commence par une perversion spirituelle
des valeurs morales ; lorsque lasservissement, les meurtres et la
violence apparaissent dans la socit, cest le signe que les racines
sont malades.
1

Faites donc mourir ce qui, dans vos membres, est terrestre, la dbauche,
limpuret, les passions, les mauvais dsirs, et la cupidit qui est une idoltrie.
Colossiens 3.5.

72

Respect du prochain

Choisis la vie...

loppos, il est vident que la paix, le dveloppement, le respect


de lautre, lassistance, lharmonie ne tombent pas subitement sur
les peuples. Ces valeurs sont des fruits visibles de la capacit des
hommes rsister au mal et respecter des principes justes.
La dmocratie, le dveloppement,
le respect des minorits, la
solidarit, la prise en charge des
malheureux, la justice quitable,
toutes ces bonnes choses dpendent
directement des valeurs morales et
spirituelles qui nous habitent.

Mesurer la sagesse, le respect


du prochain, le sens de la
responsabilit et la paix produit
SDU XQH VRFLpWp QHVWFH SDV
la meilleure manire de juger de
la qualit de ses valeurs et de ses
FUR\DQFHV"

3RXUVHQFRQYDLQFUHLOVXIWGHSUrWHUDWWHQWLRQDX[UHFKHUFKHV
des instituts qui valuent le dveloppement des pays1. Leurs
classements soulignent que la qualit de vie des socits est
fortement lie la pntration des valeurs bibliques. Selon ces
classements, les pays les plus paisibles et les mieux dvelopps
VRQWFHX[TXLRQWpWpOHVSOXVLQXHQFpVSDUOHVYDOHXUVELEOLTXHV2,
alors que les plus perturbs sont habits par des concepts animistes
ou islamiques.
*****
La haine trouble la vie, lamour la rend harmonieuse, la haine
obscurcit la vie, lamour la rend lumineuse. Martin Luther King
(Extrait de The Words of Martin Luther King)

La frontire entre le bien et le mal ne passe pas travers les


tats, ni entre les classes sociales, ni entre les partis politiques,
mais au beau milieu du cur de lhomme. Alexandre Soljenitsyne

Pour le classement des villes voir, par exemple, le site internet : www.mercer.fr.
Pour un classement selon les pays, voir le site internet : www.hdr.undp.org.

On peut aussi observer que les peuples qui ont vcu un dveloppement et
une harmonie sociale sans connatre le message de la Bible ont pu le faire en
appliquant des valeurs morales semblables son message (lire ce propos
Romains 2.14-15).

73

Respect du prochain

Choisis la vie...

Les niveaux du mal


,OHVWWRXMRXUVULVTXpGHIDLUHXQHFODVVLFDWLRQGXPDOFDULOQHVW
pas une statue pose dans notre cur et dont on mesure la taille.
Le mal est une force qui, comme le moteur dune voiture, a la
capacit de nous pousser dans une direction contraire lamour de
Dieu et des autres. Chez certaines personnes, le moteur tourne au
ralenti et attend une occasion favorable, chez dautres il tourne
plein rgime. Mais, dans les deux cas, la puissance nfaste est l.
Heureusement, grce au cadre des lois et la (r)pression de
lordre social, la plupart des personnes ne tuent pas leur prochain.
Cependant, quand ces barrires tombent, par exemple lors dune
guerre, la haine sort de sa cage et entrane les hommes dans des
actions abominables.
Cette nature du mal est mise en lumire dans les vangiles
lorsque Jsus apporte son fameux sermon sur la montagne.
cette occasion, il dnonce des expressions du mal qui paraissent
anodines ; le fait dinsulter lautre ou de le traiter dimbcile est
une preuve vidente quune force meurtrire est en nous.1
Un juge disait que ce qui spare le meurtrier de celui qui ne lest
pas, cest une occasion favorable.
Il est certes bien prfrable de navoir pas commis de vol,
dadultre ou de meurtre, mais cela nempche pas que ces choses
soient latentes en nous. En prendre conscience peut nous aider :
tre humble,
prendre garde ce qui nous habite,
demander la grce de Dieu.
Face aux exigences du commandement qui invite aimer son
prochain (mme un ennemi), chaque chrtien reconnatra aisment
quil est loin du but atteindre. Dans ces conditions, nous sommes
tous appels considrer notre chemin de vie avec humilit.
1

74

Voir Matthieu 5.22.

Respect du prochain

Choisis la vie...

Les barmes du mal


Attention, lorsquil sagit du mal, on se compare volontiers celui qui
est plus mchant que nous et qui nous permet ds lors de relativiser
nos petites mchancets. Dans ce tableau, jai volontairement
cart le mal par ignorance qui consiste causer du tort en pensant
bien faire. Cela peut arriver lorsquon manque de sagesse o quon
commette une erreur de manire involontaire.
1. Le mal contre soi-mme
Ce mal tend son action en sattaquant notre dignit. Il nous conduit
par exemple entretenir un mpris de notre propre vie, nous
dvaluer. Ces expressions du mal conduisent souvent cder des
plaisirs qui dtruisent ou sombrer dans des dviances intrieures
(boulimie, anorexie, alcoolisme, etc.).
2. Le mal qui vise les autres
Ce type de mal prend pour cible les autres, sans pourtant aboutir
une violence directe envers eux ; cest un mal contenu dans le secret
(convoitises matrielles ou sexuelles, jalousie, ressentiments).
3. Le mal qui implique le prochain
Avec ce troisime niveau, le mal nest plus limit lintrieur de
notre vie, mais il sme sa maldiction sur les autres en cherchant
enfreindre leurs droits, leur mentir, les voler, les trahir, les faire
souffrir, les tuer. Notons que ce mal concerne aussi le fait de ne pas
faire le bien quon devrait leur faire, comme ne pas honorer nos
parents, user davarice ou ne pas aider quelquun.
4. Le mal qui concerne la communaut
Dans ce type de mal, lhomme se considre comme au-dessus de
la communaut. Tyrannique, il collabore activement des projets
diaboliques et destructeurs. Ce mal ultime le conduit perscuter des
groupes ou des ethnies, massacrer, participer des gnocides.
5. Le mal contre Dieu
Dans les dix commandements, les cinq premires paroles concernent
notre attitude envers Dieu. Lidoltrie, le fait de se prosterner devant
la cration, de prendre le nom de Dieu en vain, ou encore de har
Dieu sont des expressions trs graves du mal. Comme ce mal se joue
dans lespace spirituel, il est moins visible. Ses consquences sont
pourtant dramatiques dans la vie humaine et dans la socit.

75

BIEN

Symtrie

-1
-2
-3
-4
-5
-6
-7

+7
+6
+5
+4
+3
+2
+1

Mensonge
Sduction
Idoltrie
Animosit
Dpendance
Possession
Peur, terreur

Jalousie
Discrimination
Division
Racisme
Haine
Violence
Guerre

Paix
Assistance
Respect, pardon
Collaboration
Unit
galit
quit

Relationnel

'

Subjectivit
4`Z[PJH[PVU
Superstition
Ignorance
Fatalit
Incohrence
Folie

&

Sagesse
Science
Intelligence
Connaissance
ducation
Analyse des faits
Objectivit

Intellectuel

Cupidit, vols
Dclins
Paresse
+tZLY[PJH[PVU
Chmage
Incomptence
Misre

Abondance
Dveloppement
Cration richesses
Gestion ressources
Esprit dentreprise
Innovations
Investissements

Matriel

-1
-2
-3
-4
-5
-6
-7

+7
+6
+5
+4
+3
+2
+1

Symtrie

VIE

MORT

&HWDEOHDXLOOXVWUHODPDQLqUHGRQWODVSKqUHVSLULWXHOOHLQXHQFHOHVGLIIpUHQWVHVSDFHVGHODYLH&HTXLVH[SULPHYLVLEOHPHQW
dans la socit est un indicateur pertinent des valeurs fondamentales qui habitent les hommes. On peut lire le tableau
KRUL]RQWDOHPHQWHQVXLYDQWOHVFRQVpTXHQFHVGHOLQXHQFHVSLULWXHOOHGDQVOHPRQGHYLVLEOHRXVHORQODV\PpWULHYHUWLFDOH
que le tableau met en vidence entre le bien et le mal, par exemple entre la vrit et le mensonge.

MAL

<

Grce, repos
Libert
Autorit
Communion
Rvlation
Discernement
Vrit

Spirituel

LES STRATGIES DU BIEN ET DU MAL

76

Respect du prochain
Choisis la vie...

Respect du prochain

Choisis la vie...

Quel impact dans la socit?


Les voyages en avion sont la manire la plus rapide de se dplacer
travers le monde et chaque jour des centaines de milliers
dappareils dcollent depuis des dizaines de milliers daroports.
Chacun de ces aroports a globalement le mme mandat : offrir
des structures mme de permettre aux avions datterrir et de
GpFROOHUHWJpUHUOHX[GHVYR\DJHXUVHWGHVPDUFKDQGLVHV
Pourtant, tous ceux qui voyagent travers le monde peuvent faire
ce constat : pour certains aroports cela fonctionne trs bien et
pour dautres rien ne va.

Honk Kong

Atlanta

Paris

Kinshasa

Dans la plupart des pays dAsie, les aroports sont des modles
dorganisation ; tout est propre, le service est impeccable et le
mandat complexe de gestion des avions et des voyageurs est
remport avec brio. Parmi ces aroports, ceux de Singapour, de
Soul et de Hong Kong sont considrs comme les meilleurs. Cette
qualit se retrouve aussi dans les pays du nord de lEurope ou aux
86$TXLFRPSWHQWSRXUWDQWOHVDpURSRUWVD\DQWOHSOXVJUDQGWUDF
Laroport dAtlanta doit grer plus de 90 millions de passagers
chaque anne1. Cet aroport conu avec plusieurs pistes parallles
ncessite une gestion trs complexe, les avions devant traverser des
pistes. Sur ces carrefours la moindre erreur serait tragique.
&HWWHUHPDUTXDEOHHIFDFLWpQHVHUHWURXYHPDOKHXUHXVHPHQWSDV
jODpURSRUW&KDUOHVGH*DXOH Paris en France, o la gestion
GHVDYLRQVHWGHVSDVVDJHUVVHPEOHELHQSOXVGLIFLOH(QRXWUH
arriver prendre un avion nest jamais garanti, car laroport peut
tre paralys tout moment par une grve dcrte par lun des
syndicats. Avec ces tares, il est considr par beaucoup comme
lun des pires aroports dEurope2.
La situation peut se dgrader encore lorsque lon atterrit dans
dautres pays, en particulier en Afrique centrale. Ainsi, les
1

Chiffres de 2008.

Ces critiques datent de 2010, la qualit des services de cet aroport et de ceux
des autres pays peut donc avoir chang.

77

Respect du prochain

Choisis la vie...

voyageurs qui arrivent laroport de Kinshasa se retrouvent


immergs dans le chaos et les cris. On ne peut distinguer les
HPSOR\pV RIFLHOV GDQV OD PDVVH GH JHQV TXL VDJLWHQW FDU OH
voyageur est assailli par de nombreux agents qui vont multiplier
les contrles. Lors de ces formalits, les trangers incrdules
dcouvrent que certains membres du personnel cherchent
leur soutirer des dollars. Mme les reprsentants de ltat en
SURWHQW SRXU H[HUFHU GH IRUWHV SUHVVLRQV YLVDQW j REWHQLU GHV
JUDWLFDWLRQV$YHFGHWHOOHVSUDWLTXHVOHX[GHVYR\DJHXUV
apparat comme une occasion dobtenir des richesses. Le chaos
atteint son paroxysme lorsque les bagages arrivent et que les
porteurs se battent pour prendre les valises. Parfois, les voleurs
sont de la partie et certaines personnes se font voler leurs biens.
Cette rapide et forcment caricaturale comparaison des aroports
est une manire trange daborder la question de lamour du
prochain. Habituellement, ce thme est trait selon les sentiments
que nous ressentons pour ceux qui nous entourent.
7RXWHIRLVLOELHQGLIFLOHGHTXDQWLHUODPRXUTXLQRXVKDELWHGH
manire objective. Pour le mesurer, le plus judicieux est encore
GpWXGLHUVRQLQXHQFHDXVHLQGHODVRFLpWp
Toutes les entreprises conomiques et les services administratifs
fonctionnent en additionnant les comptences de leur personnel.
Cette mise en commun est semblable la performance dune
quipe de football qui additionne les capacits individuelles
de ses joueurs. De la mme manire, la russite dun projet
communautaire dpend essentiellement des valeurs qui habitent
les individus. Ainsi, le rsultat global dune entreprise est un bon
indicateur du niveau de conscience des autres. Plus une entreprise
DOHVHQVGXSURFKDLQSOXVHOOHVHUDHIFDFHWDQGLVTXHORUVTXH
lautre na pas de valeur, elle sombre dans le chaos.
Cette ralit permet de comprendre limportance de la parole divine
qui nous invite aimer notre prochain. Ce commandement ne se
limite pas notre vie personnelle ou familiale, il concerne toute
la socit. Il a en outre la capacit de faire clore une conomie
RULVVDQWHDLQVLTXHGHVVHUYLFHVGDVVLVWDQFHHWGHVDQWpHIFDFHV
Ce commandement est donc aussi la cl indispensable pour que
des aroports fonctionnent !
78

Respect du prochain

Choisis la vie...

Un quilibre vital
Linvitation divine DLPHUVRQSURFKDLQFRPPHVRLPrPH fait
partie des deux commandements que Jsus donne lorsquil dsire
rsumer la rvlation biblique :1
 0DvWUH TXHO HVW OH SOXV JUDQG FRPPDQGHPHQW GH OD ORL "
-pVXVOXLUpSRQGLWWXDLPHUDVOH6HLJQHXUWRQ'LHXGHWRXWWRQ
cur, de toute ton me, et de toute ta pense. Cest le premier
et le plus grand commandement. Et voici le second, qui lui est
VHPEODEOHWXDLPHUDVWRQSURFKDLQFRPPHWRLPrPH'HFHV
deux commandements dpendent toute la loi et les prophtes.
Matthieu 22.36-402

LE COMMANDEMENT SUPRME
Ordonnances du culte

crits et prophtes
Lois divines

Le concentr
TU AIMERAS...
DIEU-PROCHAIN

Les commandements qui nous invitent aimer Dieu et notre prochain sont
le moyen le plus juste de rsumer lensemble des lois et des ordonnances de
lAncien Testament.

Voir aussi Luc 10. 25-27.

'DXWUHV WH[WHV FRQUPHQW OLPSRUWDQFH GH FHV FRPPDQGHPHQWV GDQV OH


judasme lpoque de Jsus. Ainsi, le Talmud relate lhistoire dun non-juif
qui vint se prsenter devant le rabbin Hillel pour se convertir condition que
ce dernier lui enseigne toute la Thora pendant le laps de temps quil pourrait
WHQLUVXUXQSLHG+LOOHOOXLUpSRQGLW1HIDLVSDVjWRQSURFKDLQFHTXHWX
QHYRXGUDLVSDVTXHORQWHIDVVH9RLOjOHVVHQFHGHWRXWHOD7KRUDOHUHVWH
ntant quune consquence de ce principe lmentaire (Chabbath 31 A).

79

Respect du prochain

Choisis la vie...

Comme le montre le dessin, le commandement mis en vidence


par Jsus et qui nous invite aimer notre prochain est au cur
de la rvlation biblique.1 Quel est donc le secret qui lui permet de
concentrer une telle rvlation en quelques mots ?
Ltude de ce commandement rvle que sa force repose sur un
prcieux quilibre. Ainsi, le commandement divin ne mentionne
pas une longue liste de choses faire pour aimer son prochain.
Non, linvitation divine est au contraire trs brve et son centre
UHSRVHVXUXQPRWWUqVVLPSOHFRPPH
'DQV OHV WH[WHV RULJLQDX[ OH VHQV GH FH PRW VLJQLH  VHORQ 
DXWDQWGHPDQLqUHVHPEODEOH/RUVTXH'LHXQRXVLQYLWHj
DLPHUFRPPHLOQRXVUpYqOHTXHORQQHSHXWOXLSODLUHVDQV
appliquer une galit de valeur entre les hommes.
Notons que ce principe dgalit entre les hommes tait dj le
fondement des lois de lAncien Testament. Par exemple, la loi du
talion qui consistait dire il pour il et dent pour dent
tait une faon remarquable dintroduire un principe dgalit.
Puisque lil de mon voisin a la valeur de mon prcieux il, si je
lui fais du mal, je me fais du mal moi.
Par cette loi, Dieu avait dj transmis lhomme les fondements
dgalit indispensable ltablissement de la justice. Cette loi
destine sanctionner le mal visait contenir la mchancet
en sappuyant sur la crainte de subir la mme chose. Cette loi
rudimentaire proclamait lgalit entre les hommes pour limiter
le mal,DORUVTXHOHFRPPDQGHPHQWGDLPHUFRPPHVDSSXLH
sur ce principe dgalit pour dvelopper le bien.
La balance
Dans le dessin ci-contre, le commandement qui nous invite aimer
notre prochain comme nous-mmes est compar une balance.
/HFRPPHGXFRPPDQGHPHQWIDLWRIFHGHSLYRWHQWUHPDYLH
et celle de mon prochain.
1

80

Dans le judasme, ces commandements vont devenir trs importants aprs la


destruction du temple de Jrusalem en lan 70. Priv de leur centre spirituel, les
-XLIVQHSHXYHQWSOXVIDLUHGHVDFULFHVRXDFFRPSOLUOHVUqJOHVFXOWXHOOHV$YHF
cette absence de temple, le judasme se focalise sur des valeurs intrieures dont
les plus grandes consistent aimer Dieu et son prochain.

Respect du prochain

Choisis la vie...

LE SECRET DU COMMANDEMENT
Une loi fonde sur lquilibre

Tu aimeras...
Comme
Toi-mme

Prochain

Le principe fondamental du commandement est de minviter trouver lquilibre


entre ma vie et celle de ceux qui mentourent. Avec ce fabuleux principe, le
FRPPDQGHPHQWVDGDSWHDX[FDSDFLWpVVSpFLTXHVGHFKDFXQ

Limage de la balance permet de comprendre que le comman-


dement suprme nous invite considrer les autres comme pesant
OH PrPH  SRLGV  TXH QRXVPrPHV &HVW GDQV FH SUpFLHX[
quilibre entre ma vie et celle des autres que saccomplit la
volont de Dieu.

LINJUSTICE DE LINGALIT

Toi-mme

Le dsquilibre

Tu naimeras pas...
Comme
Lautre
Lorsque le sens de la valeur de lautre est corrompu par lorgueil, lautre est
considr comme tant moins important. Lquilibre se brise, laissant linjustice
se manifester dans les relations.

81

Respect du prochain

Choisis la vie...

Mais cet quilibre est fragile, et lon ne saurait trouver le point


dquit par ses propres forces. Sans Dieu, la balance entre
lhomme et son prochain marque le plus souvent une forte
diffrence de poids entre les plateaux.
La situation dingalit la plus frquente est celle o le prochain
na pas ou peu de valeur. Par orgueil, je vais considrer que lautre
a moins de poids que moi.

LA TENTATION DE LINGALIT

Tentatio
n

La menace du dsquilibre

Tu aimeras...
Comme
Homme

Femme

Les attaques contre le commandement divin se manifestent sous la forme dun


dsquilibre visant se considrer comme suprieur de lautre. Cette tendance
touche par exemple lgalit entre lhomme et la femme.

Ce dsquilibre se manifestera dans mes relations avec les autres,


ainsi quentre des groupes dindividus et des nations. Par exemple,
le fait de considrer les femmes comme infrieures ou de faire
des distinctions de valeur entre les tribus ou les races conduit
drgler la balance. Ce dsquilibre est favoris par des contextes
valorisants les discriminations et lgosme, il se manifeste donc
davantage dans les environnements qui favorisent lhonneur du
clan ou la performance individuelle.
/RUVTXH  ODXWUH  HVW PpSULVp RX FRQVLGpUp FRPPH LQIpULHXU
VRQSRLGVGLPLQXHHWODEDODQFHEDVFXOHOHFRPPDQGHPHQW
damour est mis en chec et lenfer arrive.

82

Respect du prochain

Choisis la vie...

UNE MENACE POUR LA SOCIT

Tentatio
n

Tu aimeras...

Comme
Mon groupe

Les autres

La tentation de rompre lgalit de valeur entre les hommes prend aussi une
forme collective. Cette attitude consiste mpriser ceux qui ne font pas partie du
groupe (racisme, haine entre tribus, orgueil national, lutte de classe, etc.).

Comme le sous-entend limage de la balance, laplomb peut aussi


tre rompu par un surpoids plac de lautre ct. Cette intervient
ORUVTXHODXWUHGHYLHQWSOXVLPSRUWDQWTXHVRLPrPH&HW\SH
de drglement est trs frquent dans les pays communistes et
asiatiques o lon considre que la vie personnelle na de valeur
que dans la mesure o elle sert la socit.
Selon cette vision, la valeur des individus est ngligeable et il est
OpJLWLPHGHOHVVDFULHUSRXUOHELHQGXJURXSH/HVNDPLND]HVTXL
taient recruts par larme japonaise lors de la Seconde Guerre
mondiale sont lexemple ultime dun systme qui organise le
VDFULFHGHVHVVXMHWVSRXUGpIHQGUHGHVDPELWLRQVQDWLRQDOLVWHV
Lorsque la balance penche de cette manire, lenfer peut prendre
une apparence trompeuse. Ainsi, certains pays peuvent devenir
WUqVSHUIRUPDQWVHWDIFKHUGHWUqVIRUWHVFURLVVDQFHVpFRQRPLTXHV
Mais derrire ces dcors dors se cachent malheureusement les
destins crass de millions de personnes.
Une radiographie de lquilibre
Dans la socit, on trouve diffrentes manires de rompre
lquilibre entre les individus et leurs prochains. Toutefois,
FHV GpVpTXLOLEUHV QH VRQW SDV WRXMRXUV DJUDQWV HW EHDXFRXS GH
personnes ou de groupes pensent tre justes et appliquer des
principes dgalit avec leur entourage. Comment savoir si la
balance penche ?

83

Respect du prochain

Choisis la vie...

La manire la plus simple de discerner les dsquilibres entre


lhomme et son prochain consiste observer les rsultats apports
lors de projets qui nous obligent nous appuyer sur notre
prochain.
Les entreprises font partie de ces espaces qui ncessitent des
changes et des relations. Le fonctionnement dun aroport
est ainsi une mise en commun de nombreuses comptences et
de moyens. Son fonctionnement global dpend des changes
KXPDLQVHWLOVHUDGRQFIRUWHPHQWLQXHQFpSDUODPDQLqUHGRQWOH
prochain est valu.
Avec une vision cupide, le voyageur sera considr comme une
richesse quil faut dpouiller alors que, dans une vision quitable
de lautre, il sera peru comme un semblable qui a besoin de
VHUYLFHVHWGDVVLVWDQFH&HVGHX[YLVLRQVGXSURFKDLQPRGLHQW
radicalement la nature des prestations.
Dans le dessin ci-contre, nous pouvons observer combien le
GHJUp GpTXLOLEUH HQWUH OKRPPH HW VRQ SURFKDLQ LQXHQFH
le fonctionnement de la socit. Le graphique illustre que
cest au sein dun quilibre de valeur entre les hommes que le
dveloppement conomique et social est possible. La rupture dun
tel quilibre entrane toujours une dgradation des relations et du
dveloppement. Cette rgle, qui sapplique tous les secteurs de
la socit, permet de faire une analyse pertinente du potentiel des
groupes humains et, par exemple, de comprendre pourquoi les
aroports internationaux prsentent de si grandes diffrences dans
leur fonctionnement1.
Dans les pays asiatiques, chaque employ se sentira totalement
engag dans la mission globale de laroport et celui qui y
travaille le fait pour le prestige global. Avec cette perception du
ELHQFRPPXQOHWUDYDLOOHXUQHVWJpQpUDOHPHQWSDVVXIVDPPHQW
respect et il devra se donner entirement sa tache, quitte, sil
le faut, faire gratuitement des heures supplmentaires. Comme
le personnel a un sens aigu du bien commun, le voyageur est
considr comme un roi, il est particulirement bien soign.
1

84

Rappelons que ces exemples mettent en vidence des principes gnraux.

Respect du prochain

Choisis la vie...

LES DIFFRENTS TYPES DE SOCIT

Autres

Individu

-
n
Tentatio

Tentatio
n

quilibre
Comme

ENFER

galit - Justice

ENFER

Idal biblique
Lquilibre entre le
droit individuel et
le respect de lautre
permet la croissance.

Animisme
Lindividu est cras
par le culte aux
anctres et la tribu.

Individualisme
La vision de la libert
et de ses droits
conduit craser
lautre.

Communisme
Le systme broie les
individus au nom du
bien commun.

ENFER

Zone de dveloppement

ENFER

Les consquences sociales

Ce dessin illustre les enjeux de lquilibre de valeur entre lhomme et son prochain.
Lapplication des principes dgalit apporte la prosprit, mais lorsque des
dsquilibres se produisent dun ct ou de lautre cela conduit faire basculer les
socits dans loppression et la pauvret.

85

Respect du prochain

Choisis la vie...

Dans un contexte dEurope du Nord ou aux tats-Unis, la


perception du bien commun est moins forte, car chaque employ a
galement conscience de ses droits prserver sa vie et les intrts
de sa famille. Le fonctionnement sera donc bti davantage sur un
concept dgalit de traitement. Selon ces valeurs, le client est une
personne qui a autant de poids quun employ. Ce dernier travaille
en cherchant respecter un juste quilibre entre ses intrts et
ceux des voyageurs.
Lexemple de laroport de Paris est le bon modle dune
perception de lautre amoindrie. Dans le contexte franais, les
travailleurs sont spars par des luttes de classes. Le prochain est
donc dabord celui qui a le mme syndicat. Selon ces valeurs, le
personnel travaille prioritairement pour lui et pour sa corporation.
Comme la vision du bien commun est amoindrie, les pilotes, les
aiguilleurs du ciel ou dautres services nhsiteront pas faire
grve pour bloquer laroport. Avec cette perte du respect de
lautre, il apparat comme lgitime de prendre les voyageurs en
otages.
Laroport de Kinshasa est une bonne illustration des problmes
qui surviennent lorsque le sens de lautre et du bien commun sont
IRUWHPHQW HQWDPpV /HV WUDGLWLRQV OHV FRQLWV HW OHV GLIFXOWpV
conomiques du pays ont cr un tissu social dans lequel les
habitants essayent de survivre comme ils peuvent. Avec cette
TXrWHGHUHVVRXUFHVFKDFXQYLVHXQSURWSHUVRQQHORXFHOXLGHV
membres de sa famille. Dans ce contexte, le voyageur a trs peu de
valeur et tous ceux qui obtiennent une fonction vont chercher en
tirer avantage. Le chaos catastrophique qui en dcoule permet de
mesurer combien le respect de lautre est une denre fondamentale
pour faire fonctionner une entreprise ou dvelopper un pays.
Dieu vise le bien de chacun.
Toutefois, laccomplissement de
cette volont requiert que
les hommes se respectent et
travaillent
ensemble
en
cherchant amliorer le niveau
commun de leur qualit de vie.

86

Notre tude visant mesurer limpact


des valeurs morales dans la socit
dmontre quil est impossible de
dvelopper une entreprise denvergure
sans un principe dgalit entre notre
vie et celle de notre prochain. Cet
quilibre entre nos intrts et ceux des

Choisis la vie...

Respect du prochain

personnes qui nous entourent est lune des valeurs fondamentales


de lvangile.
Tout ce que vous voulez que les hommes fassent pour vous,
IDLWHVOHGHPrPHSRXUHX[FDUFHVWODORLHWOHVSURSKqWHV
Matthieu 7.12 (Luc 6.31)

7RXWHODORLHVWDFFRPSOLHGDQVXQHVHXOHSDUROHFHOOHFL7X
DLPHUDVWRQSURFKDLQFRPPHWRLPrPHGalates 5.14
6LYRXVDFFRPSOLVVH]ODORLUR\DOHVHORQOeFULWXUH7XDLPHUDV
WRQSURFKDLQFRPPHWRLPrPHYRXVIDLWHVELHQJacques 2.8

Comme le soulignent ces paroles, aimer lautre comme soi-mme


nest pas un concept abstrait, mais une manire de vivre qui
sexprime par des actes. Par exemple, notre faon de conduire un
vhicule rvle la manire dont nous considrons les autres.
Avec une voiture je peux en quelques instants blesser ou tuer.
Si mon amour pour les autres est Histoire de conduite
rel, je conduirai forcment avec Un pasteur suisse se rendait en
YRLWXUHjORIFHGXGLPDQFKH$ORUV
prudence de manire limiter quil tait sur la route, une voiture
les dangers. Je serais courtois qui le suivait a commenc lui
avec les pitons et les autres faire des appels en allumant et en
ses phares. Visiblement,
usagers. Cest par nos actes que teignant
ceux qui taient dans ce vhicule
lon peut voir si lon accorde de trouvaient que le pasteur ne
la valeur aux autres. Ainsi, cest conduisait pas bien et voulaient
par respect pour eux que lon va, passer devant lui.
par exemple, tre lheure un Face cette attitude, le pasteur a
rendez-vous, respecter le bien commenc se mettre en colre et
crier en faisant des signes contre
dautrui (et pas seulement quand ces personnes qui critiquaient sa
lon me voit), tenir sa parole, etc. manire de conduire.
Par tous ces exemples, nous
pouvons comprendre combien
le fait daimer son prochain
comme soi-mme est porteur de
dveloppements et susceptible
de transformer positivement un
pays.

Finalement, la voiture est passe et


le pasteur fch est arriv dans les
locaux de lglise.

Une fois sorti de sa voiture, il a


vu lun des chrtiens venir sa
rencontre avec un grand sourire.
Bonjour, pasteur, vous nous avez
vus sur la route quand on vous a
salu avec nos phares

87

Respect du prochain

Choisis la vie...

Un vangile qui fait la diffrence


En tant que chrtien, il est important de se rappeler que lvangile
QDSSDUWLHQWjDXFXQHHWKQLHHWTXHFHX[TXLSURWHQWGHOLPSDFW
des bonnes valeurs de la Bible nen sont pas les propritaires (et
pas forcment les bons tmoins). Lvangile est un cadeau qui
soffre toute personne qui aspire profondment vivre une
relation damour avec Dieu et avec son prochain.
La foi chrtienne ne se limite donc pas lesprance de la vie
ternelle, elle est aussi une merveilleuse puissance de vie capable
de contrer les sductions qui conduisent la dsolation. Si nous
marchons selon lEsprit du Dieu crateur, nous serons logiquement
conduits par une sagesse en totale harmonie avec la cration et la
socit. Grce au soutien de lEsprit, nous pourrons combattre les
ravages du mal en apportant une aide aux opprims, en nourrissant
les affams, en apportant des soins, etc.
Cette dmonstration, le Christ la faite en produisant des fruits
concrets damour et de justice dans son entourage. Par ses uvres,
il a dmontr sa victoire sur les forces qui conduisent la mort
ainsi que sa capacit nous conduire dans lexcellence.
Lamour de Dieu
et du prochain
forme un tout que
lon ne saurait
sparer.
Dire que lon aime
Dieu en cultivant
la haine de lautre
est absurde.

Aujourdhui, alors que le mal multiplie ses


emprises, il est essentiel que les chrtiens
soient les tmoins du potentiel de lvangile.
Pour cela, il ne sagit pas de viser trop haut
en prtendant changer le monde de manire
abstraite. Notre rle est plus concret : il consiste
jH[SULPHUQRWUHIRLGDQVQRV]RQHVGLQXHQFH
directes (famille, glise, travail, etc.).

En tant que chrtiens, nous pensons souvent que ce qui plat


Dieu cest de lui offrir nos prires et notre louange. Les chants et
les clbrations apparaissent comme les moments les plus intenses
de notre adoration. Cela est bon et il est sr que Dieu trouve du
plaisir recevoir notre ferveur. Cependant, il y a un rel danger
TXHFHWWHGpYRWLRQQLVVHSDUSHUGUHVRQVHQV3RXU'LHXHQHIIHW
la plus belle expression de lamour que nous lui portons se mesure
dans notre capacit aimer les autres.
Lvangile nest donc pas seulement le fait de prier pour la
dlivrance, la gurison et le pardon des pchs, cest aussi une
88

Choisis la vie...

Respect du prochain

extraordinaire puissance capable de crer une socit btie sur


lamour du prochain. Ce fondement est la cl qui permet dapporter
OHIFDFLWpODFUpDWLRQGHULFKHVVHVOHUHVSHFWHWODSDL[
Soyons donc des chrtiens charismatiques qui usent de lassistance
de Dieu dans nos relations avec les autres. Par cela, nous ferons
reculer la pauvret, la violence et toutes les oppressions du mal.
Cest dans cet tat desprit que nous pouvons invoquer Dieu pour
quil nous aide traduire en bonnes ides et en actions les richesses
apportes dans notre cur par sa rvlation.
Dmarche vivre en groupe
Essayez de sortir de vos habitudes de prire en largissant votre
vision selon les divers espaces indiqus dans le tableau : spirituel,
relationnel, intellectuel, matriel.

1. Influences
Dbat : 'pQLVVH] OHV SULQFLSDOHV LQXHQFHV GLDEROLTXHV TXL
selon vous, se manifestent dans votre environnement : vie, famille,
localit, rgions (soyez concret).
Prire :3UpVHQWH]j'LHXOHVLQXHQFHVTXHYRXVDYH]PLVHVHQ
vidence. Invoquez son autorit et demandez quil vous inspire
DQGHWURXYHUGHVPR\HQVSRXUIDLUHFHVVHUFHVHPSULVHV

2. Actions
Dbat : Quels sont, selon vous, les principaux besoins et
problmes concrets qui ncessiteraient une ide inspire, une
solution relationnelle, technique, conomique, etc.
Prire :3UpVHQWH]j'LHXFHVGpVHQOXLGHPDQGDQWGHODVDJHVVH
pour trouver les solutions et les mettre en pratique (selon lptre
de Jacques 1.5).
La plus grande louange que lon
peut offrir Dieu, cest daimer
activement son prochain.

89

Respect du prochain

Choisis la vie...

Citations bibliques: le respect du prochain


Nous savons que nous sommes passs de la mort la vie, parce que
nous aimons les frres. Celui qui naime pas demeure dans la mort.
1 Jean 3.14 (voir aussi sae 1.13-15)

cause de cela mme, faites tous vos efforts pour joindre votre foi
la vertu, la vertu la connaissance, la connaissance la matrise de soi,
la matrise de soi la patience, la patience la pit, la pit lamiti
fraternelle, lamiti fraternelle lamour. Car si ces choses sont en vous,
et y sont avec abondance, elles ne vous laisseront point oisifs ni striles
SRXUODFRQQDLVVDQFHGHQRWUH6HLJQHXU-pVXV&KULVW2 Pierre 1.5-8
7RXWHODORLHVWDFFRPSOLHGDQVXQHVHXOHSDUROHFHOOHFL7XDLPHUDV
WRQSURFKDLQFRPPHWRLPrPH Galates 5.14
Celui qui mprise son prochain commet un pch, mais heureux celui
qui a piti des misrables ! Proverbes 14.21
%LHQDLPpVDLPRQVQRXVOHVXQVOHVDXWUHVFDUODPRXUHVWGH'LHX
et quiconque aime est n de Dieu et connat Dieu. Celui qui naime pas
na pas connu Dieu, car Dieu est amour. 1 Jean 4.7-8
Mais maintenant, renoncez toutes ces choses, la colre, lanimosit,
la mchancet, la calomnie, aux paroles quivoques qui pourraient
sortir de votre bouche. Ne mentez pas les uns aux autres, vous tant
dpouills du vieil homme et de ses uvres, et ayant revtu lhomme
nouveau, qui se renouvelle, dans la connaissance, selon limage de celui
qui la cr. Colossiens 3.8-10
9RLFLFHTXHYRXVGHYH]IDLUHTXHFKDFXQGLVHODYpULWpjVRQSURFKDLQ
jugez dans vos portes selon la vrit et en vue de la paix ; que nul en son
cur ne pense le mal contre son prochain, et naimez pas le faux serment,
car ce sont l toutes choses que je hais, dit lEternel. Zacharie 8.16-17
/HTXHOGHQWUHYRXVHVWVDJHHWLQWHOOLJHQW"4XLOPRQWUHVHVXYUHV
par une bonne conduite avec la douceur de la sagesse. Jacques 3.13
/DYRORQWpGH'LHXFHVWYRWUHVDQFWLFDWLRQTXHYRXVYRXVDEVWHQLH]
de la dbauche, que chacun dentre vous sache prendre femme dans la
saintet et lhonneur, sans se laisser emporter par le dsir comme font
les paens qui ne connaissent pas Dieu, que nul nagisse au dtriment
de son frre et ne lui cause du tort en cette affaire, car le Seigneur tire
vengeance de tout cela, comme nous vous lavons dj dit et attest.
1 Thessaloniciens 4.3-6

90

CHOISIS LA VIE...
4. COUPLE ET FAMILLE
Je mengage reconnatre que lhomme et la femme sont deux
tres de mme valeur et dfendre leurs droits et leur dignit, en
particulier pour les femmes lorsquelles sont opprimes.
En accord avec la rvlation biblique, je considre que lalliance
du mariage est un projet sacr qui vise exprimer lamour de
Dieu et du prochain. Je demande Dieu de massister dans la
gestion de ma sexualit de manire ce quelle puisse spanouir
GDQV XQH UHODWLRQ GqOH -H PHQJDJH j UHVSHFWHU OHV FRXSOHV
et reconnatre leur droit de fonder une famille sans subir
lingrence des tiers.
Considrant combien les enfants sont prcieux aux yeux de
Dieu, je mengage les respecter, les dfendre et les assister,
en particulier les orphelins. Si je suis parent, je demande Dieu
quil maide lever mes enfants et les encourager. Pour eux,
je mengage progresser en cherchant tre un modle de
douceur et de juste autorit.

La famille: le jardin du dveloppement


premire vue, on pourrait penser que les relations entre lhomme
et la femme concernent des sphres intimes et prives et quelles
QRQWSDVGHJUDQGHVLQXHQFHVVXUOHVDVSHFWVSOXVJOREDX[TXL
concernent le fonctionnement dun pays. Pourtant, lorsquon
prend la peine de creuser des thmes de socit tels que le droit,
lconomie, lcologie, etc. on prend vite conscience que tous ces
aspects convergent vers la famille.
Larchitecture du couple et de la famille touche des aspects
essentiels parmi lesquels le plus important est la manire dont
sexercent les relations entre lhomme et la femme.

La famille est le noyau central du dveloppement. Cest dans cet


espace que commence la vie, que se forge notre vision du monde et
que nous sont donns les fondements ncessaires la construction
de notre identit.
91

Couple
Introduction
et famille

Choisis la vie...

0RQWUHPRLWDIDPLOOHHWMHGLUDLTXHOVHUDWRQDYHQLU

0DIDPLOOHHVWOHSUHPLHUHVSDFHTXLFRPPXQLTXHGHVYDOHXUV
&HOOHVFL YRQW VH GpQLU VHORQ OHV FDSDFLWpV HW OHV RULHQWDWLRQV
prises par mes parents. Si la famille dans laquelle je viens au
monde valorise la musique, les tudes ou le sport, cela minvitera
le faire. linverse, si ma famille na pas de considration pour
VRQHQYLURQQHPHQWLOPHVHUDWUqVGLIFLOHGHYDORULVHUOHPLOLHX
o jhabite.
Mais limpact de la famille ne se limite pas transmettre des valeurs,
VRQLQXHQFHODSOXVSURIRQGHUHSRVHVXUVRQDUFKLWHFWXUHHW
sur le modle de relation quelle applique. Ainsi, cest la manire
de vivre la relation dans le couple qui est laspect le plus important
de la famille et son impact dpend de la faon dont lhomme et la
femme vivent ensemble.

Les diffrentes formes familiales et du couple


Notre Terre est habite par un nombre considrable de peuples et
de tribus. Tous se distinguent par leur langage, leurs coutumes ou
leurs croyances. Lorsque lon voyage travers le monde, on est
souvent frapps par les diversits culturelles qui sexpriment dans
lestimation des valeurs et dans la vie quotidienne. Les relations
entre les hommes et les femmes, la formation des couples et la
manire de construire la famille font partie des lments essentiels
TXLGpQLVVHQWXQHVRFLpWp
Sur le plan mondial, il existe quelques rares tribus o les femmes
dtiennent le pouvoir, mais dans la grande majorit des cas la part
prdominante des forces qui rgissent les socits est dans la main
des hommes.
Cette tendance universelle sexplique par plusieurs facteurs : la
femme est plus faible physiquement et, par sa maternit et les
soins aux enfants, elle est en outre plus implique dans son foyer.
En se concentrant davantage sur la famille, la femme est moins en
prise avec les domaines politiques et conomiques.
Mais cela nexplique pas tout et, dans de nombreux cas, le statut
de la femme est mpris alors quelle est par ailleurs un objet de
convoitise. La femme est alors souvent place dans une position
infrieure et dvalorise. Il est probable quun dsir infernal de
92

Choisis la vie...

Couple
Introduction
et famille

FRPSpWLWLRQPDVFXOLQWURXYHXQHMXELODWLRQGDQVOHIDLWGHVDIFKHU
au-dessus des femmes. Avec cette sournoise domination, celles-ci
sont alors rduites au statut desclaves, corvables merci et sans
pouvoir exercer de responsabilits.
Ce mpris de la condition fminine peut sexprimer de manire
extrmement sordide comme dans certaines socits qui
dterminent la valeur des femmes selon un barme commercial.
&HV FDOFXOV FRQGXLVHQW j FRQVLGpUHU OHV OOHV FRPPH PRLQV
rentables que les garons, celles-ci sont donc perues comme un
fardeau conomique pour leur famille.
Par exemple, la limitation des naissances applique en Chine qui
force les couples navoir quun seul enfant a conduit favoriser
les garons de manire systmatique et liminer des millions de
SHWLWHVOOHVDYDQWRXDSUqVOHXUQDLVVDQFH
Selon un regard biblique, le processus qui conduit la dvalorisation
de la femme est foncirement diabolique. Plusieurs textes montrent
que la haine envers les femmes et envers les nouveau-ns est une
expression de ladversit qui sexerce contre Dieu.
Le fondement de cette haine diabolique qui vise les femmes et
les enfants trouve sa source dans le jugement qui frappe Satan.
Selon le rcit de la Gense, la premire consquence qui touche
OHVHUSHQWHVWTXLOGHYLHQWXQUDPSDQW FHTXLV\PEROLVHVD
chute spirituelle).1 ce jugement sajoute une deuxime sentence
qui annonce clairement au serpent que la femme et les enfants qui
VRUWLURQWGHVRQVHLQQLURQWSDUOXLpFUDVHUODWrWH
Je mettrai inimiti entre toi et la femme, entre ta postrit et
VD SRVWpULWp  FHOOHFL WpFUDVHUD OD WrWH HW WX OXL EOHVVHUDV OH
talon. Gense 3.15

Cette prophtie de la victoire sur le serpent diabolique est une


merveilleuse promesse pour lhumanit, mais une terrible nouvelle
SRXU OH GLDEOH &HWWH PHQDFH VXU OD  WrWH  GX GLDEOH H[SOLTXH
SRXUTXRLFHOXLFLFKHUFKHjOHVPRUGUHHWjOHVIDLUHPRXULU
/HVGHX[H[HPSOHVELEOLTXHVOHVSOXVVLJQLFDWLIVGHFHWWHKDLQH
meurtrire sont les vnements de lexode dans lequel le pharaon
1

Ce jugement qui fait tomber Satan sera accompli par luvre du Christ la croix.
Voir Apocalypse 12.12 et aussi sae 14.12-15 dans lequel le roi tyrannique est
associ Satan.

93

Couple
Introduction
et famille

Choisis la vie...

gyptien fait mourir les enfants hbreux1 et celui dans lequel


Hrode massacre les enfants de Galile.
Dans ces deux cas, le moteur de ces actions est de chercher faire
mourir le librateur. Toutefois, ces tentatives nempcheront point
la promesse de saccomplir :
0RwVH VDXYp GHV HDX[ QLUD SDU pFUDVHU OH SRXYRLU GX
pharaon.
Christ, protg du massacre, fera tomber lemprise de Satan.
Comme le montrent ces deux exemples, la violence faite aux
enfants et la discrimination des femmes ont des racines diaboliques
et touchent des aspects spirituels. Ces liens expliquent pourquoi
EHDXFRXS GH UHOLJLRQV MXVWLHQW OHV GLVFULPLQDWLRQV IDLWHV DX[
IHPPHVDXQRPGHOHXUGLHX2/DMXVWLFDWLRQGHFHVLQMXVWLFHV
DX QRP G DEVROXV GLYLQV  WUDKLW OHXUV UDPSDQWHV RULJLQHV
Cela est dautant plus tragique quavec leurs cautions religieuses
ces oppressions sont verrouilles et ne peuvent tre remises
en question ou combattues de manire rationnelle. Dans cette
situation, il nest pas possible de changer le statut des femmes
sans changer les fondements religieux et spirituels.
La famille est le fondement architectural de la socit ainsi que
lun des facteurs les plus importants pour le dveloppement dun
pays. Cest elle qui nous donne la vie, nous accueille et permet
notre croissance. La famille joue donc un rle essentiel dans la
formation de notre identit et des tudes ont montr que la forme
familiale tait en lien troit avec les niveaux de richesse et de
qualit de vie.3
Dans les paragraphes suivants, nous allons analyser sommairement
OD PDQLqUH GRQW FHUWDLQHV UHOLJLRQV HW FXOWXUHV GpQLVVHQW OD
relation entre lhomme et la femme. Toutefois, avant de faire ces
descriptions, il est important de prciser quil sagit de lignes
gnrales.
1

Voir Exode 1.22.

Rappelons que certaines formes du christianisme ont aussi dvelopp ce mpris


GHVIHPPHV&RPPHQRXVOHYHUURQVSDUODVXLWHFHWWHDWWLWXGHHVWLQMXVWLDEOH
et en contradiction avec la Bible et le message de lvangile.

Par exemple : /HQIDQFHGXPRQGHVWUXFWXUHVIDPLOLDOHVHWGpYHORSSHPHQW


Emmanuel Todd, 1984, ditions du Seuil, Paris.

94

Choisis la vie...

Couple
Introduction
et famille

De nombreux exemples attestent quil est possible de vivre des


relations bonnes et aimantes dans un cadre oppressant et qu
lautre extrme des relations peuvent tre catastrophiques alors
mme que lentourage offre un espace favorable.
Noublions pas non plus que la femme, mme dans les formes
de socit les plus oppressantes, a souvent russi garder une
PDUJHGLQXHQFH&HOOHFLOXLSHUPHWLQGLUHFWHPHQWGDJLUGDQV
la socit.
/HVSURSRVFLGHVVRXVQHSHXYHQWGRQFTXHUHpWHUOHVWHQGDQFHVHW
les valeurs qui sont appliques par des cultures ou des religions.
La forme islamique
Avant lmergence de lislam, le statut de la femme tait
loin dtre enviable et elle tait la merci de son mari ou des
oppressions sociales. La femme navait pas droit lhritage
et le nombre dpouses ou de rpudiations ntait pas limit.
Selon certains tmoignages, les Arabes de lpoque prislamique
KDwVVDLHQWOHVOOHVTXLOVHQWHUUDLHQWSDUIRLVYLYDQWHVSDUFUDLQWH
du dshonneur.
Lorsque Mahomet pose les fondements de lislam au 7e sicle, il
HVWIRUWHPHQWLQXHQFpSDUOHPHVVDJHHWOHVYDOHXUVTXHOHV-XLIV
et les Chrtiens ont apports.1
Lislam intgre donc plusieurs de ces valeurs et donne un meilleur
statut la femme sans toutefois lui reconnatre une pleine galit avec
lhomme. Dans ce contexte, la forme archaque de la domination
GHOKRPPHVXUODIHPPHV\WURXYHMXVWLpH/H&RUDQDSSRUWH
donc un statut de dignit pour les femmes, mais il contient aussi
des lments contradictoires en les considrant parfois comme des
tres de seconde zone et en permettant par exemple aux hommes
de les frapper jusqu ce quelles obissent.
'XQH PDQLqUH JpQpUDOH OLVODP HVW GpQL VHORQ XQ FRQFHSW GH
domination2 qui autorise la violence pour soumettre les peuples
sa croyance. Cette religion a t le plus souvent impose
1

Plusieurs textes du Coran sinspirent des rcits de lAncien et du Nouveau


Testament.

/HPRWLVODPVLJQLHVRXPLVVLRQ/HVWDWXWGHODIHPPHQpFKDSSHGRQF
pas au concept de situer les personnes au sein dune hirarchie, par la contrainte
si besoin.

95

Couple
Introduction
et famille

Choisis la vie...

des peuples par des guerres (saintes !) de conqute appeles


GMLKDG0DKRPHWpWDLWOXLPrPHXQJXHUULHUTXLDGLULJp
campagnes militaires. Ces combats lon conduit tuer et utiliser
abondamment la force et la terreur pour imposer sa religion aux
autres peuples.
La relation homme-femme nchappe pas ce jeu de forces,
ainsi la femme jouit dune relative libert pour autant quelle se
soumette au pouvoir de lhomme, lui-mme tant soumis la loi
de la charia.

LA FORME ISLAMIQUE
Clan-famille du mari

Enfants

ce

en
r
Ing

Femme1

Moteur: LA DOMINATION
Lexigence de la soumission

/DYLVLRQGH'LHXLQXHQFHODYLVLRQGHODIDPLOOHHWODIHPPHIDLWSDUWLHGXQH
chane de soumission. Les femmes ont un statut infrieur et sont domines par la
charia, par la loi du clan et par leur mari.
Lhonneur et le sens du clan sont trs forts. Si quelquun sort de cette emprise, par
exemple en se convertissant une autre religion, il pourra tre condamn mort ;
mort, ce qui est aussi le cas dune femme adultre.

Dans cette architecture, la femme est considre comme la


proprit de son mari, ce qui conduit ne pas considrer le
mariage comme exclusif. Les Musulmans sont donc autoriss
prendre plusieurs femmes (jusqu quatre). Lorsquun enfant
surgit dans ce type dunion, il est mis en prsence dune forme de
relation btie sur lingalit des sexes et sur des jeux de pouvoir.
La construction de sa propre identit va se faire en intgrant et en
MXVWLDQWFHGpVpTXLOLEUHGDQVVDSHUVRQQDOLWp
96

Choisis la vie...

Couple
Introduction
et famille

Les rpercussions sont tragiques car lenfant ne grandit pas avec la


vision dune relation exclusive fonde sur lamour et sur lgalit.
Par la suite, il ne pourra concevoir une identit de valeur entre les
hommes et les femmes. Avec cette vision, le concept de socit
quil va appliquer lorsquil sera adulte le conduira reproduire ce
principe de domination dans sa famille et dans la socit.
Ce jeu entre la domination et la soumission a des rpercussions
nfastes pour le dveloppement dun pays car il exacerbe et
valorise lhonneur du clan religieux, familial, etc. Sur le plan
SROLWLTXH FH FRQFHSW GH GRPLQDQWVGRPLQpV UHQG GLIFLOH OD
reconnaissance des droits fondamentaux des tres humains, en
particulier si ceux-ci pratiquent dautres religions. Ces jeux de
pouvoir sopposent en outre la mise en place des gouvernances
selon des principes dmocratiques. Jouer avec des relations de
force conduit le plus souvent exalter la guerre et nourrir une
affection passionnelle pour la force des armes.
La forme athe
La perception du divin est universelle et partout les croyances en
des divinits ou des forces suprieures ont conduit les hommes se
construire des temples ou des tombeaux. Durant des millnaires, il
nexistait pas de civilisation sans religion. La remise en question
de lexistence de Dieu par lathisme durant les 19e et 20e sicles
est donc une rupture qui va profondment marquer lHistoire.1
Lune des raisons de lmergence de lathisme est lie aux
GpYHORSSHPHQWV GHV FRQQDLVVDQFHV VFLHQWLTXHV &HOOHVFL
GpP\VWLHQWGHQRPEUHX[SURFHVVXVTXLpWDLHQWFRQVLGpUpVMXVTXH
l comme magiques. Ces dcouvertes rendent ridicules plusieurs
GRJPHVUHOLJLHX[HWPRGLHQWODYLVLRQGXPRQGH&HSURFHVVXV
VFLHQWLTXHUHQIRUFHODIRLGHFHUWDLQVHWFRQGXLWGDXWUHVjQLHU
toutes rfrences Dieu.
Mais ce nest pas impunment que lon carte la rfrence un
crateur. Cette contestation conduit forcment nier que la nature
1

La pense athiste marxiste va prendre son envol avec le Manifeste du parti


communiste en 1848 ; elle sera applique comme systme politique en Russie
sous Lnine (1917-1923) puis sous Staline (1928-1953), en Chine sous Mao,
en Core du Nord, au Vitnam de H Ch Minh, au Cambodge sous Pol Pot,
Cuba avec Castro, en thiopie, en Angola, etc.

97

Couple
Introduction
et famille

Choisis la vie...

et lhumanit soient le fruit dun projet. Priv de sens, lunivers


est rduit devenir un espace vide et lugubre dans lequel la vie
apparat par la bonne volont du hasard. Selon cette conception,
ltre humain est rduit une simple dimension matrielle ; son
corps est un agglomrat de cellules bien organises, ses motions
des ractions chimiques, la mort un simple arrt biologique, etc.
Dans lHistoire moderne, cette ngation de Dieu va enfanter
des courants idologiques qui chercheront malgr tout trouver
DUWLFLHOOHPHQWXQVHQVjOH[LVWHQFHKXPDLQH
En labsence de Dieu crateur, le pouvoir suprme est le plus
VRXYHQWIRQGpVXUGHVFRQFHSWVGHVRFLpWpV/HFRPPXQLVPH
sera lun de ces concepts de socit sans Dieu et btie sur des
YDOHXUVKXPDQLVWHV

LA FORME ATHE COMMUNISTE

Socit - tat
Ingrence

Ingrence

Mari
Moteur: LAUTORITARISME
/DVRFLpWpGpLpH

Ingrence

Femme
Enfants

Dans le communisme, le groupe social devient lorgane suprme qui prend la


place de Dieu ; il a ainsi le droit dexercer un contrle sur lindividu.
Ce systme entrane une trs forte ingrence de ltat sur les individus et les
familles qui ne sont pas considrs comme des entits autonomes. Pour ces
raisons, les enfants font partie de la proprit de ltat et sont sous sa gouvernance.
En Chine, par exemple, cest le parti qui gre la rgulation des naissances en
imposant un seul enfant par couple. Ceux qui ont plus denfants sont amends ou
doivent quitter leur emploi.

98

Choisis la vie...

Couple
Introduction
et famille

Le communisme part dune bonne intention qui vise tablir un


ordre social juste. Mais, en labsence de rfrence divine, il est
IRUFpGHOXLVXEVWLWXHUXQDEVWUDLWVHQVGHO+LVWRLUHTXLYDOH
conduire de terribles abus.
Les pays dans lesquels le communisme est appliqu deviennent
la proie dorganisations politiques dune extrme violence qui
QKpVLWHQWSDVjMXVWLHUODORLGXSOXVIRUWHWjH[WHUPLQHUGDXWUHV
hommes pour purger la socit et lui imposer leur modle.1
Aujourdhui, les thories athes ont montr leurs limites et peu
de personnes sont encore disposes militer pour des systmes
politiques qui ont conduit leurs adeptes la catastrophe. Lathisme
pur est en recul et rares sont ceux qui en appliquent la froide
logique. Toutefois, les socits modernes restent profondment
imprgnes dun athisme dulcor dautant plus subtil quil vite
soigneusement daller au fond de ses ides.
Dans les socits occidentales, cet athisme larv est un adversaire
implacable envers toutes les rfrences un ordre divin qui
puisse contredire les droits que lhomme sest donns. Selon
FHWWHLGpRORJLHODVRFLpWpGRLWFRQVWUXLUHVDSURSUHPRUDOHHQ
GpQLVVDQWHOOHPrPHVHVYDOHXUV
La relation du couple et de la famille nchappe pas lemprise
GH FHW  RUGUH  TXL UHYHQGLTXH ODXWRULWp GH GpQLU OH U{OH GH
lhomme et de la femme dans la famille et dans la socit.
6RXVFHWWHLQXHQFHOHVFRPPDQGHPHQWVELEOLTXHVVRQWFRQVLGpUpV
FRPPHGpVXHWVHWOHPDULDJHHWODGpOLWpVRQWUHPSODFpVSDUGHV
revendications de libert sexuelle et dautonomie.
/XQ GHV HIIHWV WUDJLTXHV GH FHWWH LGpRORJLH  VHPLDWKpH  HVW
GHQWUDvQHU HW GH MXVWLHU OD PRUW GHV SHUVRQQHV TXHOOH SUpWHQG
dfendre. Ainsi, de nombreuses femmes qui se sont lances corps
perdu dans lapplication de la libert sexuelle ont, certes, multipli
les aventures, mais elles se retrouvent aujourdhui seules, sans
conjoint ni enfant, victimes de lapplication dune folie qui a brl
leurs ailes.
1

Le bilan des systmes politiques athes prsente un dsastre conomique,


culturel et humain ; il a conduit des dportations massives et a fait des millions
de victimes.

99

Couple
Introduction
et famille

Choisis la vie...

Les consquences sont encore bien plus dramatiques quand


on mesure les effets de la revendication des femmes pouvoir
avorter.
Ce discours, qui semble soutenir le statut des femmes, a sduit
GH QRPEUHX[ SD\V TXL RQW PRGLp OHXUV ORLV SRXU DXWRULVHU
OLQWHUUXSWLRQ GH JURVVHVVH &HW  HQFRXUDJHPHQW  j DYRUWHU D
ouvert une brche qui conduit chaque anne environ 50 millions
denfants la mort.1 Ces chiffres dpassent largement les
60 millions de morts qui ont pri durant les presque six ans de
FRQLWVGHOD6HFRQGH*XHUUHPRQGLDOH
Triste paradoxe, dans cette hcatombe, plus de la moiti des
YLFWLPHVHVWFRQVWLWXpHGHOOHWWHVTXLDXUDLHQWELHQDLPpSURWHU
GXQGURLWGHIHPPHSRXUYHQLUDXPRQGH6DQVRXEOLHUTXH
dans de nombreux pays, lavortement est devenu un moyen de
FKRLVLUOHVH[HGHVRQHQIDQWFHTXLOHSOXVVRXYHQWSURWHjXQ
garon. Les femmes sont donc les grandes victimes dun concept
qui se prsente comme tant le dfenseur de leur cause !2
Lenfant qui nat dans un tel cadre va avoir beaucoup de peine
trouver des repres.
La fragilit de la relation entre ses parents et lclatement de la
famille vont briser les rfrences ncessaires sa quitude et
son panouissement. Lenfant se retrouve comme plong dans un
espace mouvant et imprvisible.
Cette situation engendre le plus souvent une forme danxit
latente et le besoin de trouver un refuge ou dtre scuris.3
Un tel cadre de croissance conduit un rtrcissement de la vision
du monde selon un cercle gocentrique qui nest pas propice
1

Estimation de lInstitut Alan Guttmacher New York. En moyenne mondiale,


le taux davortement annuel est de 35 pour 1000 femmes ges de 15 44 ans.

Les considrations athes et matrialistes, qui conduisent estimer la valeur


des humains selon des critres de confort ou dutilit menacent galement les
SHUVRQQHVkJpHVRXOHVLQUPHV$LQVLFHWWHLGpRORJLHSUpWHQGOLEpUHUOHV
VRXIIUDQWVGHOHXUVFRQGLWLRQVGLIFLOHVSDUODPRUW HXWKDQDVLH 

Avec ces carences affectives, les enfants de famille dcomposes cherchent,


ladolescence plus particulirement, des refuges dans les gangs et autres clans
de rues et de truands qui vont leur donner lillusion dappartenir un milieu
protecteur et valorisant.

100

Couple
Introduction
et famille

Choisis la vie...

former des hommes et des femmes capables dassumer des


UHVSRQVDELOLWpV RXGrWUHHX[PrPHVDEOHVHQYHUVOHVDXWUHV 
Lenfant, qui a vcu la sparation de ses parents et qui grandit dans
XQHIDPLOOHUHFRPSRVpHDXUDEHDXFRXSGHSHLQHjDYRLUFRQDQFH
dans sa capacit crer une famille ou sappuyer sur les autres.
Le schma ci-dessous prsente lune des formes de famille
dcompose telle quelle sexprime dans de nombreux pays
occidentaux.

LA FORME INDIVIDUALISTE (SEMI-ATHE)

Homme
Femme
Enfant

Enfants

Homme
Moteur: LGOSME

Enfants

Femme

Enfants

Un gosme revendicateur

Labsence de rfrence un ordre divin conduit nier le projet dune union


sacre et exclusive dans le couple. Selon cette vision, lhomme et la femme sont
invits suivre leurs dsirs. La sexualit est principalement un moyen dobtenir
du plaisir, lhomosexualit est valorise et lavortement est un droit lgitime.
Cette vision du monde, qui semble dfendre la libert individuelle, est en ralit
trs oppressive et conduit crer des enfers familiaux dont les enfants sont les
principales victimes.

Avec de tels fondements, la socit est entrane dans un processus


deffritement de ses liens sociaux, les relations de couple ou de
travail se font en papillonnant pour tirer le meilleur dune situation
HQpYLWDQWGHVHQJDJHURXHQVHQIX\DQWGqVTXHGHVGLIFXOWpV
surgissent.

101

Couple
Introduction
et famille

Choisis la vie...

Ladulte qui na pas connu la scurit dun foyer stable est le plus
souvent habit par une inquitude diffuse que les mouvements
politiques utilisent pour imposer leur idologie.
Lvolution des socits occidentales vers des systmes de socits
trs scurises et aux mcanismes juridiques envahissants est lune des
consquences du manque de climat paisible vcu durant lenfance.
La forme animiste
Les croyances animistes1 sont des formes religieuses primitives
qui se sont formes au sein dethnies traditionnelles. lorigine,
lanimisme couvrait toute la surface de la Terre. Il tait donc
en vigueur avant que lvangile ne vienne changer le destin de
nombreuses nations. Alors que le christianisme est habituellement
peru comme une culture issue de la race blanche et de lOccident,
il est bien de se rappeler que tous ces pays taient sous lemprise
de cultes animistes qui les asservissaient par de nombreuses et
cruelles superstitions parmi lesquelles on trouvait entre autres, des
VDFULFHVKXPDLQV2
Aujourdhui, lanimisme est principalement prsent dans les
ethnies traditionnelles dAfrique, dAmrique, dAsie centrale et
G2FpDQLH,ODpJDOHPHQWGHIRUWHVLQXHQFHVGDQVSOXVLHXUVSD\V
islamiques ou christianiss.
Malgr ses nombreuses origines gographiques, lanimisme est
souvent construit autour dune croyance commune qui considre
que la nature, lair, les pierres, les animaux et de nombreuses
autres choses sont habits par des forces invisibles. Ces esprits
RXFHVGLYLQLWpVFHQVpVLQXHQFHUODYLHTXRWLGLHQQHVRQWVRXYHQW
perus comme des puissances versatiles, colriques et menaantes.
La peur joue donc un rle important dans la culture animiste qui
cherche amadouer la bienveillance des forces spirituelles par
toutes sortes de pratiques.
1

&HWHUPHYLHQWGXODWLQDQLPXVTXLVLJQLHOHVSULW

Il est bien de souligner que lOccident nest pas le propritaire de la culture


chrtienne. Comme dans les autres pays, les valeurs novatrices de lvangile
sont venues apporter leur lumire des peuples prisonniers de leur paganisme.
Aujourdhui, il reste de nombreuses traces des anciennes superstitions. La foi
chrtienne ne vient pas de lOccident, elle est un cadeau pour tous les peuples
sans que personne puisse prtendre en tre propritaire.

102

Choisis la vie...

Couple
Introduction
et famille

Les rituels sont trs divers et consistent faire des offrandes, des
VDFULFHVjSDVVHUSDUGHVpWDSHVLQLWLDWLTXHVjDYRLUGHVIpWLFKHV
ou porter des amulettes pouvant repousser le mal ou donner
du pouvoir. Certains cherchent entrer en transe pour se laisser
pntrer par des esprits.
Ces croyances se basent gnralement sur la pense que les
HVSULWVHWOHVGLYLQLWpVVHUpYqOHQWHWpWHQGHQWOHXUVLQXHQFHVDX
sein de la famille et du clan. Cette vision conduit la plupart des
socits animistes sorganiser selon des structures tribales et
hirarchiques dans lesquelles les ans et les anctres (morts ou
YLYDQWV RQWXQHLQXHQFHVXUOHXUVGHVFHQGDQWV1
Ce type dorganisation sociale considre les liens du sang comme
le canal sacr qui permet aux esprits de se manifester et de
transmettre les bndictions ou les maldictions. Ds lors, quand
un malheur touche une personne du clan, il nest pas rare que
lon ait recours des pratiques occultes pour trouver la personne
qui est responsable de ce mal. Dans certains cas, cela conduit le
sorcier ou la famille accuser violemment lun des membres de
la famille ou du clan.2
La manire quont les croyances animistes de vnrer la ligne
du sang conduit souvent les socits se construire selon des
systmes communautaires et religieux qui accordent une libert
individuelle minime, chaque personne tant avant tout un membre
GXFODQ&HWWHPDLQPLVHDIIHFWHWRXVOHVDVSHFWVGHODYLHHWLQXHQFH
grandement la construction de la famille : choix du conjoint,
valuation du couple, pression sur le nombre denfants, etc.
1

6XUXQSODQVSLULWXHOFHVDvQpVFHVFKHIVFRXWXPLHUVGXFODQVRQWLQYHVWLV
GHSRXYRLUVRFFXOWHVTXLLQXHQFHQWQpJDWLYHPHQWODOLJQpH/HVFKUpWLHQVTXL
veulent casser cette spirale oppressante doivent donc renoncer solennellement
GHYDQW'LHXHWGHYDQWOHVPHPEUHVGHOHXUFODQjFHVSRXYRLUVGHOLDWLRQDQ
den tre librs et den librer leur descendance.

Dans certaines tribus, il est frquent que ceux qui sont accuss dtre
responsables de la maldiction meurent des suites de lpreuve quils doivent
passer pour prouver leur innocence (par exemple boire du poison). Dans
GDXWUHVFDVOHVERXFVpPLVVDLUHVVRQWH[FOXVGXFODQRXGHODIDPLOOH&HOD
FRQGXLW SDU H[HPSOH j FH TXXQ HQIDQW FRQVLGpUp FRPPH OH  VRUFLHU  TXL
apporte la maldiction, soit chass de sa famille. Des villes telles que Kinshasa
comptent des milliers de petits enfants abandonns dans la rue pour ces raisons.

103

Couple
Introduction
et famille

Choisis la vie...

Dans ces conditions, le mariage nest pas envisag comme la


cration dun nouvel espace autonome. Il reste sous lemprise de
la tribu et du lignage qui sont considrs comme dterminants.
Dans la pratique, cela conduit juger que les enfants ne sont pas
sous lautorit de leurs parents biologiques mais sous le pouvoir
des ans ou des anctres.

LA FORME ANIMISTE
Anctres

Anctres
Clan-famille
du mari

Clan-famille
de la femme

Femme(s)
Mari

Ing

ce

r
en

ce

en
r
Ing
Moteur: LES SUPERSTITIONS

Enfants

Une chane de superstition

La vision animiste du monde conduit de grandes superstitions en lien avec


lenvironnement et la socit. Dans ce contexte, les anctres dcds concervent
XQHLQXHQFHDXVHLQGXFODQ&HGHUQLHUH[HUFHXQHIRUWHDXWRULWpVXUOHVIDPLOOHV
souvent par lan. Cette chane de pouvoirs se manifeste par des ingrences sur
le couple qui ne parvient pas crer son propre espace. Dans cette situation, le
rle du pre ou de la mre est dilu dans un ensemble et les enfants nont pas de
rfrences claires leur permettant de construire solidement leur identit.

Dans les tribus patriarcales, la structure de la socit est construite


selon les liens de paternit. Les enfants sont considrs comme la
 SURSULpWp  GH OD IDPLOOH SDWHUQHOOH &HVW GRQF OD IDPLOOH GX
mari qui garde la mainmise sur le destin des descendants. Cette
situation ne conduit cependant pas forcment ce que le pre
biologique exerce une pleine autorit envers ses enfants, car, selon
les rgles hirarchiques du clan, lan a un droit dautorit sur ses
frres, il peut donc intervenir dans la famille de son frre cadet et
exercer son pouvoir sur sa famille et ses enfants.
104

Choisis la vie...

Couple
Introduction
et famille

Dans les tribus matriarcales, la structure de la socit est fonde


sur les liens qui stablissent entre la femme et son enfant. Comme
OHQIDQW  VRUW  GH OD PqUH LO DSSDUWLHQW j VD OLJQpH HW FHVW OD
famille de la mre qui garde un droit sur les descendants. Dans
ce mode social, le pre biologique na pas grand-chose dire, car
ses enfants ne sont pas vraiment considrs comme les siens. Sa
position dans la famille sapparente celle dun berger qui garde
OHWURXSHDXGXQDXWUH XQERXYLHU 'DQVFHW\SHGHVRFLpWp
lautorit suprme et familiale sexerce habituellement par le frre
an de la femme. Loncle peut par exemple intervenir dans le
FRXSOHHW[HUSDUH[HPSOHODVRPPHGHODGRWTXLOUHFHYUDSRXU
OHPDULDJHGXQHOOHGHVDVXU
Comme le montre cette tude, les conceptions et les croyances
DQLPLVWHVH[HUFHQWXQHLQXHQFHGpWHUPLQDQWHGDQVODFRQVWUXFWLRQ
GHVIDPLOOHV/DUFKLWHFWXUHTXLHQUpVXOWHHVWXQpGLFHFRPSOLTXp
qui naccorde pas une grande responsabilit au couple biologique.
Dans cette situation, les enfants sont face un systme de pouvoirs
hirarchiques et arbitraires au sein duquel le pre ou la mre nest
pas pleinement investi de son rle de parent. Dans les socits o
OHSqUHHVWFRQVLGpUpFRPPHXQERXYLHULOQHVWSDVFRQVLGpUp
comme responsable de ses enfants. Cette distance entre lui et sa
progniture lamne peu simpliquer pour assumer leurs besoins
et leur dveloppement.
/RUVTXHOHVHQIDQWVDSSDUWLHQQHQWjODIDPLOOHGHODPqUHFHVW
la femme qui doit assumer lentretien des enfants et soutenir sa
famille. Cette situation cre un norme dsquilibre et les femmes
sont gnralement face une tche dmesure qui les contraint
devoir trouver elles-mmes des ressources pour nourrir leur famille.
Dans ce genre de situation, les enfants se retrouvent laisss eux-
mmes et sans modles capables de leur donner une bonne vision
de la responsabilit de lhomme et de la femme.
Dans ce contexte, lenfant construit son identit avec la pense
que le pouvoir na pas de lien rel et effectif avec le sens des
responsabilits.
Lautre perversion de ce systme est de fausser le concept de
lautorit. Ainsi, le garon qui a le privilge de natre le premier
reoit un statut suprieur. Dans les faits, il nest pas rare quil soit
105

Couple
Introduction
et famille

Choisis la vie...

encourag par sa mre et par son pre qui lui disent quil est le
chef, quil a le pouvoir sur ses frres et surs, etc. Cette lection
DUELWUDLUHDXVWDWXWGHURLYDOHFRQGXLUHjFURLUHTXLODUHoXXQ
droit souverain sur son entourage.
Labsence de liens entre les comptences et les responsabilits
conduit lenfant construire sa vision du pouvoir en donnant libre
cours ses dsirs et sa cruaut infantile.1
Cette manire dexercer lautorit cre des tyrans qui utiliseront
leur position dominante pour imposer leurs volonts aux autres et
DFTXpULUGHVMRXHWVRXWRXWHVOHVFKRVHVSURSLFHVjOHXUSODLVLU
Cette mentalit se reporte aux plus hauts niveaux politiques.
Les flaux de la polygamie
La plupart des formes familiales animistes sorganisent sur le principe de
la polygamie. Un chercheur1 a publi une tude sur les problmes causs
SDUFHWWHSUDWLTXH,O\pYRTXHSOXVLHXUVpDX[GRQW
Lingalit sociale : quelques riches vieillards peuvent accaparer
les jeunes femmes et de nombreux garons sont forcs au clibat.
La dlinquance : les enfants de polygames grandissent sans autorit
et sans soutien. Dans les villes, cela les conduit la dlinquance.
/D FRXWXPH GX  GHX[LqPH EXUHDX   FKDQJHDQW OD SRO\JDPLH
du pass, certains prennent des concubines quils installent dans
un logement part. Ces femmes ne font plus aucun travail, elles
vivent du salaire de leur amant qui nglige ainsi sa famille lgitime.
Des drames et des malheurs : dans les familles de polygames rgne
un climat de querelle, de jalousie, de rivalit et de haine.

Besiki Uziedje, Lvangile face la polygamie chez les Basakata, 1973, pages 10 et 11.

Lenfance est innocente mais aussi souvent trs cruelle car lenfant est
foncirement gocentrique et ne peroit pas la souffrance des autres. Cette
cruaut infantile a t utilise par des systmes totalitaires tels que celui de Pol
Pot qui employait des enfants pour torturer des prisonniers. Pour surmonter
et vaincre sa cruaut, lenfant doit grandir dans un cadre qui lui permet de
dcouvrir le respect des autres et la porte de ses actes.

106

Choisis la vie...

Couple
Introduction
et famille

La forme biblique de la famille


Dans la partie prcdente, nous avons tudi diffrentes formes
familiales en analysant leurs impacts dans la vie de couple et
dans la construction de la personnalit des enfants. Ces lments
nous conduisent examiner les fondements et larchitecture de la
famille selon la rvlation biblique.
Lune des paroles bibliques fondatrices du couple est mentionne
ds le dbut de la cration, lorsque lhomme reconnat en sa
IHPPH FHOOH TXL HVW  FKDLU GH VD FKDLU  &HWWH H[FODPDWLRQ
heureuse dAdam envers ve atteste quil reconnat quils sont
FUppVGHODPrPHPDWLqUH&HWWHWRWDOHFRPSDWLELOLWpVXUOHV
plans spirituels, affectifs et corporels, permet au couple de former
un tout :
Cest pourquoi lhomme quittera son pre et sa mre, et
sattachera sa femme, et ils deviendront une seule chair.
Gense 2.24

Notons que ces paroles fondatrices du couple traversent toute la


Bible et quelles seront cites par Jsus dans Matthieu 19.5 (et Marc
10.7) et galement reprises par laptre Paul dans phsiens 5.31.
Le besoin dune rupture
Lorsque nous tudions les fondations bibliques de la construction
du couple, nous dcouvrons un aspect trange le projet dunion
de lhomme et de la femme commence par une rupture !
Ainsi, la Bible nous dit que lunion entre lhomme et la femme
ne peut pas se faire immdiatement, lhomme doit dabord quitter
son pre et sa mre avant de pouvoir sunir.
La vision biblique du couple sappuie sur le principe que
lhomme doit devenir un adulte capable de mener sa destine.

Cet aspect souvent ignor est fondamental. En effer, tant que


lhomme est sous lautorit de ses parents, il reste un enfant. Pour
changer de statut, il doit sortir du cadre familial et tre capable de
sassumer. Pour accomplir ce processus, lhomme doit donc se
VpSDUHUGHVHVSDUHQWVGHVRQFODQRXGHVDWULEXDQGHSRXYRLU
entamer la ralisation de son couple et de sa famille.
107

Couple
Introduction
et famille

Choisis la vie...

Tous les parents devraient donc comprendre que leur rle est
dlever leurs enfants en cherchant ce quils deviennent
autonomes, responsables et capables de crer quelque chose de
neuf.
Mais dans beaucoup de socits, le pouvoir du clan et la manire
de considrer les enfants ne permettent pas cette rupture. Ceux qui
commencent leur couple sans navoir jamais t spars de leurs
parents vivent encore sous la domination de leur famille ou de leur
clan. La famille ainsi forme nest pas autonome et les nouveaux
parents nexercent pas le mandat qui leur a t donn par Dieu.
Comme les enfants ont besoin de grandir en ayant comme vis--
vis des parents responsables, cela conduit un affaiblissement de
OLGHQWLWpGHVLQGLYLGXV$XOGXWHPSVODVRFLpWpQDSDVGHYUDLV
responsables et cela entrave fortement le dveloppement du pays.

UN EXODE POUR SUNIR


Homme

Parents
1. QUITTER

Femme

2. SATTACHER

Abraham, Mose, Jacob, tous ont quitt leur cadre familial pour construire une
IDPLOOH&HODHVWDXVVLYUDLGH-pVXVTXLTXLWWHVDSRVLWLRQFpOHVWHSRXUVDWWDFKHU
lglise (cest un grand mystre que mentionne Paul dans phsiens 5.31).
1RWRQVTXHOHIDLWGHTXLWWHUQHVLJQLHSDVXQHUXSWXUHGHUHODWLRQVRXOHIDLW
de considrer ses parents avec mpris ou ngativement. Cest un cheminement
qui doit conduire prendre sa vie en main de manire devenir un vrai adulte.

Labsence de rupture pralable est la cause de problmes


importants au sein du couple. Car si un homme est incapable de
sassumer seul, il aura beaucoup de peine entamer un processus
dunion. Celui qui est capable de bien vivre seul pourra construire
un couple sur de bonnes bases, alors que celui qui a toujours vcu
en tat de dpendance sera fragile.
108

Choisis la vie...

Couple
Introduction
et famille

Le processus de rupture lgard de sa famille est un moment


GLIFLOH,OFRQGXLWjVHGpWDFKHUGXQFDGUHVpFXULVDQWSRXUVHODQFHU
dans laventure de la vie. Cest un peu comme les oiseaux qui
doivent un moment donn quitter leur nid. Cest seulement en
sautant dans le vide quils vont dcouvrir leur capacit voler de
leurs propres ailes..
Pour lhomme, le fait de quitter sa famille est souvent le moment
qui lui permet de dcouvrir quil peut sappuyer sur Dieu.
Avec cette tape, il devient un tre directement connect son
Crateur.
Alors que la socit cherche souvent me maintenir dans une
FRQGLWLRQGDVVLVWpSDUOD%LEOH'LHXPHGLW-HWLQYLWHjTXLWWHU
tes origines pour construire quelque chose de neuf. Je te donne
lautorit pour construire un couple avec ton pouse et dans un
esprit dgalit. Vos enfants seront vos enfants et personne naura
OHGURLWGHPpSULVHUYRWUHYRFDWLRQGHSqUHRXGHPqUH
Une unit retrouve
Si le processus de cration du couple commence par mettre en
pYLGHQFHOHPRWTXLWWHUFHODQHVWTXXQHpWDSHHWOHVSDUROHV
ELEOLTXHVPHWWHQWHQYDOHXUOHYHUEHDWWDFKHU&HWWHWUDQVLWLRQ
entre la rupture et lunion souligne que lintention divine est de
runir lhomme et la femme dans un projet commun. Cet objectif
sappuie sur le projet que Dieu a dessin lavance. Ainsi, le
centre du couple nest pas lhomme ou la femme, mais la nouvelle
FKDLUTXLOVSHXYHQWFUpHUHQVXQLVVDQW

La Bible souligne plusieurs reprises linteraction qui devrait


se vivre pour que lhomme et la femme puissent construire une
entit scelle par lamour. Dans ce sens, il est intressant de
chercher comprendre de quelle manire une complmentarit
peut sexercer.
Comme le prsente le schma qui suit, lhomme et la femme
QRQW SDV pWp  GpFRXSpV  SRXU FUpHU GHX[ HQWLWpV VHPEODEOHV
PDLVDYHFODYRORQWpGLYLQHGHGLVWULEXHUGHVTXDOLWpVVSpFLTXHV
Ds lors, bien que fondamentalement gaux en valeur, ils sont
GLIIpUHQWVHWSUpVHQWHQWGHVVSpFLFLWpVLQGLVSHQVDEOHVHWYRXOXHV
par le Crateur.
109

Couple
Introduction
et famille

Choisis la vie...

LGALIT DANS LA DIFFRENCE


1. ENSEMBLE

1. SPARATION
Homme

3. UNION
Homme

tre unique
Femme
Homme gnrique

tres sexus

Femme
Couple

Dans ce schma, la sparation entre les parts fminines et masculines souligne


OHXUFRPSOpPHQWDULWp$LQVLOpJDOLWpFKDLUGHPDFKDLUQHVLJQLHSDVTXH
lhomme et la femme sont interchangeables. Ils sont complmentaires et le projet
GX FRXSOH YLVH j XQLU GHV FDSDFLWpV GLIIpUHQWHV DQ TXH OHV IDLEOHVVHV GH OXQ
sappuient sur les forces de lautre.

La coupure en diagonale est une belle manire dillustrer la


particularit de lhomme et de la femme elle permet dillustrer
TXHODIHPPHjXQHEDVHSOXVFRQVpTXHQWHHWGDYDQWDJHHQ
appui avec la Terre. La maternit et ses capacits accueillir un
enfant saccompagnent de grandes comptences pour grer la vie
et offrir un appui ceux qui lentourent. Ces capacits rejoignent
la vision initiale qui associe des notions daide et dgalit.
/DPDQLqUHGRQWOKRPPHHVWGpFRXSp  /eWHUQHO 'LHX GLW 
favorise plutt les liens avec les Il nest pas bon que
dimensions extrieures et sociales. Cette lhomme soit seul ; je lui
facilit saccompagne cependant dune ferai une aide semblable
lui. Gense 2.18
SOXVJUDQGHIDLEOHVVHVXUVDEDVH
noter que ce dcoupage des rles ne doit pas nous faire oublier
que lhomme et la femme ont une part commune beaucoup plus
importante que celle qui les diffrencie.1
1

Par exemple, les squelettes de lhomme et de la femme sont globalement


identiques. Les deux sont conus avec un dgagement des ctes au niveau de
labdomen pour permettre la grossesse (espace inutile chez lhomme). Les
mamelons de lhomme attestent aussi que le corps est globalement identique et
quil se diffrencie par un processus dhormone.

110

Couple
Introduction
et famille

Choisis la vie...

LA CONSTRUCTION GNTIQUE

Homme

Demi-livre

23 chromosomes

Enfant

Nouveau livre
46 chromosomes

Femme

Demi-livre

23 chromosomes

Une fantastique usine de vie


Lors de la conception dun enfant, la moiti du patrimoine gntique du pre et
de la mre se runissent pour former une nouvelle identit.
noter que, durant sa vie, lhomme produit des dizaines de milliers de milliards
de spermatozodes (10 puissance 12 ou 13). De son ct, la femme abrite environ
400 000 ovules potentiels, dont environ 400 qui arrivent maturit.

Sur le plan corporel, lhomme et la femme sont construits selon


XQ  WURQF FRPPXQ  TXL DFFXHLOOH OHV VSpFLFLWpV IpPLQLQHV HW
masculines. Sur le plan biologique, la diffrence entre lhomme
et la femme se joue sur lun des plus petits chromosomes du code
gntique. Une cellule humaine en compte 46.1
Chaque chromosome est comme le chapitre dun livre qui dcrit
SUpFLVpPHQWQRWUHYLH/HVVFLHQWLTXHVRQWFODVVpFHVFKDSLWUHV
du plus grand au plus petit et en utilisant des lettres alphabtiques.
1

&KDTXHrWUHKXPDLQHVWIDEULTXpjSDUWLUGXQSURJUDPPHJpQpWLTXHTXLHVW
pFULWGDQVXQHFHOOXOHGHEDVH&HSURJUDPPHDSSHOpJpQRPHHVWFRQVWLWXp
des 23 paires de chromosomes qui contiennent lADN. Lors dune fcondation,
lun des spermatozodes du pre va pntrer lintrieur de lovule de la mre.
Durant cette rencontre, les chromosomes du pre et de la mre sassocient en
SDLUHVGHPDQLqUHjIRUPHUOHQRXYHDXSURJUDPPHTXLSHUPHWWUDGHFUpHUXQ
nouvel tre.

6XUOHVSDLUHVGHFKURPRVRPHVVHXOHODPRLWLpGHOXQHGHVSDLUHVYDGpQLU
quel sera le sexe de lenfant. Si le spermatozode qui est entr dans lovule est
porteur dun chromosome masculin (Y), ce sera un garon ; sil est porteur dun
FKURPRVRPHIpPLQLQ ; FHVHUDXQHOOH

111

Couple
Introduction
et famille

Choisis la vie...

Deux tres diffrents pour un projet unique


La cration abrite des myriades despces et dtres distincts.
Lhomme et la femme font partie de cet loge la diversit, ils
sont invits runir les parts quils ont reues.
La femme : Biologiquement la femme a reu un ministre qui
lui permet daccueillir et de donner la vie. Son corps est construit
de manire offrir un lieu de dveloppement qui permettra une
minuscule cellule de se multiplier, dvoluer en embryon et de
faire natre un enfant.
&HWWHXVLQHGHODYLHHVWXQSURGLJHLQFUR\DEOHGRQWODVFLHQFH
peine encore comprendre la complexit. Les capacits tonnantes
de la femme se prolongent dans sa facult de pouvoir assister et
accueillir les bbs en lui donnant le sein.
Tous ces services ont une valeur inestimable et cest grce
eux que chacun de nous a pu venir au monde et survivre. La
femme a souvent une polarit plus porte vers lintrieur, elle est
gnralement plus tourne vers le foyer.
Lhomme : Sur un plan biologique, le corps de lhomme ne lui
permet pas de construire la vie. Sa force musculaire est toutefois
plus importante que celle de la femme, ce qui lui permet de
travailler davantage dans la cration. Ses capacits visuelles sont
aussi plus adaptes la chasse.
Lhomme est souvent davantage port vers lextrieur ; il a une
personnalit gnralement plus conqurante et en prise avec son
environnement. Ainsi, les capacits de lhomme lui permettent
habituellement dapporter un cadre protecteur sa famille et de
rcolter des ressources alimentaires pour lassister.
Sur un plan psychologique, on peut observer que le pre joue
galement un rle crucial pour construire lidentit des enfants et
leur permettre de se lancer dans la vie.
Comme le montre cette brve description, la femme a de
meilleures capacits pour accueillir et prendre soin des nouveau-
ns et lhomme davantage de capacits pour aider ses enfants se
lancer dans la vie.
Ces deux ministres dcoulent du mme projet damour et
SHUPHWWHQWGRIIULUXQHDVVLVWDQFHGLYHUVLpHGDQVODIDPLOOH

112

Choisis la vie...

Couple
Introduction
et famille

La diffrence entre lhomme et la femme se joue dans la dernire


paire de chromosomes, soit les 45 et 46esFKDSLWUHV
Si lon tient compte du nombre de chromosomes, la diffrence
quantitative entre un homme et une femme reprsentent peine
plus de 2 % !
Cette proportion diminue encore radicalement si lon considre le
volume dinformation prsent dans les gnes.1
Ces quelques pour cent de diffrences vont entraner des
PRGLFDWLRQVDYDQWODQDLVVDQFHHWFRQWLQXHUjGpQLUORULHQWDWLRQ
sexuelle en scrtant dans le corps des hormones capables de
dvelopper les capacits fminines ou masculines. Mais la base
humaine reste la mme.
Lhomme et la femme sont donc fondamentalement trs sem-
blables.2 Cela est important souligner, car, dans de nombreuses
cultures, lhomme et la femme sont prsents avec des valeurs
diffrentes. Le plus frquemment la femme est sous-value et
considre comme infrieure. Cela na aucun sens et la Bible
souligne plusieurs reprises lgalit de valeur absolue entre
lhomme et la femme.
/D SULVH GH FRQVFLHQFH GHV VSpFLFLWpV IpPLQLQHV HW PDVFXOLQHV
conduit comprendre que le couple est un loge la diversit et
quil ne peut se construire sans une acceptation des diffrences.
Construire un couple de qualit nest pas vident, et seules de trs
grandes doses damour et de respect mutuel permettent de vivre
cette union travers le temps.

Chez lhomme, on dnombre environ 30 000 gnes ; le chromosome mle


(Y) est plus petit et ne contient quune cinquantaine de gnes, alors que le
chromosome femelle (X) en contient environ 1500. Une femme a donc un
patrimoine gntique plus grand.

Plusieurs thories cherchent tablir la part de fminit dans lhomme et vice


versa, mais cette conception ne prend pas en considration la grande part de
patrimoine commune qui relie les deux sexes : la fminit, ou la masculinit,
GRLWrWUHSOXW{WFRQVLGpUpHFRPPHODSDUWVSpFLTXHSURSUHjFKDTXHSRODULWp
sexuelle.

113

Couple
Introduction
et famille

Choisis la vie...

Souvent les capacits et les forces physiques des hommes les


conduisent considrer leur(s) femme(s) comme des tres de rang
infrieur quils peuvent dprcier.
De leur ct, les femmes peuvent aussi avoir une forte tendance
mpriser leur mari et exploiter ses faiblesses.
Dans le livre de la Gense, cette guerre entre les deux sexes est
prsente comme lune des consquences de la rupture entre Dieu
et lhumanit. Ainsi, aprs la chute, il est dit la femme :
Tes dsirs se porteront vers ton mari, mais il dominera sur
toi. Gense 3.16

Domination et dsirs de prendre le dessus sont les deux forces


principales qui sopposent la rencontre harmonieuse entre
lhomme et la femme. Ces forces inscrites au fond du cur humain
sopposent au projet de Dieu et conduisent la destruction de la
famille et de la socit ; limage divine inscrite dans le couple se
brise et celui-ci devient une source amre qui entrane lhumanit
dans la souffrance et le malheur.1
Cette situation qui conduit au mpris, ladultre, aux violences,
HWFSHXWIDLUHGXFRXSOHXQHQIHUTXLOHVWQDOHPHQWSUpIpUDEOH
darrter. Cest pourquoi Jsus prcise dans les vangiles que cest
cause de la duret des curs que Dieu a permis aux hommes de
casser lalliance du mariage.
 -pVXV OHXU UpSRQGLW  FHVW j FDXVH GH OD GXUHWp GH YRWUH
cur que Mose vous a permis de rpudier vos femmes ; au
commencement, il nen tait pas ainsi. Matthieu 19.8

Comme le souligne ce texte, lunion entre lhomme et la femme


se joue dans le cur. Notre manire de vivre le couple est un bon
rvlateur de ce qui se cache dans la partie secrte et intime de
notre vie.

Car cest du cur que viennent les mauvaises penses, les meurtres, les
adultres, les dbauches, les vols, les faux tmoignages, les calomnies.
Matthieu 15.19. Lhomme bon tire de bonnes choses du bon trsor de son
cur, et le mchant tire de mauvaises choses de son mauvais trsor; car cest
de labondance du cur que la bouche parle. Luc 6.45.

114

Couple
Introduction
et famille

Choisis la vie...

LA FORME BIBLIQUE IDALE


Socit
Soutien

Famille du mari

Soutien

Mari
Femme
Enfants

Soutien

Famille de la femme

Rupture du lien familial pour


crer une nouvelle cellule

Moteur: LA RESPONSABILIT
galit et diversit

La vision biblique pour le couple, cest de construire une nouvelle cellule


familiale labri des ingrences extrieures. Cet espace privilgi, reconnu et
soutenu par la socit, permet lhomme et la femme dexercer un ministre
VSpFLTXHDXSUqVGHOHXUVHQIDQWV
Lapplication de ce genre de famille permet aux enfants de dcouvrir le respect de
lautre dans la diversit et aussi de devenir des personnes responsables qui seront
leur tour capables de construire leur propre famille.

Toute la Bible et les rvlations donnes aux hommes se rsument


par le fait daimer Dieu de tout son tre et son prochain comme
soi-mme.1
Ces deux facettes de lamour sont le fondement du Royaume de
Dieu, car Dieu est amour . 1 Jean 4.16
&HSHQGDQW'LHXHVWLQYLVLEOHHWLOHVWGRQFWUqVGLIFLOHGpYDOXHU
lamour que nous lui portons. Notre prochain en revanche est bien
visible et cela nous permet de mesurer notre amour.
Logiquement, le premier prochain cest la personne qui est
la plus proche de nous. La Bible nous invite donc construire
QRWUHIDPLOOHGDQVXQHVSULWGDPRXUHWHQH[HUoDQWGqOHPHQWQRV
responsabilits.
1

Tu aimeras le Seigneur, ton Dieu, de tout ton cur, de toute ton me, de toute
WDSHQVpHHWGHWRXWHWDIRUFH  7XDLPHUDVWRQSURFKDLQFRPPHWRLPrPH,O
Q\DSDVGDXWUHFRPPDQGHPHQWSOXVJUDQGTXHFHX[Oj Matthieu 12.30-31.

115

Couple
Introduction
et famille

Choisis la vie...

Cela est important, car si nous disons aimer Dieu et que nous
naimons pas notre femme, notre mari ou nos enfants, nous faisons
la dmonstration de notre mensonge.
Cest pourquoi, seule la rvlation de lamour de Dieu peut rtablir
dans notre cur la vraie image du couple telle que Dieu dsire
ODFFRPSOLUHQXQLVVDQWGHX[rWUHVHQXQHVHXOHFKDLU
Cette restauration de la juste vision du couple commence
lintrieur de nous-mmes.

Les diffrentes facettes de lamour

$XMRXUGKXLOHPRWDPRXUHVWDVVRFLpjEHDXFRXSGH[SUHVVLRQV
et ses usages couvrent des dimensions trs diverses. On peut aimer
un objet, une personne, un sport, une musique, un animal, une
couleur, etc.
'DQV OD UHODWLRQ DPRXUHXVH OH VHQV G DLPHU  SUHQG DXVVL GH
QRPEUHXVHVIDFHWWHVHWSHXWGpQLUGHVDVSHFWVWUqVGLYHUVWHOVTXH
lattirance sexuelle, le dsir de possder lautre ou avoir une relle
affection pour lui.
Lattraction entre lhomme et la femme a une composante
physiologique. Ainsi, des tudes ont dmontr quune part
importante de lattirance se concrtise dans notre corps sous la
forme de ractions chimiques. Le dsir, le bien-tre ou le sentiment
de manque de ltre aim sexpriment dans notre corps par des
messages molculaires envoys notre cerveau.
Ces processus chimiques sont la base des motions qui nous font
ressentir la peur, la douleur ou le plaisir. Grce eux, notre corps
peut ragir aux situations et nous pouvons ressentir des motions.
Cependant, tous ces mcanismes intrieurs ne peuvent pas se
SURORQJHULQGpQLPHQW
Par exemple, si jai peur des serpents, je vais vivre une intense
motion chaque fois que je serai vers lun deux. Devant lanimal
que je crains, mon corps va produire des molcules qui vont
PRGLHUPRQFRPSRUWHPHQW0RQFXUYDVHPHWWUHjEDWWUHHW
mes muscles se crisper, tout en moi me forant fuir lobjet de
ma peur. Mais, si je dois vivre ct dun (gentil) serpent, mon
corps ne pourra pas distiller constamment des alertes chimiques ;
PHVpPRWLRQVYRQWGRQFQLUSDUVHVWRPSHUHWMHQHSRXUUDLSOXV
paniquer face cette menace.
Cet exemple illustre pourquoi les motions ne peuvent durer
LQGpQLPHQW 3DU FRQVpTXHQW XQ FRXSOH TXL VH FRQVWUXLW VXU OHV
seules motions ne peut tenir dans la dure.

116

Choisis la vie...

Couple
Introduction
et famille

Les origines du couple selon la Bible


'LHXGLW)DLVRQVOKRPPHjQRWUHLPDJHVHORQQRWUHUHVVHPEODQFH
(). Dieu cra lhomme son image, il le cra limage de Dieu,
LOFUpDOKRPPHHWODIHPPH'LHXOHVEpQLWHW'LHXOHXUGLW6R\H]
IpFRQGVPXOWLSOLH]UHPSOLVVH]OD7HUUHHWDVVXMHWWLVVH]ODHWGRPLQH]
sur les poissons de la mer, sur les oiseaux du ciel, et sur tout animal
qui se meut sur la terre. Gense 1.26-28
Ressemblance , son image , limage de Dieu Homme
et femme il les cra ... voici les termes que la Bible utilise quand
elle parle de la relation damour qui unit lhomme et la femme.
&DU'LHXHVWDPRXU1 et cest pourquoi, seule une relation est
capable den donner une reprsentation sur la terre. Le couple a
t dsir et conu par Dieu pour clairer la cration.
La ralisation de ce chef-duvre sest faite par un tonnant
processus. Ainsi, la Bible nous rvle qu lorigine, lhomme
tait form dune seule pice. Cet tre mystrieux et complet tait
plac au-dessus de la cration. Cette condition de matre ne le rend
toutefois pas heureux, car il souffre dune profonde solitude que
les autres cratures ne sauraient gurir.
Lternel Dieu forma de la terre tous les animaux des champs et
WRXV OHV RLVHDX[ GX FLHO HW LO OHV W YHQLU YHUV OKRPPH SRXU YRLU
FRPPHQWLOOHVDSSHOOHUDLWHWDQTXHWRXWrWUHYLYDQWSRUWHOHQRP
que lui donnerait lhomme ; et lhomme donna des noms tout
le btail, aux oiseaux du ciel et tous les animaux des champs ;
mais, pour lhomme, il ne trouva point daide semblable lui.
Gense 2.19-20

Face cette solitude, Dieu entreprend une action dterminante qui


va bouleverser sa condition. Il entame une opration chirurgicale
(avec anesthsie) pour diviser sa crature et en faire deux parties
distinctes.
$ORUVOeWHUQHO'LHXWWRPEHUXQSURIRQGVRPPHLOVXUOKRPPH
qui sendormit ; il prit une de ses ctes, et referma la chair sa
place. Lternel Dieu forma une femme de la cte quil avait prise de
lhomme, et il lamena vers lhomme. Gense 2.21-22
1

-HDQFHVWODSOXVFRXUWHGpQLWLRQTXHOD%LEOHGRQQHGH'LHXHOOH
rsume cependant toutes les autres.

117

Couple
Introduction
et famille

Choisis la vie...

Ce texte tonnant souligne que lhomme et la femme viennent


dune seule et mme source : leurs origines sont communes. Notons
quil ne sagit pas dans ce rcit de laspect biologique, mais dune
sparation qui fait rfrence une dimension spirituelle ; lhomme
HW OD IHPPH UHoRLYHQW XQH SDUW VSpFLTXH GH OLPDJH TXH 'LHX
dpose sur la Terre.1
Comme des rabbins lont trs vite soulign, ce nest pas sans
raison que le rcit biblique donne des prcisions sur lopration de
sparation : ainsi, la femme nest pas tire du pied pour quon lui
marche dessus, ou de la tte pour quelle domine sur lhomme.
Non, la femme est issue du ct, ce qui souligne le parfait quilibre
GHYDOHXUTXLO\DHQWUHOKRPPHHWODIHPPH&HWWHpJDOLWpHVW
SOHLQHPHQWUHFRQQXHSDU$GDPTXLMXELOHGHWURXYHUHQQXQYLV
-vis dans la cration ; ces retrouvailles damour, qui recomposent
ltre unique, constituent le fondement du couple et de la famille.
Comme le montre cette rapide tude, le couple avait reu une
dimension divine qui lui permettait de crer la vie et de transmettre
la rvlation de Dieu. Cette capacit donne lhomme et la
femme ne se limite pas la procration biologique ; elle permet de
PHWWUHDXPRQGHGHVHQIDQWVGH'LHX$LQVLFKDTXHSHUVRQQH
sur la terre est le fruit dune rencontre qui a permis de runir en un
seul tre deux hritages distincts (une seule chair).
Aujourdhui, des milliards dtres humains peuplent le monde, et
cette puissance de vie continue de triompher sur les maladies et sur
les guerres. Certes, un grand nombre de naissances ne dcoulent
pas dun vrai amour tel que Dieu laurait dsir, mais chaque
naissance dmontre la puissance qui a t donne au couple pour
lui permettre de remplir la cration.

118

La majorit des espces animales sont sexues. Ainsi le fait que lhomme
ne trouve pas de vis--vis parmi les autres cratures souligne quil y a dans
lhomme une dimension spirituelle qui le conduit aspirer un vis--vis qui
DOXLDXVVLOHVRXIHO(VSULWGH'LHX

Choisis la vie...

Couple
Introduction
et famille

La sexualit
$XMRXUGKXLGDQVOHVPpGLDVOHVOPVHWOHVMRXUQDX[RQSDUOH
de plus en plus des relations sexuelles, des caresses et du plaisir.
En revanche, on parle bien peu du fabuleux projet de vie que
lhomme et la femme peuvent vivre en sunissant affectivement
et physiquement. Pourtant, avant toute chose, il est bien de se
rappeler que chacun de nous est le fruit dune relation sexuelle ;
si lhumanit existe, cest donc grce cette fabuleuse capacit de
donner la vie.
Dieu a cr lhomme et la femme avec le projet quils sunissent
et crent un nouvel ensemble. Cette relation nest pas une simple
amiti, car elle abrite les dimensions intimes de la vie en commun
et de lunion des corps. Dans ce projet, les relations sexuelles sont
lune des prcieuses dimensions qui cimentent un couple.
Ainsi, et contrairement aux ides reues, la Bible prsente la
sexualit de manire positive et lun de ses livres, le Cantique
des cantiques, se consacre dcrire le jeu des attirances amoureuses
et des plaisirs de lamour.
Que tu es belle, mon amie, que tu es belle ! Tes yeux sont des
FRORPEHV4XHWXHVEHDXPRQELHQDLPpTXHWXHVDLPDEOH
Notre lit, cest la verdure. Cantique des cantiques 1.15-16
Que ta source soit bnie et fais ta joie de la femme de ta
MHXQHVVHELFKHGHVDPRXUVJD]HOOHSOHLQHGHJUkFHVRLVHQWRXW
temps enivr de ses charmes, sans cesse pris de son amour.
Proverbes 5.18-19

Les attirances affectives et physiques de la sexualit font partie du


projet dalliance ; ils sont lun des signes de la nature de lamour.
Car lamour, cest aimer un autre que soi ; lamour nous conduit
donc dpasser nos limites pour nous attacher celui qui est
diffrent.
Cest ce cri damour que lon peut observer lorsque Adam dit
SURSRVGHVDIHPPHFKDLUGHPDFKDLUYHQHVWSDV$GDP
mais lamour conduit Adam au-del de son gocentrisme. Il
sattache sa femme et la reconnat comme une partie de lui-
mme. Cette union corporelle sera souligne par laptre Paul qui
prcise que, dans le mariage, le corps du conjoint appartient aussi
lautre, il forme un tout :
119

Couple
Introduction
et famille

Choisis la vie...

Ce nest pas la femme qui dispose de son corps, cest son


mari. De mme, ce nest pas le mari qui dispose de son corps,
cest sa femme. 1 Corinthiens 7.4
Cest ainsi que le mari doit aimer sa femme comme son propre
FRUSV&HOXLTXLDLPHVDIHPPHVDLPHOXLPrPHphsiens 5.28

Comme le rappellent ces versets, le fruit de lamour nous conduit


considrer lautre comme tant une part de notre vie. Lattirance
et les dsirs de la sexualit sont lune des forces qui nous
SRXVVHQWjUHFRQQDvWUHKXPEOHPHQWQRVOLPLWHV-HQHVXLVSDV
complet et cest grce lautre, qui est diffrent, que je pourrai
PDFFRPSOLU
Cette merveilleuse dcouverte du plaisir de la diffrence peut
malheureusement tre ravage par le mpris envers lautre sexe.
OH[WUrPHOHGpVLUSHXWQLUSDUVHGpWRXUQHUGHFHOXLTXLHVW
GLIIpUHQWDXSURWGHTXHOTXXQGHVHPEODEOHjVRL&HVWOHGUDPH
de lhomosexualit ou de lgocentrisme qui sont laboutissement
GXQH DWWLUDQFH ELHQ WULVWH SRXU VRQ SURSUH UHHW 'DQV OD OHWWUH
aux Romains, Paul considre que ce chemin strile qui conduit
jVHQDPPHUSRXUVDSURSUHLPDJHHVWOXQHGHVFRQVpTXHQFHV
affectives et sociales de la rupture entre les hommes et Dieu.1
Puisque la sexualit est lune des composantes complexes et
vitales de lhumanit, elle peut rapidement se pervertir et conduire
loppression et la mort
/DGXOWqUHOHYLROODSURVWLWXWLRQODSpGRSKLOLHWRXVFHVpDX[
sont les expressions dune sexualit dconnecte de son projet
divin. Car lorsque lamour rel manque, les dsirs et la recherche
de plaisirs deviennent des forces indomptables et chaotiques. Dans
cette situation, lhomme ou la femme peuvent devenir esclaves
des plaisirs sexuels, ceux-ci sont alors comme une drogue qui les
entrane dans la dchance.
/HFKUpWLHQQpFKDSSHSDVjODGLIFLOHWkFKHTXLFRQVLVWHjJpUHU
ses dsirs et tenir sa sexualit dans le cadre du projet de Dieu.
&HOD HVW GDXWDQW SOXV GLIFLOH ORUVTXH OHV FDGUHV VRFLDX[ HW OD
vision de la famille samenuisent.
1

Romains 1.18-32.

120

Choisis la vie...

Couple
Introduction
et famille

Dans le contexte actuel, la sexualit est devenue lun des moyens


dattirer lattention et les publicits utilisent abondamment les
charmes fminins ou masculins pour vendre leurs produits.
Cette rotisation, visant exciter les dsirs, saccompagne aussi
dune idologie qui prsente la sexualit en dehors de toute
considration familiale.
Dans ce contexte, le chrtien qui dsire vivre selon Dieu est donc
dans une situation de tension entre les discours qui linvitent
cder ses dsirs charnels et le projet du couple prsent dans la
Bible.
Pour apprendre grer ses dsirs,
LOHVWXWLOHGHFRQHUFHWDVSHFWGH
notre vie Dieu en lui demandant
quil nous aide et nous garde
dune tentation qui pourrait nous
faire sombrer. Dans ce sens, il est
bien dviter les zones risques et
les personnes qui pourraient nous
entraner dilapider notre capital
dalliance.

Lorsque lon casse un aimant en


deux, laimant ne se dtruit pas,
mais les deux parties deviennent
deux aimants distincts qui
sattirent et cherchent recrer
laimant initial. Cette exprience
est une belle image de ce que Dieu
a ralis en crant le couple ;
il a spar deux tres pour leur
permettre de se trouver par
lattirance de leur amour.

Lune des meilleures aides face aux tentations consiste viser


haut avec lambition de trouver la bonne personne qui permettra
de sunir dans le projet du mariage.
3DUH[HPSOHGHQRPEUHXVHVMHXQHVOOHVVHODLVVHQWHQWUDvQHUj
coucher avec des hommes parce quelles nont pas conscience
de leur dignit et du fait quelles mritent plus quune aventure.
Comprendre quil y a un projet pour notre vie est un encouragement
ne pas cder au premier venu.
Je te loue de ce que je suis une crature si merveilleuse. Tes
oeuvres sont admirables et mon me le reconnat bien. Mon
corps ntait point cach devant toi, lorsque jai t fait dans
un lieu secret, tiss dans les profondeurs de la terre. Quand je
ntais quune masse informe, tes yeux me voyaient ; et sur ton
livre taient tous inscrits les jours qui mtaient destins, avant
quaucun deux nexiste. Psaume 139.14-16

121

Couple
Introduction
et famille

Choisis la vie...

Pourquoi la sexualit doit-elle se vivre dans le mariage?


Lune des fonctions essentielles de la sexualit est de pouvoir
donner la vie. Ainsi, lors dun rapport sexuel lhomme et la femme
vivent un contact biologique intense qui permet de mlanger leur
patrimoine gntique pour crer une nouvelle identit. Ce contact
intime est semblable au fait de mlanger son sang.1
La relation sexuelle procure du plaisir, mais elle nest pas anodine
et vise logiquement permettre la procration. Le mariage permet
de proclamer publiquement lunion librement consentie entre
un homme et une femme. Cet engagement permet de crer un
espace reconnu socialement et mme daccueillir les enfants.
loppos, vivre des relations sexuelles hors du mariage conduit
grandement sexposer, car :

Lamour de lautre est-il vrai ou est-ce une simple recherche


de plaisirs ?
Mon partenaire sera-t-il prt sengager durablement ?
Prendra-t-il ses responsabilits si un enfant vient natre ?
Chaque anne le monde compte des centaines de millions
denfants non dsirs et lon estime environ 50 millions le
nombre davortements. Derrire ces chiffres normes se cache
une multitude de vies brises et de souffrances. La sexualit
procure du plaisir, elle est belle et prcieuse, cest la source de la
vie. Pourtant, mal gre, elle peut produire lenfer et la mort.
La planification des naissances
Avant de clore ce sujet, il faut encore aborder la question cruciale
GHODQDWDOLWpDQGHUppFKLUjODERQQHPDQLqUHGDJLUGDQVFH
domaine.
Quels sont les conseils bibliques que lon peut avoir sur le contrle
de la natalit ?
Dmographie par couple :
3,1 enfants : Moyenne mondiale
1,8 enfant : Pays industrialis
6,3 enfants : Afrique subsaharienne
1

Cest cause de ce contact que des maladies virales ou infectieuses peuvent se


transmettre (VIH (sida), hpatites, syphilis).

122

Choisis la vie...

Couple
Introduction
et famille

Comme nous lavons vu prcdemment, le mandat donn


lhomme dans la cration tait dtre le grant du jardin. Selon
cette vision, lhomme nest pas un petit ftu de paille entran
par son environnement, il gre son destin, cultive et transforme
ce qui lentoure de manire prosprer. Cette vision biblique est
trs diffrente du fatalisme des autres religions ou superstitions
SDUOHTXHORQFRQVLGqUHTXHFHVWDX[GLHX[DX[HVSULWVRXj
ltat de dcider.
Dans la Bible, la sexualit fait partie des choses que lon doit grer
de manire responsable en veillant mesurer les consquences de
ses actes.
Si une jeune femme a une relation sexuelle lors de sa priode
fertile, elle aura environ une chance sur quatre dtre enceinte.
Ainsi, des rapports rguliers durant une anne conduisent dans
84% des cas une grossesse.
Selon ces chiffres, il est normalement trs facile davoir des enfants
et cette fertilit conduit de nombreuses femmes enchaner les
grossesses. Par ailleurs, sur un plan biologique, un homme aurait
potentiellement les moyens davoir plus dune centaine denfants.
&HODVLJQLHWLOFHSHQGDQWTXLOGRLWOHIDLUH"
Donner la vie est un acte important qui dcide du destin dune
nouvelle personne. Dans certaines rgions du monde, le fait davoir
XQJUDQGQRPEUHGHQIDQWVHVWXQHVRXUFHGHHUWpDORUVTXHGDQV
dautres pays la natalit est trs faible. Devant ces deux extrmes,
le couple doit donc prendre conscience de sa responsabilit et
sinterroger sur ses capacits accueillir des enfants. Aura-t-
il les ressources pour en prendre soin ? Les environnements
conomiques et sociaux lui permettront-ils davoir une famille
nombreuse ?
Selon ces questions, il est important davoir un quilibre entre le
dsir davoir des enfants et la sagesse de pouvoir les assumer. Dans
ce sens, il vaut mieux avoir peu denfants qui soient bien soigns
plutt que beaucoup qui restent enferms dans la pauvret. Dans
FHPRQGHGLIFLOHDYRLUWURLVRXTXDWUHHQIDQWVHVWGpMjXQJUDQG
GpjDVVXPHU
Les moyens contraceptifs ou larrt des relations sexuelles durant
les priodes de fertilit de la femme sont des moyens disposition
qui permettent de grer les naissances.
123

Couple
Introduction
et famille

Choisis la vie...

La ncessit dduquer les enfants


Un enfant livr lui-mme ne pourra sortir de son univers infantile
et de son ignorance. Sil est laiss dans son immaturit et quil
napprend pas contenir ses pulsions, il sera plus tard un danger
pour la socit. Car lenfant na pas les capacits de mesurer la
gravit de ses actes ; il peut alors laisser libre cours ses violences
et commettre des atrocits sans mesurer la souffrance vcue par
ses victimes. Cest pour cette raison que, dans certains pays, les
chefs de guerre cherchent recruter des enfants soldats. Ceux-ci
VRQW LQXHQoDEOHV HW SHXYHQW VXLYUH DYHXJOpPHQW OHV RUGUHV OHV
plus cruels.
Cependant, et mme dans ces situations tragiques o les enfants
soldats torturent et pillent, il est important de se rappeler quils
sont eux-mmes les victimes de ceux qui les ont conduits sur ce
chemin de violences et dignorance.
La manire dlever nos enfants dessine le pays que nous aurons.

Dans de nombreux textes, la Bible nous invite considrer la


valeur des enfants. Jsus a pris plusieurs fois les enfants en les
prsentant comme les plus grands !1 Par ce geste, il annonce que
laccueil dun enfant conduit linviter lui-mme.
(WTXLFRQTXHUHoRLWHQPRQQRPXQSHWLWHQIDQWFRPPHFHOXL
FLPHUHoRLWPRLPrPHMatthieu 17.5

Jsus donnera aussi des avertissements trs svres ceux qui leur
font du mal ou les scandalisent.
*DUGH]YRXVGHPpSULVHUXQVHXOGHFHVSHWLWVFDUMHYRXVGLV
que leurs anges dans les cieux voient continuellement la face de
mon Pre qui est dans les cieux. Matthieu 17.10

Comme le montrent ces quelques exemples, la valorisation des


enfants est lun des messages central du Christ et celui qui prtend
tre chrtien doit renverser ses valeurs. Dans beaucoup de cultures,
lenfant est peru comme un tre de peu dimportance et les
KRPPHVLQXHQWVFKHUFKHURQWVXUWRXWjVRFFXSHUGHVSHUVRQQHV
qui leur apportent la gloire et le prestige.
/HQIDQW QDSSRUWH SDV FHV EpQpFHV LO HVW IDLEOH LO D SHX GH
connaissances et ne possde pas de richesses matrielles.
1

Matthieu 18.3, Luc 18.13-16, Marc 9.37, 10.14.

124

Choisis la vie...

Couple
Introduction
et famille

Pourtant, Jsus nous dit quil est trs important Comment


comprendre cette vision ?
%HDXFRXSGHQVHLJQDQWVVHFRQVLGqUHQWFRPPHOHVFKHIVGH
leur classe et se sentent suprieurs. Mais, comme le dit Jsus, le
centre ce nest pas le professeur, mais lenfant. En effet, cest pour
lenfant que le professeur doit transmettre un savoir et donner
lexemple. Le matre de classe est au service des enfants et ceux
TXLGRPLQHQWIUDSSHQWRXPDOWUDLWHQWFHX[TXLOHXUVRQWFRQpV
ne sont pas dignes de soccuper des cratures de Dieu. Comme
le dit lvangile, ce que lon fait un enfant, cest au Christ
quon le fait ; ceux qui ne respectent pas les petits seront jugs
svrement.
La mise en valeur du petit sapplique aussi lensemble de la
socit. Souvent, les dirigeants considrent que les enfants
doivent grandir pour tre capables de servir la socit. L
encore, cest une erreur. Les enfants ne sont pas la socit (ou
lglise) de demain, ils sont la part la plus prcieuse de la socit
daujourdhui. Comme les enfants sont prioritaires, la socit
doit consacrer une part importante de ses ressources servir les
enfants et leur donner les moyens de progresser. Dans les pays
trs dvelopps, la charge attribue lducation et la prise en
charge des enfants est la part la plus importante ; elle correspond
HQYLURQ j XQ WLHUV GHV UHVVRXUFHV VFDOHV &HW LQYHVWLVVHPHQW D
GHEpQpTXHVUpSHUFXVVLRQVFDUTXDQGOHVHQIDQWVSURWHQWGXQH
ducation de qualit, ils seront capables plus tard de crer des
richesses et dassumer des responsabilits. leur tour, ils pourront
soutenir les enfants. Cette boucle de croissance est lune des cls
importantes de la prosprit.
Plus une socit prend soin de ses enfants, mieux elle se dveloppe
long terme.
Il ny a pas de meilleur placement pour un pays que de mettre
du lait dans des enfants. Winston Churchill, premier ministre du Royaume-
Uni durant la Seconde Guerre mondiale.

125

Couple
Introduction
et famille

Choisis la vie...

Quelques pistes pratiques sur le thme de la famille


Couple : Prends soin de ton conjoint en considrant quil est ton
compagnon sur le chemin de la vie. Ne laisse pas ses dfauts ou
tes frustrations couvrir ses qualits.
6L WX WHQJDJHV GDQV OHV OLHQV GX PDULDJH VRLV GqOH j WHV
engagements en demandant aussi Dieu quil taide dans ta
responsabilit et te garde de la tentation.
Sexualit : Le premier sens de la sexualit est de donner la vie ;
elle fait partie dun grand projet. Gre avec sagesse tes dsirs
en veillant exercer la sexualit dans un projet dalliance et de
GpOLWp
Enfants : /HV HQIDQWV VRQW XQ GRQ GH 'LHX TXL QRXV HVW FRQp
pour un temps. Ils sont Dieu et tu es appel en prendre soin et
les faire grandir.
Aime tes enfants et aie le courage de topposer toute personne
qui voudrait leur faire du mal ou les mpriser. En tant que pre ou
mre, tu es responsable de les assister et de travailler pour quils
puissent avoir de quoi vivre. Ils sont le centre de ton ministre
familial.
1H WUDLWH SDV WHV OOHV FRPPH pWDQW GHV rWUHV LQIpULHXUV RX GHV
HVFODYHV PDLV FRQVLGqUHOHV FRPPH GHV UHLQHV HW GHV OOHV GH
Dieu. Prends soin delles et oppose-toi toutes traditions qui
voudraient les rabaisser, les asservir ou les mutiler.
6LWXGRLVGpQLUXQHGRWSRXUXQPDULDJHIDLVOHVDQVFXSLGLWp
et en demandant un prsent symbolique. Donne lexemple et
dnonce publiquement ceux qui exigent des dots pour senrichir.

Si tes enfants se marient, inspire-toi de la Bible pour trouver
la force de ne pas cder la tradition, mais pour agir selon le
projet de Dieu. Encourage et soutiens ceux qui vont se marier en
reconnaissant leur mandat de construire une nouvelle famille. Si ta
tradition exige une dot, quelle reste ltat symbolique et ne soit
SDVOHPR\HQGHIDLUHSHVHUXQSRLGVQDQFLHUVXUOHVPDULpV6LOH
mari ou la femme sont lun de tes enfants, reconnais son autorit
sur la gestion de son couple et sur lducation de ses enfants.
126

Choisis la vie...

Couple
Introduction
et famille

Citations bibliques : le couple et la famille


Maris, que chacun aime sa femme, comme Christ a aim lglise, et
VHVWOLYUpOXLPrPHSRXUHOOH &HVWDLQVLTXHOHPDULGRLWDLPHUVD
IHPPHFRPPHVRQSURSUHFRUSV&HOXLTXLDLPHVDIHPPHVDLPHOXL
mme. phsiens 5.25
Cest pourquoi lhomme quittera son pre et sa mre, sattachera sa
femme, et les deux deviendront une seule chair. phsiens 5.31
3qUHVQLUULWH]SDVYRVHQIDQWVPDLVpOHYH]OHVHQOHVFRUULJHDQWHWHQ
les instruisant selon le Seigneur. phsiens 6.4
Celui qui trouve une femme trouve le bonheur ; cest une grce quil
obtient de lternel. Proverbes 18.22
Car si quelquun ne sait pas diriger sa propre maison, comment
SUHQGUDWLOVRLQGHOeJOLVHGH'LHX"1 Timothe 3.5
Femmes, que chacune soit soumise son mari, comme au Seigneur ;
car le mari est le chef de la femme, comme Christ est le chef de lglise
qui est son corps, et dont il est le Sauveur. Or de mme que lglise est
soumise Christ, les femmes aussi doivent ltre leur mari en toutes
choses. Maris, que chacun aime sa femme, comme Christ a aim lglise,
HW VHVW OLYUp OXLPrPH SRXU HOOH DQ GH OD VDQFWLHU HQ OD SXULDQW
et en la lavant par leau de la parole, pour faire paratre devant lui
cette glise glorieuse, sans tache, ni ride, ni rien de semblable, mais
sainte et irrprochable. Cest ainsi que le mari doit aimer sa femme
FRPPH VRQ SURSUH FRUSV &HOXL TXL DLPH VD IHPPH VDLPH OXLPrPH
Car jamais personne na ha sa propre chair, mais il la nourrit et en
prend soin, comme Christ le fait pour lglise, parce que nous sommes
membres de son corps. Cest pourquoi lhomme quittera son pre et sa
mre, sattachera sa femme, et les deux deviendront une seule chair.
Ce mystre est grand ; je dis cela par rapport Christ et lglise. Du
UHVWHTXHFKDFXQGHYRXVDLPHVDIHPPHFRPPHOXLPrPHHWTXHOD
femme respecte son mari. phsiens 5.22-32
)HPPHVTXHFKDFXQHVRLWGHPrPHVRXPLVHjVRQPDULDQTXHVL
TXHOTXHVXQVQREpLVVHQWSRLQWjODSDUROHLOVVRLHQWJDJQpVVDQVSDUROH
par la conduite de leur femme () Maris, montrez votre tour de la
sagesse dans vos rapports avec votre femme, comme avec un sexe plus
IDLEOHKRQRUH]ODFRPPHGHYDQWDXVVLKpULWHUDYHFYRXVGHODJUkFH
GHODYLH4XLOHQVRLWDLQVLDQTXHULHQQHYLHQQHIDLUHREVWDFOHjYRV
prires. 1 Pierre 3.1-7

127

Notes personnelles

128

CHOISIS LA VIE...
5. GLISE
Si jai une responsabilit ou un ministre dans lglise, je
promets de mappliquer pour exercer cette fonction avec
conscration et selon le modle donn par le Christ, le bon
berger. Dans ce service, je mengage ne pas dominer les
autres, mais chercher lunit et la collaboration avec tous les
membres du corps de Christ, mme ceux qui sont dune autre
dnomination ou fdration dglises.
Selon lexemple du Christ, qui sest donn gratuitement aux
hommes, je mengage ne pas utiliser ma fonction dans
lglise pour menrichir ou pour abuser du pouvoir. Dans ce
sens, je reconnais que les dmes et les offrandes appartiennent
Dieu et lglise et visent apporter le salut, lassistance aux
pauvres et le soutien des ministres.
Dans la gestion des richesses, je mengage appliquer un
principe dgalit envers ceux que je sers.

Le tmoignage de lglise
Cette partie de la charte aborde la question de la responsabilit
que nous avons dans le cadre de lglise. Cet aspect est crucial.
Certes, le tmoignage personnel du chrtien est important pour son
entourage ; mais cest surtout par le tmoignage de lglise que
OHVFUR\DQWVSHXYHQWYpULHUODFDSDFLWpGHOeYDQJLOHjFKDQJHU
le monde. Malheureusement, ce tmoignage de lglise peut aussi
sloigner de lexemple du Christ et donner une vision ngative
de la foi. Par exemple au Moyen ge, le message corrompu et
les abus de responsables dglise ont fait scandale. Alors que le
message du Christ est daimer son prochain, certains hommes ont
XWLOLVpOHODEHOFKUpWLHQSRXUMXVWLHUOHXUFXSLGLWpHWDFFRPSOLU
des crimes et des actes de violences. Ces modles ont donn une
mauvaise vision du message de Dieu. Et aujourdhui ces drives,
qui ont pourtant eu lieu il y a des sicles, loignent encore de
nombreuses personnes de lamour de Dieu.
Limpact de lglise dans la socit souligne le besoin pour
les chrtiens de construire des communauts de qualit dans
129

glise

Choisis la vie...

lesquelles le monde puisse voir lamour de Dieu et rencontrer


le Christ. Comme lglise est une construction divine, il est
essentiel que ceux qui la construisent prennent conscience de leur
responsabilit.
Exercer un service pour Dieu est une voie dexcellence et
nombreux serviteurs de Dieu sont admirables et expriment
la bont et la sagesse de Dieu. Mais il y en a dautres dont les
actions reprsentent de vritables scandales et ces personnes sont
menaces par la colre de Dieu.
Lobjectif de la CHARTE+ est daider chaque responsable
marcher dune manire juste et digne dans le service du Christ.

Les fondements de lglise


Quest-ce que lglise ?
Quel est son rle pour les chrtiens et pour le monde ?
Ces questions sont essentielles, car le danger est grand de sloigner
de la vocation de lglise et de faire delle une communaut
tourne vers ses traditions, ses habitudes ou ses btiments.
/eJOLVHGHYLHQWDORUVXQFOXEFHQWUpSULQFLSDOHPHQWVXUGHV
choses matrielles, donc sur la poussire
Face ces drives, il est bien de rappeler que lglise est issue
de la volont du Dieu crateur ; elle a une vocation spirituelle,
elle est appele porter un tmoignage cleste. Dans lune de ses
ptres, Paul indique que
les dominations et les autorits dans les lieux clestes
FRQQDLVVHQW DXMRXUGKXL SDU OeJOLVH OD VDJHVVH LQQLPHQW
varie de Dieu. phsiens 3.10

Ces paroles permettent de comprendre que limpact dune


YUDLHpJOLVHHVWWUqVSURIRQGHWTXLOPRGLHOHPRQGHYLVLEOH
et invisible.
La naissance de lglise
Dans la nature, cest par une humble graine quun arbre peut sortir
de terre, slever et atteindre de la hauteur. Larbre majestueux
GRLWWRXWjODJUDLQHFDUFHOOHFLDEULWHOLPDJHGHODUEUHHW
la puissance capable de le faire grandir. Il en est de mme pour le
Christ, il est la semence qui contient les fondements de lglise et
la puissance ncessaire sa croissance.

130

Choisis la vie...

glise

On ne peut comprendre le sens de lglise sans (re)venir Christ


car il en est la source et le fondement.
Ce retour aux racines de lglise nous conduit prter une grande
attention aux vnements qui prcdent le ministre de Jsus.
Comme le rapportent les vangiles, ce moment crucial a lieu
lorsque Jsus se fait baptiser par Jean.
Ds que Jsus eut t baptis, il sortit de leau. Et voici, les
cieux souvrirent, et il vit lEsprit de Dieu descendre comme
XQHFRORPEHHWYHQLUVXUOXL(WYRLFLXQHYRL[WHQWHQGUHGHV
FLHX[FHVSDUROHVFHOXLFLHVWPRQ)LOVELHQDLPpHQTXLMDL
mis toute mon affection. Matthieu 3.16-17

Quelle intensit lorsque le Crateur de toute chose dclare son


affection en faisant descendre son Esprit de manire visible.
Cette spectaculaire intervention divine nest pas sans consquence
et Jsus doit affronter les tentations du prince qui rgne sur les
hommes.
Aprs sa victoire spirituelle sur le diable, lvangile de Luc nous
invite couter la dclaration solennelle prononce par le Christ.
Cet pisode a lieu dans la synagogue de Nazareth, la ville qui a
vu Jsus grandir. Dans cette assemble, le Christ prend le livre du
prophte sae, louvre et prononce ces paroles :
LEsprit du Seigneur est sur moi, parce quil ma oint pour
annoncer une bonne nouvelle aux pauvres ; il ma envoy pour
gurir ceux qui ont le cur bris, pour proclamer aux captifs
la dlivrance et aux aveugles le recouvrement de la vue, pour
renvoyer libres les opprims, pour publier une anne de grce
du Seigneur. Luc 4.18 -19 (voir aussi sae 61.1-4)

Aprs cette lecture, Jsus annonce ses auditeurs que ces paroles
prophtiques, crites et gardes prcieusement depuis plus de
600 ans, se ralisent :
Aujourdhui cette parole de lcriture, que vous venez
dentendre, est accomplie. Luc 4.20

Quelle tonnante nouvelle pour les Juifs qui depuis des sicles
attendaient laccomplissement de ces promesses ! Jusque-l,
aucun homme navait eu lambition daccomplir ces promesses.
Jsus tait-il rellement le porteur de cette oeuvre de libration ?
131

glise

Choisis la vie...

Le sens de lonction
Jsus baptis, lEsprit Saint qui descend sur lui, la victoire sur la
tentation et lannonce de son ministre avec la prophtie dsae...
Ce nest pas sans raison que les vangiles nous rapportent les
pYpQHPHQWVTXLRXYUHQWOHPLQLVWqUHGH-pVXV
Pour en comprendre la porte, il faut se rappeler que le nom
&KULVWYLHQWGXWHUPHJUHFFKULVWRVTXLVLJQLHORLQW
&H PRW HVW OXLPrPH OD WUDGXFWLRQ GX WHUPH KpEUHX  PDVKLDK
0HVVLH FKDTXHIRLVTXHQRXVSDUORQVGX&KULVWQRXVIDLVRQV
donc rfrence lonction quil a reue.

Mais alors, si lonction est au coeur du ministre de Christ, que


VLJQLHWHOOHFRQFUqWHPHQW"
Les textes de lAncien Testament nous apportent un clairage trs
prcieux sur le sens de lonction. Sa premire mention biblique
lieu lorsque Jacob1 a la vision dune chelle qui monte vers
Dieu. Cette rvlation le conduit lever un autel et y verser de
OKXLOH,OGRQQHHQVXLWHjFHOLHXOHQRPGH%pWKHOTXLVLJQLH
ODPDLVRQGH'LHX2.
Par ce geste, lonction exprime une dimension spirituelle. Lhuile
verse symbolise la grce et la prsence de Dieu qui descendent
VXUODWHUUHSRXUODVDQFWLHU
'LHX HVW DXGHVVXV GH OD FUpDWLRQ HW VHXOH VRQ LQLWLDWLYH SHXW
permettre lhomme davoir accs son Esprit.

Aprs la libration des esclaves hbreux, le symbole de lhuile se


renforce car elle sert alimenter les sept lampes du chandelier.
Cette huile sainte, source de lumire, fait rfrence lEsprit Saint
qui donne la vie et claire les hommes3.



-DFREHVWOVG,VDDFHWOHSHWLWOG$EUDKDP$SUqVDYRLUFRPEDWWXDYHFODQJH
GH'LHXLOHVWUHQRPPp,VUDsO6HVGRX]HVOVGRQQHURQWQDLVVDQFHDX[WULEXV
du peuple hbreu.

Voir Gense 28.12-19.

Voir Jean 1.1-4.

132

glise

Choisis la vie...

Lonction du sacrificateur
/DVLJQLFDWLRQV\PEROLTXHGHOKXLOHVHUHQIRUFHHQFRUHORUVTXH
Dieu demande Mose doindre un homme et sa famille.
Qui est llu mme de recevoir un tel signe ? Un grand sage, un
chef puissant, un habile artiste ?
Non, car toutes ces qualits sont humaines. Lonction qui vient de
Dieu vise manifester une vocation divine et spirituelle.
Le messie choisi par Dieu aura la charge dexercer un rle de
SXULFDWLRQHWGHSDUGRQSRXUVRQSHXSOH
Mose prit de lhuile donction et du sang1 qui tait sur lautel ;
LOHQWODVSHUVLRQVXU$DURQHWVXUVHVYrWHPHQWVVXUOHVOV
dAaron et sur leurs vtements... Lvitique 8.30

Comme le montre ce rcit, les premires personnes recevoir la


FKDUJHGH&KULVWRVRQWpWpPDQGDWpHVSDU'LHXSRXUVHUYLUGH
VDFULFDWHXU2.

LONCTION DU SACRIFICATEUR
lection divine
une vocation

Mose rpandit de lhuile donction sur la


tte dAaron, et loignit, afin de le sanctifier.
Lvitique 8.12

Homme choisi par Dieu pour offrir les


sacrifices et pour apporter le pardon.

Aaron tait le frre de Mose. Choisi par Dieu, il est le premier recevoir
ORQFWLRQGLYLQHGHVRXYHUDLQVDFULFDWHXU

Lors de cette onction, lhuile est mlange au sang. Cest en mettant du sang
dagneau sur leur porte que les hbreux avaient chapp la mort. La liaison
HQWUHOHVDQJHWOKXLOHVRXOLJQHODSRUWpHGXVDFULFHHWIDLWGpMjUpIpUHQFHDX
&KULVWTXLGRQQHUDVDYLHHQLQGLTXDQWFHVWPRQVDQJ9RLU0DWWKLHX

Cette vocation spciale, accorde la tribu des Lvites, sest transmise travers
le temps. Audjourdhui encore, dans le judasme, les descendants de la tribu
des Lvites (appel les cohanim/cohen) ont encore un statut particulier.

133

glise

Choisis la vie...

Dans la Bible, la vocation du messie se concentre dans le rle de


FHOXLTXLH[HUoDLWWHO$DURQOHU{OHGHVRXYHUDLQVDFULFDWHXU
Pour illustrer le sens spirituel de sa charge, le souverain
VDFULFDWHXU DYDLW VXU OD WrWH XQH WLDUH HQ RU VXU ODTXHOOH pWDLW
pFULW6DLQWHWpjOeWHUQHO6XUVHVpSDXOHVHWVRQFRHXUpWDLHQW
dposes des pierres prcieuses symbolisant les tribus dIsral.

LE SOUVERAIN SACRIFICATEUR
Exode 28:1-28

paules

Deux pierres prcieuses


graves avec le nom des tribus.
Il porte le peuple.

Tte

Chapeau de lin avec tiare en or


Saintet lternel .

Poitrine

Douze pierres prcieuses,


une pour chaque tribu dIsral.

Tablier

Brod avec des fils dor,


des fils bleus et rouges.

Robe

En toffe bleue avec des


dcorations et des clochettes.

/KDELOOHPHQW SDUWLFXOLHU GH FH PHVVLH VRXOLJQH VD YRFDWLRQ GH SRUWHU VRQ
SHXSOHDQGHOXLRIIULUOHSDUGRQHWODFFqVjODSUpVHQFHGH'LHX

/D SRUWpH GH FHV V\PEROHV VDIUPDLW DYHF SXLVVDQFH ORUV GH OD
journe du grand pardon (Yom Kippur)1. cette occasion, le
VRXYHUDLQVDFULFDWHXUDYDLWODFKDUJHGHSpQpWUHUGDQVOHOLHXOH
plus sacr du Temple.
&HW HVSDFH LQWHUGLW DX[ MXLIV HW DX[ DXWUHV VDFULFDWHXUV DEULWDLW
larche de lalliance. Deux chrubins poss sur larche rappelaient
la terrible barrire sparant les hommes de la prsence de Dieu2.

La fte du Yom Kippur est dcrite dans Lvitique 16.

lorigine, les hommes remplis de lEsprit avaient un accs direct la prsence


de Dieu et larbre de la Vie. Leur acte de rupture va les conduire tre chasss
du jardin dEden. Ce jardin devenu inaccessible est une image du destin de
lhomme enferm dans la maldiction de la mort. Voir Gense 3.24.

134

glise

Choisis la vie...

Pour entrer et amener symboliquement son peuple dans la prsence


GH'LHXOHPHVVLHGHYDLWRIIULUGHVVDFULFHV&HX[FLpWDLHQW
dj le signe que seul le don dune vie pouvait apporter la grce
et la rconciliation1.
/H[SLDWLRQVHUDIDLWHSDUOHVDFULFDWHXUTXLDUHoXORQFWLRQ
Lvitique 16.32

Lonction royale
Alors que notre tude nous a conduits dcouvrir la vocation des
VDFULFDWHXUVOD%LEOHQRXVHQWUDvQHGDQVXQHQRXYHOOHGLPHQVLRQ
de lonction. Environ 300 ans aprs Aaron, lhuile de la vocation
divine est dpose sur des hommes choisis pour exercer la royaut.
Lonction dverse sur le roi David est celle qui a la plus forte
porte symbolique2, car ce roi, selon le coeur de Dieu, va librer
son peuple, conqurir Jrusalem, et ouvrir un rgne qui trouvera
VRQDSRJpHVRXVODFRQGXLWHGHVRQOV6DORPRQ3.

LONCTION DE DAVID
lection divine
une vocation.

Samuel prit la corne dhuile, et oignit David


au milieu de ses frres. LEsprit de lternel le
saisit partir de ce jour et dans la suite.
1 Samuel 16.13

Homme choisi par Dieu selon les


valeurs de son cur.

'DYLGpWDLWOHSOXVMHXQHOVGHVDIDPLOOHLOVHUDSRXUWDQWGpVLJQpSDU'LHXSRXU
exercer la royaut et conducteur de son peuple.

2 Corinthiens 5.17-19, Romains 5.8-11, Ephsiens 2.13-18, Colossiens 1.19-22.

Lonction royale sera dabord dpose sur Sal (1 Samuel 10.1), mais ce roi se
GpWRXUQHUDGHVDYRFDWLRQLOVHUDUHPSODFpSDUXQQRXYHDXRLQW'DYLG YRLU
1 Samuel 16.1-14).



/DUR\DXWpGH6DORPRQGRQWOHQRPVLJQLHSDL[HVWXQHSUpJXUDWLRQGX
rgne qui sera tabli dans la Jrusalem cleste (voir Apocalypse 21.1-4).

135

glise

Choisis la vie...

Notons que ce temps de paix et de prosprit sera aussi marqu par


la construction dun majestueux temple symbolisant la prsence
de Dieu Jrusalem1.
Malheurement, cette priode de va pas durer et les rois suivants
vont le plus souvent entraner le peuple dIsral dans lidoltrie
et le mal. Mis part quelques rares temps de restaurations, le
pays sera ds lors divis et les populations disperses, exiles ou
domines par des armes trangres.
Pourtant, au sein de ces souffrances les prophtes vont annoncer
la venue dun oint, dun Messie capable dapporter un rgne de
paix.2
$X O GX WHPSV HW GHV PDOKHXUV FHWWH DWWHQWH GXQ OLEpUDWHXU
envoy par Dieu va se renforcer ; elle sera trs prsente au dbut
de notre re, alors que les Romains dominaient le Moyen-Orient
et occupaient la ville de Jrusalem.
Cette esprance des Juifs souligne lextraordinaire onction que
-pVXV UHoRLW ORUV GH VRQ EDSWrPH  FHW LQVWDQW O KXLOH  GH
lumire qui descend nest pas dverse par des hommes, elle vient
directement du Pre en prenant la forme dune colombe.
&HWWH DSSDULWLRQ V\PEROLTXH j XQH IRUWH VLJQLFDWLRQ FDU XQH
FRORPEHQHVHSRVHDYHFFRQDQFHTXHGDQVVDPDLVRQOHOVHVW
lhabitation du Saint-Esprit3.
Ce lien unique entre Jsus, lEsprit et le Pre est la source vitale
de loint ; lhomme, Jsus na pas la capacit de faire les prodiges,
PDLVSDUVRQXQLRQOLDOHDYHFOH3qUHFpOHVWHLOSHXWDJLUSDUOXL4.


&HWHPSOHpWDLWXQDJUDQGLVVHPHQWGHFHOXLIDLWHQWRLOHDSUqVO([RGH,OQH
sagit donc pas dun btiment o les juifs pouvaient entrer, mais dun symbole
encore plus marquant de limpossibilit de lhomme datteindre Dieu sans une
oeuvre de grce.

Par exemple : Miche 5.1, sae 42.6-7, 49.26, 53, Psaume 132.17.

La colombe qui descend sur les eaux du baptme de Jsus nous rappelle lEsprit
TXLSODQHHWYROWLJHVXUOHVHDX[RULJLQHOOHV LEsprit de Dieu se mouvait
DXGHVVXVGHVHDX[(Gense 1.2). Cette image se retrouve aussi dans lhistoire
de No lorsque la colombe plane sur les eaux en cherchant un lieu pour habiter
(Gense 8.8-12).

Jsus leur dit : En vrit, en vrit, je vous le dis, le Fils ne peut rien faire de
OXLPrPHLOQHIDLWTXHFHTXLOYRLWIDLUHDX3qUHHWWRXWFHTXHOH3qUHIDLWOH
Fils aussi le fait pareillement. Jean 5.19.

136

glise

Choisis la vie...

LONCTION DE JSUS
Celui-ci est mon Fils
bien-aim, en qui jai mis
toute mon affection.

LEsprit trouve une


habitation sainte.

Homme en communion
spirituelle avec Dieu.
Au moment o il sortait de leau, il vit les
cieux souvrir, et lEsprit descendre sur lui
comme une colombe.
Marc 1.10
(Q-pVXVO(VSULWSXLVVDQWHWYLYLDQWREWLHQWHQQOHFDQDOTXLOXLSHUPHWWUDGH
dverser la grce de Dieu sur lhumanit.

Alors que lonction de Jsus annonce des temps nouveaux, elle


IDLWDXVVLGHVFHQGUHVXUOH&KULVWXQPDQGDWGLYLQVSpFLTXH
Ainsi, lorsque Jsus lit le chapitre 61 du livre dsae, il sait
que ces paroles prophtiques le concernent et quelles dcrivent
prcisment la vocation qui lui est donne daccomplir.
Cest pourquoi il dit : LEsprit du Seigneur ma oint pour
Avec ce pour , il reconnat avec humilit que lonction abrite
XQHRULHQWDWLRQVSpFLTXHHOOHHVWune volont du Pre.
Mon Pre (...), que ta volont soit faite ! Matthieu 26.42

La puissance de la communion avec le Pre


On peut illustrer cette ralit spirituelle avec limage dune lampe
fonctionnant sur piles et dune autre raccorde au rseau lectrique.
Alors que la premire tire sa force de rservoirs qui spuisent, la
seconde obtient sa puissance dune source extrieure illimite.
Il en est de mme de la lumire que le Christ apporte dans le
monde ; ses capacits ne reposent pas sur lui-mme, mais sur la
ligne qui lunit au Pre. Cest par le lien actif de lEsprit que passe
la puissance qui lui permet de briller dans le monde.

137

glise

Choisis la vie...

Dans ce sens, il est intressant dobserver que Jsus ne lit pas


entirement le texte dsae. Alors que la citation mentionne
une anne de grce et se poursuit avec lannonce dun jour de
jugement, Jsus sarrte subitement au milieu de la phrase !
(LEsprit ma oint...) pour publier une anne de grce de lternel, et
un jour de vengeance de notre Dieu sae 61.2-4

Pourquoi le Christ annonce-t-il ses auditeurs que ces paroles


sont accomplies en omettant de parler de ce jour redoutable ?
Ce nest pas parce que Jsus est fatigu quil sarrte au milieu de
cette lecture mais bien parce quil connat prcisment les limites
GXPDQGDWTXLOXLHVWFRQp
Quelles sont ces restrictions ? Jsus na-t-il pas reu une onction
totale, nest-il pas le Messie attendu ?
Oui, Jsus est bien le Christos. Pourtant, laube de son ministre,
il sait dj quil nest pas venu parmi les hommes pour tablir son
rgne et exercer la domination. Un jour la royaut lui sera donne,
mais ce moment l, lonction quil reoit du Pre est celle du
VDFULFDWHXUDSSHOpjUpSDQGUHODJUkFHHWOHSDUGRQVXUOD7HUUH1.
&KULVWHVWYHQXFRPPHVRXYHUDLQVDFULFDWHXUHbreux 9.11
Christ ne sest pas attribu la gloire de devenir souverain
VDFULFDWHXUPDLVLOODWLHQWGHFHOXLTXLOXLDGLWWXHVPRQ
Fils, je tai engendr aujourdhui ! Hbreux 5.5

&HWWH YRFDWLRQ VSpFLTXH GH VDFULFDWHXU QRXV SHUPHW GH


comprendre pourquoi Jsus refuse de prendre la place de roi ou
quil ne fait pas appel des armes clestes pour se librer2. Il se
ODLVVHVDFULHUFRPPHXQDJQHDX
Par ce chemin de souffrance, il se consacre son mandat de
VRXYHUDLQVDFULFDWHXUHQSRUWDQWODIDXWHGHVKRPPHVVXUOXL
1

Ces deux vocations messianiques taient dj effectives dans lAncien


7HVWDPHQW $LQVL ORQFWLRQ GX VDFULFDWHXU D SUpFpGp GH SOXVLHXUV VLqFOHV
lonction royale. Notons que le drame du peuple juif est davoir manqu la
premire venue du Christ. Avec leur attente dun Messie royal, ils nont pas vu
FHOXLTXLYHQDLWRIIULUVDYLHHQVDFULFH

Jean 6.15, Matthieu 26.52-53, Jean 18.36-37

138

glise

Choisis la vie...

&HWHUULEOHFKHPLQOHFRQGXLWjrWUHFUXFLpHWEDQQLDEDQGRQQp
de Dieu...1 Et alors que cette redoutable vocation saccomplit dans
la douleur ultime et la mort, le voile de sparation du Temple se
dchire2, le Messie vient de faire cder la barrire entre Dieu et
les hommes.
'HSXLVFHWLQVWDQWOH&KULVWDLQDXJXUpOHGpEXWGHVRQDQQpHGH
JUkFH
/DS{WUH3LHUUHGpQLUDFHWWHqUHFRPPHXQHSpULRGHGHSDWLHQFH
durant laquelle Dieu supporte le mal pour permettre lhumanit
de trouver le salut.3

UN TEMPS DE PATIENCE...
Pardon du
Christ

jugement

Temps de grce
Prparation

Une anne

un jour

La mention dune anne de grce se retrouve dans les annes sabbatiques et du


jubil que lon ftait tous les 7 et 49 ans et qui taient loccasion dannuler les
dettes et dentrer dans le repos (voir Lvitique 25.8-24).

Aprs cet espace de pardon et de grce, il viendra un temps o la


prophtie annonant le jour du jugement saccomplira.
cette occasion, le Christ revtu de lonction royale pourra
accomplir la suite du texte dsae en prenant le mandat divin
SRXUpWDEOLUODMXVWLFH&HVWFHTXDIUPH3DXO
Dieu, sans tenir compte des temps dignorance, annonce
maintenant tous les hommes, en tous lieux, quils ont se
UHSHQWLUSDUFHTXLOD[pXQMRXURLOMXJHUDOHPRQGHVHORQOD
justice, par lhomme quil a dsign, ce dont il a donn tous
une preuve certaine en le ressuscitant des morts Actes 17.30-31

Matthieu 27.46, Marc 15.34.

Matthieu 27.51, Marc 15.38, Luc 23.45, Hbreux 4.14.-16; 9.11-15; 10.19-22.

2 Pierre 5.9.

139

glise

Choisis la vie...

Cette onction future donnant autorit Jsus pour juger le monde


HVW FRQUPpH SDU SOXVLHXUV WH[WHV ELEOLTXHV TXL DQQRQFHQW TXLO
viendra un temps o tous les hommes comparatront devant le
Christ :
Lorsque le Fils de lhomme viendra dans sa gloire, avec
tous les anges, il sassira sur le trne de sa gloire. Toutes les
nations seront assembles devant lui. Il sparera les uns davec
les autres, comme le berger spare les brebis davec les boucs.
Matthieu 25.31-32

Cest ce qui paratra au jour o, selon mon vangile, Dieu


MXJHUDSDU-pVXV&KULVWOHVDFWLRQVVHFUqWHVGHVKRPPHV
Romains 2.16

Mais avant ce jour, Jsus sait quil nest pas venu pour juger
les hommes, mais pour apporter le pardon. Cela sexprime par
exemple lorsquil rencontre la femme adultre ; selon la loi de
Mose, elle mrite un jugement, mais le Christ ne lapplique pas.
-pVXVOXLGLW-HQHWHFRQGDPQHSDVQRQSOXVYDHWQHSqFKH
plus. Jean 8.11

Jsus va aussi dmontrer la priorit de la grce sur le jugement


lorsquil doit faire escale dans un village de Samarie. Comme les
habitants refusent de laccueillir, les disciples, Jacques et Jean, se
mettent en colre et proposent Jsus de faire descendre le feu du
ciel sur ce village.
Mais, Jsus les rprimande en leur disant :
Vous ne savez de quel esprit vous tes anims. Car le Fils de
lhomme est venu non pour perdre les mes des hommes, mais
pour les sauver. Luc 9. 51-59

Lors de cet pisode, les disciples taient srs davoir le droit


dinvoquer le jugement de Dieu. Les Samaritains ne venaient-ils
pas de manquer dhospitalit envers le Messie, lenvoy de Dieu ?
Mais Jsus leur montre que ce dsir de jugement, qui les fait
bouillir, nest pas dans lonction quil a reue.
Si ce qui anime les disciples nest pas dans le dessein de Dieu, cest
donc que ce dsir de jugement vient dune inspiration charnelle et
diabolique.
140

glise

Choisis la vie...

Cette exprience marquera profondment Jean et Jacques qui


souligneront plus tard la priorit de lamour dans leurs crits1.
1RXVDYRQVGX&KULVWFHFRPPDQGHPHQWTXHFHOXLTXLDLPH
Dieu aime aussi son frre. 1 Jean 4.21

Ces quelques exemples soulignent que le Christ avait une


conscience prcise de sa vocation et quil savait que son autorit,
sa force et les exaucements ses prires ne pouvaient se faire que
dans le cadre prcis du ministre de lEsprit.

LE PROGRAMME DE LONCTION

Une vocation
divine prcise.

LEsprit ma
oint pour:

Gurir

Annoncer

Librer

Dlivrer

Publier

Ouvrir

/H&KULVWpWDLWRLQWSRXUIDLUHXQHXYUHSUpFLVHVXUODWHUUHHWFHVWSDUFH
quil tait en plein accord avec les objectifs du Saint-Esprit que son ministre a
t puissant et salutaire.
1

Ce dsir de consumer les mchants aura un touchant pilogue. Plus tard, Jean
VHUHQGUDDYHF3LHUUHFKH]OHV6DPDULWDLQVDQGHSULHUSRXUTXLOVUHoRLYHQWOH
6DLQW(VSULW&HIHXSDLVLEOHTXLGHVFHQGUDDORUVVXUHX[ $FWHV 

141

glise

Choisis la vie...

Dans cette parfaite symbiose entre le Christ et lonction se cache


aussi lautorit dagir spirituellement dans la cration.
Lunivers na-t-il pas t cr par la Parole de Dieu et faonn par
son Esprit ?
En suivant la volont de Dieu, Jsus a un accs direct au
soubassement spirituel de la cration, cela lui permet duser de
lautorit divine pour librer de la puissance du mal, agir sur les
lments et accomplir des miracles1. Il va de soi quil naurait
pas eu cette autorit en dehors de la volont de Dieu ou sil avait
utilis son onction pour des ambitions personnelles.2
travers Jsus lEsprit agit dans (par exemple) :
Les secrets de la matire (la multiplication des pains).
La complexit de la vie (les gurisons).
Le monde spirituel (les librations).
Les raisonnements (la sagesse manifeste).
Et mme la mort (les rsurrections).
9RXVVDYH]FRPPHQW'LHXDRLQWGX6DLQW(VSULWHWGHIRUFH
Jsus de Nazareth, qui allait de lieu en lieu faisant du bien et
gurissant tous ceux qui taient sous lempire du diable, car
Dieu tait avec lui. Actes 10.38

La manire dont le Christ a march avec Dieu nous conduit


tudier attentivement le mandat qui lui a t donn par lEsprit et
quil va consciencieusement appliquer dans son ministre. Grce
DXWH[WHGeVDwHFLWpSDU-pVXVRQSHXWGpQLUOHVD[HVVSpFLTXHV
de lonction et observer leurs accomplissements par le Christ.

Dans labsolu, rien nchappe la puissance de lEsprit, toutefois et comme le


rappelle le symbole de la colombe, lEsprit, aussi puissant soit-il, ne poursuit
pas une conqute violente, cest un esprit doux et de paix qui ne force pas le
cur des hommes.

Cest sur cette voie que le diable cherche le conduire par ces tentations (voir
Luc 4.2-13). Certains serviteurs de Dieu cherchent la puissance sans raliser
quelle est le fruit de lobissance. Fais la volont de Dieu et tu le verras agir !

142

glise

Choisis la vie...

Onction de lEsprit

Actions de Jsus

Annoncer une bonne


nouvelle aux pauvres.

Il prche le pardon des pchs et le salut.

Gurir ceux qui ont le


cur bris.

Il tmoigne de bont, console et gurit


les malades dans leur me et dans leur
corps.

Proclamer aux captifs


la dlivrance.

Il annonce la libration spirituelle (et


indirectement sociale) sur les oppressions
et les contraintes. Il promet la venue
de lEsprit de vie. Il fait mme sortir des
hommes de la mort.

Proclamer aux aveugles Il enseigne et fait sortir les hommes des


le recouvrement de la
tnbres spirituelles et du mensonge, il
vue.
ouvre les yeux des aveugles.

Renvoyer libres les


opprims.

Il libre ceux qui sont sous les dominations


diaboliques.

Publier une anne de


grce du Seigneur.

Il meurt sur la croix pour le pardon des


pchs. Par cet acte, le Christ est comme
un drapeau hiss devant les hommes
et les puissances. Par son lvation, il
proclame un temps nouveau, une trve
sur le jugement, un temps de grce et de
Salut.

Ce tableau permet de saisir la parfaite cohrence entre le


SURJUDPPHGHO(VSULWHWOHPLQLVWqUHDFFRPSOLSDUOH&KULVW
Comme nous lavons vu dans le premier chapitre, notre monde
est domin par une adversit humaine et diabolique contre Dieu.
/H PLQLVWqUH GH &KULVW HVW GRQF XQ FRPEDW GLIFLOH FRQWUH OHV
oppressions et lobscurit spirituelle. Pour permettre aux hommes
de sortir de la mort, Jsus devra aller jusquau bout de sa vocation,
il portera sur lui les fautes en donnant sa vie ! Avec cet acte
dobissance, le diable perd les droits quil a acquis en recevant
ODGRUDWLRQ GHV KRPPHV /H VDFULFH GH OD &URL[ HVW OD EDWDLOOH
ultime de loint pour offrir la libert.
Christ (loint) a dpouill les dominations et les autorits et
les a livres publiquement en spectacle, en triomphant delles
par la croix. Colossiens 2.15

143

glise

Choisis la vie...

Lglise: le corps du Christ


Ceux qui suivaient le Christ ont pris conscience de la parfaite unit
entre Jsus et lEsprit du Pre. On peut lobserver, dans lvangile
GH0DWWKLHXORUVTXH-pVXVGHPDQGHjVHVGLVFLSOHVGHOHGpQLU
4XLGLWHVYRXVTXHMHVXLV"Matthieu 16.15

Pour Simon Pierre, cette question est une occasion de rendre


tmoignage de lintime unit quil a pu contempler entre Jsus et
son Pre ; il rpond :
Tu es le Christ, le Fils du Dieu vivant. (verset 16)

Ces paroles Tu es le Christ VLJQLHQWWXHVFHOXLTXLDUHoX


lonction. Pierre reconnat que Jsus est le porteur la prsence de
'LHXHWTXLOHVWGRQFVRQOV1.
Cette juste comprhension de la nature de loint est une rvlation
divine fondamentale, elle va permettre Jsus de mentionner pour
la premire fois son glise.
Et moi, je te dis que tu es Pierre, et que sur ce roc je btirai
mon glise, et que les portes du sjour des morts ne prvaudront
SRLQWFRQWUHHOOH-HWHGRQQHUDLOHVFOpVGXUR\DXPHGHVFLHX[
ce que tu lieras sur la terre sera li dans les cieux, et ce que tu
dlieras sur la terre sera dli dans les cieux. Matthieu 16.18-20

Cet pisode pose les fondements de lglise, car avec le je te


donnerai , Jsus annonce que lautorit de son onction sera
FRQpHjFHX[TXLOHUHFRQQDLVVHQW3RXUFHWUDQVIHUW&KULVWGRLW
donner sa vie, cest donc logiquement quil indique ses disciples
quil va prochainement mourir la croix.
'qVORUV-pVXVFRPPHQoDjIDLUHFRQQDvWUHjVHVGLVFLSOHVTXLO
fallait quil aille Jrusalem, quil souffre beaucoup de la part
GHV DQFLHQV GHV SULQFLSDX[ VDFULFDWHXUV HW GHV VFULEHV TXLO
soit mis mort, et quil ressuscite le troisime jour. (verset 21)

cet instant, les disciples nont pas encore pris conscience que
le ministre de Jsus est une graine qui sera douloureusement
plante dans la terre ; sa prsence est temporaire et il ne restera
pas physiquement parmi les hommes.
1

Voir ce propos ce que Jsus dit dans Jean 17.7-8.

144

Choisis la vie...

glise

Pour Pierre, qui ne peut saisir cette ralit, il est hors de question
que le Christ ne saisisse pas les rnes du pouvoir.1
Mais la vocation de Jsus ne consiste pas devenir un roi
dominateur ; il est lAgneau qui vient rpandre lonction de
lEsprit en donnant sa vie.
Le repas de la cne dans lequel Jsus partage le pain avec ses
disciples annonce que son corps va tre bris pour tre partag.
Cet acte symbolique annonce que lonction de lEsprit qui tait
sur Jsus sera distribue dans la communaut des croyants.
Plusieurs paroles de Jsus annoncent quil sera remplac par
le consolateur qui viendra soutenir et assister lglise.2 Dans
OpYDQJLOHGH-HDQFHWWHGLVWULEXWLRQGHO(VSULWHVWSUpVHQWpH
comme une source deau vive qui sort des croyants.3
$SUqVODUpVXUUHFWLRQGX&KULVWORHXYUHGHSDUGRQGXVDFULFDWHXU
donne un accs la prsence de Dieu. Laccomplissement est
imminent et Jsus invite solennellement les premiers chrtiens
attendre le don qui leur permettra daccomplir luvre de Dieu
sur la terre.
Cette promesse se ralisera la Pentecte.4 cette occasion,
lonction qui tait sur Jsus descend de manire spectaculaire sur
lglise. Les premiers chrtiens revtus de lEsprit deviennent,
leur tour, dpositaires du mandat qui tait sur le Christ ; ils sont
ceux qui portent le projet de Dieu pour le monde.
Cet aspect est malheureusement souvent mal compris et beaucoup
GHFKUpWLHQVQRQWSDVVDLVLTXHODGLPHQVLRQGHOeJOLVHFRUSV
GX &KULVW  QH SHXW rWUH VpSDUpH GH OD IRQFWLRQ HVVHQWLHOOH GX
6DLQW(VSULW 3RXU VHQ UHQGUH FRPSWH LO VXIUDLW GH WUDGXLUH OH
PRW&KULVWGqVORUVODGpQLWLRQGHOeJOLVHFRUSVGX&KULVW
GHYLHQGUDLWOeJOLVHFRUSVGHFHOXLTXLHVWRLQW
Cet clairage sur luvre du Christ conduit comprendre que
lonction du Saint-Esprit est la raison dexister de lglise !
1

Matthieu 16.22, voir aussi la promesse faite par Jean dans Matthieu 3.11.

Jean 14.16-20; 15.26, 16.7-13

Jean 7.37-39.

Actes 2.1-47.

145

glise

Choisis la vie...

Le rle de lglise
quoi sert lglise?
Cette question fondamentale est importante car la cration de
communauts chrtiennes peut facilement perdre sa vision. Dans
ce cas, la construction des glises se fait par mimtisme et selon un
principe de copie. Les missionnaires ont ainsi souvent reproduit
les types de communauts quils connaissaient dans leur pays
dorigine ; larchitecture des btiments, le type de chants et la
liturgie permettent souvent de reconnatre la dnomination qui a
servi de modle. cela sajoutent encore souvent des particularits
GRFWULQDOHVTXLFRQGXLVHQWjDYRLUGHIRUWHVPpDQFHVHQYHUVOD
foi des autres.
Par de tels mcanismes, le louable et juste dsir de dvelopper
lglise conduit reproduire des doctrines et des traditions
humaines. Cette tendance recopier le pass favorise aussi la
vision paenne qui conduit sacraliser des lieux et des pratiques
religieuses. Cela corrompt le concept de lglises en forant les
croyants se focaliser sur les btiments qui leur servent se
UDVVHPEOHUOHGLPDQFKH&HWWHGpULYHPDWpULDOLVWHHQWUDvQHOHV
chrtiens construire de nombreux temples et chapelles pour y
organiser des crmonies religieuses. Dans certaines rgions, ces
PXOWLSOHVpJOLVHVGHSLHUUHVVRQWVLWXpHVjSUR[LPLWpOHVXQHV
des autres ; toutes se prsentant comme le meilleur lieu de culte !

Cette vision de lglise a aussi de grandes rpercussions sur


la gestion des ressourcesres puisque la plus grande partie des
dons est utilise pour payer les btiments et pour assumer le
fonctionnement des cultes. Les chrtiens seront donc ardemment
VROOLFLWpVSDUOHXUVSDVWHXUVSRXUQDQFHUFHVpGLFHV
Cette spirale de dpenses conduit malheureusement consacrer
lessentiel du capital au fonctionnement interne. Cela affaiblit
le rayonnement vers lextrieur et ceux qui dsirent apporter
lvangile au-dehors ne sont que trs peu soutenus.
La perte de limpact de lvangile que lon observe dans de
nombreux pays est fortement lie cette perversion qui conduit
OpJOLVHORFDOHjGHYHQLUXQHpJOLVHERFDO5HIHUPpHVXUVHV
coutumes et son pass, elle ne peut intresser les hommes et les
femmes qui lentourent.
146

glise

Choisis la vie...

Il va de soi que ce type de communaut nest pas conforme


la vision biblique qui prsente lglise comme la communaut
dpositaire du ministre du Christ.
Lors de la Pentecte, lglise a vcu un vnement fondateur
par lequel lonction qui tait sur Jsus est descendue sur la
communaut des croyants.
$YHFXQWHOKpULWDJHLOHVWLQGLVSHQVDEOHGHUppFKLUDXU{OHGH
lglise dans le monde et aux mandats donns ceux qui exercent
une responsabilit dans les communauts.
Cette onction puissante de lEsprit tait le carburant essentiel
qui a permis aux premires glises de rayonner et dapporter un
tmoignage puissant. Cest lorsque lEsprit saisit Pierre quil
devint capable dannoncer la bonne nouvelle et de toucher le cur
de trois mille personnes.

LONCTION DE LGLISE

Onction et vocation
de Jsus

Vous recevrez une puissance,


le Saint-Esprit survenant
sur vous, et vous serez
mes tmoins Jrusalem,
dans toute la Jude, dans
la Samarie, et jusquaux
extrmits de la terre.
Actes 1.8

Ministres
Tmoignage
Vocations

Miracles

Services

Amour

Dons
spirituels
Visions

Comme lors du baptme de Jsus, le Saint-Esprit descend sur lglise lors de


OD3HQWHF{WH3DUVDYHQXHO(VSULWFRQUPHTXLOSHXWKDELWHUFHX[TXLVRQW
VDQFWLpVHQ-pVXV/RQFWLRQGX&KULVWGHYLHQWORQFWLRQGHOeJOLVH

147

glise

Choisis la vie...

Cest encore ce mme Esprit qui fait des miracles, qui donne
des paroles de rvlation, qui fait des prodiges et qui conduit la
communaut de Jrusalem mettre en place un service dassistance
pour les veuves et les personnes dfavorises.
Par toutes ces choses, les premires glises ont exerc un mandat
GHVDFULFDWHXU
A celui qui nous aime, qui nous a dlivrs de nos pchs par
VRQ VDQJ HW TXL D IDLW GH QRXV XQ UR\DXPH GHV VDFULFDWHXUV
pour Dieu son Pre... Apocalypse 1.5-6

Cet engagement librer et rpandre la grce tait conforme au


SRXUYRXOXSDU'LHXLOpWDLWGRQFVRXWHQXSDUVDSXLVVDQFH
Lorsque lglise travaille au sein du projet de Dieu, lEsprit peut
lassister par des miracles, des inspirations et des exaucements
Mais si lglise agit hors du champ de la volont de Dieu, elle ne peut
obtenir lassistance de lEsprit, elle sassche et devient rigide.

Cette rgle sapplique aussi sur le plan personnel et pour lexercice


dun ministre. Si le rayonnement de notre foi nest pas dans le
champ de lonction, nous ne porterons pas de fruits.
Lattitude qui vise juger les pcheurs est lun des exemples
caractristiques dun comportement situ en dehors de lonction.
Comme nous lavons vu prcdemment, Jsus avait pleinement
compris que sa mission tait de proclamer une anne de grce ;
alors quil pouvait lgitimement juger, il a rsolument choisi de
ne pas le faire. Cest pourquoi laptre Paul souligne que celui qui
juge les pcheurs en se croyant habilit les condamner fait une
grande erreur :
homme, qui que tu sois, toi qui juges, tu es donc inexcusable ;
FDUHQMXJHDQWOHVDXWUHVWXWHFRQGDPQHVWRLPrPHSXLVTXHWRL
qui juges, tu fais les mmes choses. Romains 2.1

Dans ce sens, il est intressant de noter que les aptres et les


vanglistes du Nouveau Testament se sont consacrs annoncer
la grce de Dieu leurs contemporains. Alors que lEmpire
romain tait idoltre, perverti et violent, les chrtiens nont pas
proclam un jugement pour dtruire cet empire, mais ils ont invit
OHXUVFRQWHPSRUDLQVjSURWHUGXSDUGRQGHVSpFKpVDYDQWTXHOH
jugement ne vienne sur le monde.
148

glise

Choisis la vie...

AVEC OU EN DEHORS DE LESPRIT


Onction du
Saint-Esprit

Attitude conforme la
vocation de lEsprit

Grce

Jugement
Attitude hors de lonction
et du mandat de lEsprit

Lonction de lEsprit de Dieu dlimite un champ prcis. Cet espace de grce ne


peut couvrir des attitudes de jugement ou qui sont hors de la volont divine.

$XMRXUGKXLHQFRUHQRXVSURWRQVGHFHWWHSDWLHQFHGDQVODTXHOOH
Dieu ne juge pas activement lhumanit ; au contraire, cest grce
sa gnrosit que le monde continue de tourner. Si Dieu cessait
de retenir le mal, le monde basculerait immdiatement dans le
chaos et la destruction.
Alors que le monde est suspendu la grce divine, on peut
REVHUYHU TXH OHV  MXJHPHQWV  TXL WRXFKHQW OKXPDQLWp VRQW
des consquences indirectes du mal. Larrogance, lidoltrie et
ODPpFKDQFHWpGHVKRPPHVVRQWFRPPHGHVODPHVTXLQLVVHQW
par couper la grce et la protection divine. Lorsque ces liens
protecteurs cdent, lhomme est livr ses propres mchancets.
La guerre, les destructions, la pauvret, les violences ne sont donc
pas causes par Dieu mais reprsentent au contraire la redoutable
consquence du mal.
Un jour, comme lannonce le livre de lApocalypse, le monde sera
jug par son Crateur. cette occasion, ce nest pas le mal qui
jugera le mal, mais le Dieu puissant et juste. Ce qui est cach au
fond des curs sera dvoil.
Le fait que Jsus et lglise nont pas reu le mandat de juger ne
VLJQLHSDVTXHWRXWMXJHPHQWHVWLQWHUGLWHWTXHODMXVWLFHQHGRLW
pas tre applique dans la socit.
149

glise

Choisis la vie...

Dans le Nouveau Testament, Paul indique que les hommes de loi


ont reu un mandat divin pour faire respecter le droit.1 Toutefois,
ce rle politique nest pas en charge de lglise.
Lglise tmoigne de lamour de Dieu aux pcheurs, elle enseigne
des valeurs et transmet des fondements pour lexercice de la justice.
Mais son rle nest pas dappliquer des lois ou de prononcer des
condamnations.
Selon lonction donne par le Christ, lglise travaille tablir le
Royaume de Dieu ; cette vocation qui consiste changer la socit
par une transformation du cur et des valeurs. Ce mandat, qui
consiste implanter lamour de Dieu et du prochain lintrieur
des personnes, est complmentaire celui dune bonne gestion
politique.
Alors que lglise na pas reu le mandat de juger le monde, elle
doit tre attentive la justice qui devrait sexprimer lgitimement
HQ HOOH &HWWH SUpRFFXSDWLRQ GXQH pJOLVH GqOH HW TXL WUDYDLOOH
lintrieur du mandat de lEsprit tait le souci de ceux qui
conduisaient la premire glise. Car si la communaut chrtienne
se corrompt et perd sa vocation, qui laccomplira ?
Le sel est une bonne chose ; mais si le sel perd sa saveur, avec
TXRLODVVDLVRQQHUDWRQ"Luc 14.34

7HQLUIHUPHGDQVODYpULWpHWODPRXUHVWOHSOXVJUDQGGp&HVW
pour sauvegarder ces valeurs que la cupidit et les mensonges
dAnanias et de Saphira seront sanctionns de manire
spectaculaire : ce couple, qui voulait tromper lglise sera
surnaturellement frapp par Dieu.2
Lglise ne doit donc pas juger le monde mais se juger elle-mme
de manire rester pleinement dans le cadre du projet de Dieu3.
La conqute de lvangile sur le monde dpend de lonction qui
habite lglise.

Romains 13.4 (voir le dveloppement de ce thme dans le chapitre sur la


socit).

Actes 5.1-11.

Voir aussi les propos de Pierre, qui annonce que le jugement de Dieu commencera
dans lglise : 1 Pierre 4.15-19.

150

glise

Choisis la vie...

La vraie onction
Certaines personnes pensent quelles ont lonction divine parce
quelles font des miracles ou des choses spectaculaires. Mais,
comme nous lavons vu travers luvre du Christ, la vraie
RQFWLRQHVWXQSURJUDPPHVSpFLTXHTXLYLHQWGH'LHXSRXU
conduire les hommes faire sa volont.
Cette onction divine, qui a t dpose sur le Christ, vise
logiquement accomplir luvre annonce par le Christ lors de
louverture de son ministre. Les chrtiens qui forment lglise
peuvent donc reprendre leur tour les paroles dsae et de Jsus
en proclamant que lEsprit les invite accomplir les pour
GHORQFWLRQHWjDJLUFRPPHGHVVDFULFDWHXUV
AVEC OU SANS LESPRIT

Vocation de
lEsprit

Ministre bni

Ambitions
personnelles

Ministre non bni

La seule bonne manire dexercer un ministre est de se placer sous la conduite


de lEsprit mais cela nest pas facile et nous pouvons facilement confondre la
volont de Dieu avec nos ambitions personnelles.

 -H GLV GRQF  PDUFKH] VHORQ O(VSULW HW YRXV QDFFRPSOLUH]


pas les dsirs de la chair. Car la chair a des dsirs contraires
ceux de lEsprit, et lEsprit en a de contraires ceux de la
FKDLULOVVRQWRSSRVpVHQWUHHX[DQTXHYRXVQHIDVVLH]SRLQW
ce que vous voudriez. Galates 5.16-17

&HVWH[FOXVLYHPHQWGDQVFHSURJUDPPHGH'LHXTXHOeJOLVH
va exprimenter le soutien de Dieu. Mais attention, lorsque nous
parlons de lonction donne lglise, il faut se rappeler que le
&KULVWHVWYHQXDQGHVRIIULUDX[KRPPHV3RXUFHODVRQFRUSV
a t bris.
151

glise

Choisis la vie...

Ce symbole nous rappelle que cest Jsus qui distribue lonction


sur son glise. LEsprit de Dieu est entirement solidaire de ce
processus de multiplication qui conduit fractionner lonction
pour la partager.
Lorsque lEsprit est descendu sur les chrtiens la Pentecte
il sest manifest par un bruit de tempte qui a rapidement fait
DSSDUDvWUHGHVDPPHVGHIHX/D%LEOHSUpFLVHTXHFHVDPPHV
spares les unes des autres, se sont poses sur chacun deux.
Cette manifestation souligne que lonction
GH'LHXVHVWURPSXHDYDQWGHGHVFHQGUH
sur les croyants. Pour cette raison, lonction
que nous recevons personnellement nest
quune petite partie de lonction globale qui
est dpose sur lglise.

dire et redire
Lglise nest PAS un
btiment de pierres,
mais la communaut
des croyants unis en
Christ.

Dans ces conditions, ce nest pas lhomme qui choisit ce quil


reoit mais lEsprit de Dieu.
Paul soulignera plusieurs reprises que la distribution des dons et
des vocations est faite par et selon la volont de lEsprit :
Un seul et mme Esprit opre toutes ces choses, les distribuant
chacun en particulier comme il veut. 1 Corinthiens 12.11-12
Dieu appuyant leur tmoignage par des signes, des prodiges,
HW GLYHUV PLUDFOHV HW SDU OHV GRQV GX 6DLQW(VSULW GLVWULEXpV
selon sa volont. Hbreux 2.4

Selon ces paroles, cest Dieu qui choisit et distribue les parts
destines aux chrtiens. Pour cette raison, personne ne doit se
considrer comme tant suprieur ou comme ayant tous les
ministres. Croire que nous aurions nous seuls toute lonction
du Christ serait le signe dun grand orgueil et lexpression de
notre ignorance du projet de Dieu.
Comme le soulignent plusieurs textes bibliques, il y a un seul
&RUSVFHVWOeJOLVHHWFHVWVXUFHWWHFRPPXQDXWpGHGqOHVTXH
lEsprit descend.

152

Choisis la vie...

glise

Textes bibliques sur lunit du Corps dans la diversit des vocations


Car, comme le corps est un et a plusieurs membres, et comme tous les membres
GX FRUSV PDOJUp OHXU QRPEUH QH IRUPHQW TXXQ VHXO FRUSV DLQVL HQ HVWLO GH
Christ. Ainsi, nous qui sommes plusieurs, nous formons un seul corps en Christ,
et nous sommes tous membres les uns des autres. Romains 12.4-5
Mais toutes ces choses (dons spirituels) cest un seul et mme Esprit qui
les accomplit, en les distribuant chacun en particulier comme il veut.
1 Corinthiens 12.11

Christ est le chef de lglise qui est son corps, et dont il est le Sauveur.
phsiens 5.23b (voir aussi Colossiens 1.24, 2.17, 3.15)

/DFRXSHGHEpQpGLFWLRQTXHQRXVEpQLVVRQVQHVWHOOHSDVODFRPPXQLRQDX
VDQJGH&KULVW"/HSDLQTXHQRXVURPSRQVQHVWLOSDVODFRPPXQLRQDXFRUSV
GH&KULVW"1 Corinthiens 10.16
Car, comme le corps est un et a plusieurs membres, et comme tous les membres
GX FRUSV PDOJUp OHXU QRPEUH QH IRUPHQW TXXQ VHXO FRUSV DLQVL HQ HVWLO GH
Christ. En effet (...) nous avons tous t baptiss dans un seul Esprit pour former
un seul Corps 1 Corinthiens 12.12-13
Vous tes le corps de Christ, et vous tes ses membres, chacun pour sa part.
1 Corinthiens 12.27

Ce mystre, cest que les paens sont cohritiers, forment un mme corps, et
SDUWLFLSHQWjODPrPHSURPHVVHHQ-pVXV&KULVWSDUOeYDQJLOHphsiens 3.6
(Christ) a donn les uns comme aptres, les autres comme prophtes, les
autres comme vanglistes, les autres comme pasteurs et docteurs, pour le
SHUIHFWLRQQHPHQWGHVVDLQWVHQYXHGHOXYUHGXPLQLVWqUHHWGHOpGLFDWLRQGX
corps de Christ. phsiens 4.11-12

Toutes ces paroles sur la nature du corps de Christ doivent nous


conduire reconnatre que :
Nous avons besoin les uns des autres.
Ce que nous recevons ne dpend pas de nous.
Nos dons ou notre vocation sont un service.
Cette vision de la complmentarit de lonction est aussi trs
prcieuse dans lexercice des dons spirituels car ceux-ci ne sont
pas donns pour mettre en avant un homme : mais ils sont au
service du Corps. La puissance de dlivrance et les miracles sont
GHVPR\HQVTXH'LHXFRQHjOeJOLVH&HVPDQLIHVWDWLRQVQHVRQW
donc pas un but en soi mais un tmoignage qui vise dlivrer et
gurir les malheureux.
153

glise

Choisis la vie...

Trois conseils suivre


La manire dont Jsus a exerc son ministre est le modle
suivre. Par amour, il a servi les hommes avec une grande humilit
et en cherchant les lever. Pour marcher dans ses traces, je
soulignerai deux aspects importants :
1. Prendre garde ses faiblesses
La plus grande menace qui vise lglise est de se laisser diriger
par des concepts charnels et diaboliques. Car, mme si notre esprit
est bien dispos, notre dimension charnelle peut facilement nous
faire tomber.
 9HLOOH] HW SULH] DQ TXH YRXV QH WRPELH] SDV HQ WHQWDWLRQ 
lesprit est bien dispos, mais la chair est faible. Matthieu 26.4,
Marc 14.38

De grands ministres se sont ainsi subitement crouls lorsque


OHXUPRQWXUHGHFKDLUOHVDHQWUDvQpVGDQVODGXOWqUHOHYRORX
la convoitise. Mais cette perversion peut aussi prendre des formes
bien plus subtiles...
Lun des exemples les plus dramatiques de cette prise de pouvoir
de la chair est mis en vidence par les pharisiens qui ont cherch
mettre mort Jsus. Ces hommes taient persuads dtre de
grands serviteurs, inspirs et mandats par Dieu, alors quils
taient pilots par les dsirs meurtriers de Satan.1
Dans lptre aux Galates, Paul dnonce ces attitudes qui se
drapent de spiritualit alors quelles sont bassement charnelles
et diaboliques. Ces drives reposent souvent sur des pratiques de
PRUWLFDWLRQVGHVFRQFHSWVOpJDOLVWHVRXXQHMRXLVVDQFHjMXJHU
les autres. Elles sont le plus souvent diriges par des personnes
qui croient tre totalement et constamment inspires par Dieu.
Un danger pour les dons spirituels
Cette perversion de la chair est aussi particulirement tragique
dans lexercice des dons spirituels. La majorit des dons de
lEsprit expriment la sagesse et lautorit de Dieu. Cela est donc
trs sduisant pour les dsirs charnels qui convoitent ces attributs
DQGDVVRXYLUOHXUVRLIGHUHQRPPpHHWGHSXLVVDQFH
1

Voir le texte de Jean 8.44.

154

Choisis la vie...

glise

La gurison des malades, les paroles de connaissance ou la


prophtie font partie des charismes qui peuvent tre subtilement
dtourns par la chair.
Par exemple, lorsquune personne dclare parler au nom du
Seigneur, elle prend une position dautorit sur ceux qui dsirent
entendre la voix de Dieu ; elle peut donc utiliser consciemment
ou inconsciemment ce pouvoir pour dominer les autres ou se
faire valoir. Ainsi, dans certaines communauts, des personnes
GpFUpWpHVSURSKqWHVSUHQQHQWOHFRQWU{OHGHIDoRQVXEWLOHRX
tyrannique sur lensemble de lglise car les autres ministres
et les membres de lglise nosent pas rsister quelquun qui
prtend parler au nom du Seigneur.
De grands miracles sans compassion perdent tout leur sens, le but
de lEsprit ntant pas de faire des choses spectaculaires mais de
conduire les hommes Dieu.
Prendre les dons spirituels ou sa vocation pour dominer ou obtenir
GHVDYDQWDJHVQLWSDUFRUURPSUHOHVEpQpGLFWLRQVGLYLQHV
Face ces tentations, il est important de se rappeler que ce qui
vient de Dieu ne nous appartient pas et que nous serons jugs, non
en fonction de ce que nous aurons reu, mais selon ce que nous
DXURQVIDLWDYHFOHVELHQVTXH'LHXQRXVDFRQpV
Utiliser lglise pour dominer ou prendre un avantage sur les
autres est en horreur Dieu :
-pVXVOHXUGLW9RXVYRXVFKHUFKH]jSDUDvWUHMXVWHVGHYDQW
les hommes, mais Dieu connat vos curs ; car ce qui est lev
parmi les hommes est une abomination devant Dieu. Luc 16.15

La juste attitude
Face ces nombreux dangers qui menacent la vie de lglise, la
Bible nous invite faire la distinction entre ce qui, en nous, vient
de la chair ou de lesprit. Cette attitude conduit sexaminer avec
humilit en reconnaissant quune grande partie de notre vie tourne
autour de nos dsirs charnels.
Cest avec cette honntet que laptre Paul reconnat que ses
membres sont habits par un courant qui na rien de spirituel.
Cette force qui le pousse dans la mauvaise direction le dsespre
et semble anantir tous ses espoirs de salut.

155

glise

Choisis la vie...

Mais moi (Paul), je suis charnel, vendu au pch. Car je ne


VDLVSDVFHTXHMHIDLVMHQHIDLVSRLQWFHTXHMHYHX[HWMHIDLV
ce que je hais. Romains 7.14-15

Cette confession est tonnante, car Paul a pourtant vcu une


conversion spectaculaire ; il a t rempli de lEsprit, il vit dans
une conscration exemplaire et exerce le rle de conducteur.
Mais toutes ces choses nont pas annul sa dimension charnelle et
lhumble aptre reconnat quil a besoin de luvre de Christ et de
ODVVLVWDQFHGHO(VSULWSRXUPDUFKHUGqOHPHQWGDQVVRQVHUYLFH
Misrable que je suis ! Qui me dlivrera de ce corps de
PRUW"*UkFHVVRLHQWUHQGXHVj'LHXSDU-pVXV&KULVWQRWUH
Seigneur ! Romains 7.24-25

Cette prise de conscience est fondamentale, elle invite chaque


chrtien et serviteur de Dieu reconnatre sa fragilit et invoquer
laide de Dieu et de son Esprit.
Cette dmarche personnelle se vit dabord dans le dialogue de la
prire. Dans cette intimit, il est possible dapparatre devant Dieu
tels que nous sommes, sans fard religieux ou position ministrielle
en sachant quil connat notre nature charnelle qui nous attire vers
le pch. Toutes ces choses font partie de notre faiblesse et cest
DYHF FRQDQFH TXH QRXV SRXYRQV OXL FRQIHVVHU QRWUH QDWXUH HQ
OXL GHPDQGDQW TXLO IRUWLH QRWUH HVSULW SRXU TXH QRXV UHVWLRQV
GqOHV
Sous son autorit, notre partie charnelle peut tre tenue en bride
HWFRQGXLWHGDQVXQHVDQFWLFDWLRQMR\HXVH1RWUHYLHPDOJUpVHV
faiblesses, peut alors porter les prmices du Royaume divin et
ternel :
Le fruit de lEsprit, cest lamour, la joie, la paix, la patience,
la bont, la bienveillance, la foi, la douceur, la matrise de soi.
Galates 5.22

Dans lglise, ce bon processus consiste se considrer les uns et


les autres au mme niveau, en se rappelant nos propres faiblesses.
Car si nous sommes diffrents dans les dons et les ministres,
nous sommes tous trs semblables dans la chair et le pch. Par
consquent, celui qui exerce un grand ministre nest pas plus
quun autre et il a autant besoin de la grce de Dieu pour rsister
ses penchants intrieurs.
156

glise

Choisis la vie...

2. Vivre selon un principe dgalit


Le pasteur, le prtre, lvangliste ou le responsable ne doivent
pas se considrer comme suprieurs. Sils ont reu quelque chose
de particulier, cest une grce. Ils ne doivent mpriser personne et
prendre soin des enfants et des plus faibles. Ce principe dgalit
devrait conduire travailler en collgialit et en unit avec dautres
ministres.

Le responsable doit tre un serviteur, cest--dire quelquun


qui est au service des autres, qui les lve. Il ne doit donc pas
dominer, mais conduire avec humilit. Cette attitude de service est
celle qui sest manifeste en Jsus. Il est descendu vers nous non
pour prendre, mais pour donner. Il est venu pour gurir, dlivrer,
apporter la bonne nouvelle. Cependant, dans toutes ces actions, il
avait un cur de serviteur qui la conduit laver les pieds de ses
disciples.
Pourtant, je rencontre parfois des pasteurs trs bien habills... ils
ne portent aucune charge, ne servent pas aux tables, ne nettoient
jamais. Ils sont des rois et se font servir

LA MAUVAISE ET LA BONNE MANIRE DE GRER


Pasteur

Communaut

Domination
Collaboration
Richesses
Service
Communaut

Oppressif

quipe ministrielle

Collgial

Comme le Christ et les aptres lont montr, la conduite de lglise doit se vivre
comme un service aux autres (en dessous) et selon une structure collgiale.

157

glise

Choisis la vie...

Quelle diffrence avec lexemple du Christ accroupi pour laver


les pieds sales de ses disciples ! Ce nest pas pour rien que Jsus
a servi ses disciples en accomplissant une tche rserve aux
esclaves. Il a donn limage juste de ce que reprsente un service
pour Dieu. Chaque candidat qui dsire servir Dieu devrait avoir un
cur de serviteur pour aider concrtement ceux qui lentourent.
Alors que la vision humaine de lglise en fait un espace de luttes
et de pouvoirs, lexemple donn par le Christ souligne que lglise
a une mission dvanglisation et de service.
Pour accomplir sa vocation, lglise est appele offrir un espace
qui lui permet de transmettre lamour de Dieu.
Dans ce monde dchir et cruel, des relations aimantes sont le
plus puissant moyen de dcouvrir Dieu. Pour cela et selon la
vision divine, les nouveaux chrtiens sont invits entrer dans un
processus de croissance et daffermissement. Avec ce mouvement
dynamique, les chrtiens deviennent solides et dcouvrent leurs
dons et leur vocation. Ce rayonnement permet lglise de
tmoigner de la bont de Dieu et dattirer de nouvelles personnes.

UNE GLISE QUI ASPIRE ET QUI ENVOIE...


Rayonnement

Mission

vanglisation

CROISSANCE

Conducteur

Intrt pour Dieu

Formateur

dification

Conversion

Responsable
Chrtien
Visiteur
Dcouverte de la foi

Comme le montre ce schma, lorsquune glise suit la vision du Christ, elle


GHYLHQWXQDVSLUDWHXUTXLFRQGXLWOHVKRPPHVj'LHXOHVpGLHHWOHVpTXLSH
DQTXLOVSXLVVHQWjOHXUWRXUGHYHQLUGHVWpPRLQVHWH[HUFHUOHXUYRFDWLRQ

158

Choisis la vie...

glise

3. Bien grer les ressources


Lvangile est une puissance pour librer les hommes de lemprise
des tnbres et pour rtablir la dignit et la justice. Cette vision
doit nous conduire user de sagesse pour ne pas dilapider les
richesses humaines et matrielles.
Un bon serviteur de Dieu vise bien grer les ressources qui lui
VRQWFRQpHV
Dans certaines rgions, les chrtiens investissent toutes leurs
richesses pour se construire des lieux de culte et les rues en
sont pleines. Ou alors, ils multiplient les runions centralises,
sans laisser les membres exercer leurs dons et leurs services de
PDQLqUH GpFHQWUDOLVpH GDQV OD VSKqUH GLQXHQFH TXL HVW OD OHXU
Mais est-ce cela, lvangile ? Le but de lglise nest pas dtre
un groupe de chrtiens mais dapporter le salut au monde. Pour
atteindre cet objectif, la premire glise de Jrusalem consacrait
une part importante de ses ressources nourrir des veuves et
tmoigner de sa foi. Les libralits et les offrandes taient utilises
pour assister les personnes dmunies et pour annoncer lvangile.
Tous les membres visaient accomplir le ministre de Christ.
&HODVLJQLHTXHOHVUHVVRXUFHVGXQHpJOLVHGRLYHQWVHUYLUjVRX-
tenir le tmoignage du Christ sur la Terre. Le budget de la commu-
naut est donc rpartir selon les objectifs de ces services.
'DQV EHDXFRXS GH FRPPXQDXWpV OHV UHVVRXUFHV QDQFLqUHV
servent essentiellement payer les locaux et le pasteur. Mais la
ralisation et lentretien dun btiment sont coteux et le salaire
du pasteur peut tre une charge trs consquente pour des petites
pJOLVHV$YHFFHVIDUGHDX[QDQFLHUVOpJOLVHSHXWQLUpWRXIIpH
Pour cette raison, il est prfrable de dvelopper les communauts
selon un principe de collgialit et de bnvolat. Utiliser des
locaux existants, comme des maisons, des espaces publics ou des
salles et construire une quipe de ministres bnvoles ou mi-
WHPSVVRQWGH[FHOOHQWVPR\HQVGHUpGXLUHOHVFKDUJHVQDQFLqUHV
ce propos, il est bien de souligner que le ministre de pasteur
est une vocation qui peut parfaitement sexercer en marge dun
travail. Laptre Paul, qui avait un ministre trs important pour
lglise, veillait ne pas tre la charge des glises. Cette juste
DWWLWXGHODFRQGXLWjWUDYDLOOHUGHVHVPDLQVDQGHSRXYRLURIIULU
son service gratuitement :

159

glise

Choisis la vie...

9RXVYRXVUDSSHOH]IUqUHVQRWUHWUDYDLOHWQRWUHSHLQHQXLWHW
jour loeuvre, pour ntre la charge daucun de vous, nous
vous avons prch lvangile de Dieu. 1 Thessaloniciens 2.9
9RXVVDYH]YRXVPrPHVFRPPHQWLOIDXWQRXVLPLWHUFDUQRXV
navons pas vcu parmi vous dans le dsordre. Nous navons
mang gratuitement le pain de personne ; mais, dans le travail
et dans la peine, nous avons t nuit et jour luvre, pour
ntre la charge daucun de vous. () Nous apprenons,
FHSHQGDQW TXLO \ HQ D SDUPL YRXV TXHOTXHVXQV TXL YLYHQW
dans le dsordre, qui ne travaillent pas, mais qui soccupent de
IXWLOLWpV1RXVLQYLWRQVFHVJHQVOjHWQRXVOHVH[KRUWRQVSDUOH
6HLJQHXU-pVXV&KULVWjPDQJHUOHXUSURSUHSDLQHQWUDYDLOODQW
paisiblement. 2 Thessaloniciens 3.7-12
 9RXV VDYH] YRXVPrPHV TXH FHV PDLQV RQW SRXUYX j PHV
besoins et ceux des personnes qui taient avec moi. Je vous ai
montr de toute manire que cest en travaillant ainsi quil faut
soutenir les faibles, et se rappeler les paroles du Seigneur, qui a
GLWOXLPrPHLO\DSOXVGHERQKHXUjGRQQHUTXjUHFHYRLU
Actes 20.34-35

Comme le montrent ces textes, Paul se faisait un honneur de ne


pas tre un poids pour les autres car il voulait que son service soit
lexpression gratuite de lamour de Dieu. Dans sa deuxime lettre
aux Corinthiens, il considre comme un grand honneur doffrir
gratuitement ce quil a reu. Son dsir de donner lvangile le
conduit des privations et travailler durement. Il crira ce
propos :
Jaimerais mieux mourir que de me laisser enlever ce sujet de
gloire. 1 Corinthiens 9.15 (voir aussi les versets 6-18)

Travailler pour assumer ses besoins et servir Dieu bnvolement


devrait tre la norme du service chrtien. Mais cette manire
dexercer un ministre nest pas toujours applique et beaucoup
de pasteurs ou dvanglistes considrent que leur ministre leur
GRQQHOHGURLWGHSURWHUGHVUHVVRXUFHVGHVDXWUHV3RXUFHUWDLQV
cet intrt pour le salaire les conduit exercer le service par appt
du gain.

160

Choisis la vie...

glise

Lorsquune communaut devient importante, par exemple


lorsquelle rassemble plus dune quarantaine de famille,1 il est
utile davoir des serviteurs qui puissent se consacrer entirement
leur tche. Dans ce cas, il devient lgitime dutiliser une part des
dons pour employer un ou plusieurs salaris.
Pour calculer le soutien donner un
ministre, il est primordial dappliquer le
principe dgalit de manire ce quun
serviteur ne puisse senrichir sur le dos
de ceux qui lassistent. Par exemple, si
un pasteur reoit un salaire, celui-ci doit
OXL rWUH [p VHORQ OH UHYHQX PR\HQ GHV
membres de la communaut.

Il y a un lien vident
entre notre foi et la
manire dont nous
grons notre argent.
Cette rgle sapplique
lchelon individuel
mais aussi pour lglise
en tant que commu
naut.

Par cette rgle, lglise fait la dmonstration que le serviteur


participe un ensemble et que son salaire est une part du labeur
de ses frres et surs en Christ.
 &DU LO VDJLW   GH VXLYUH XQH UqJOH GpJDOLWp  GDQV OD
FLUFRQVWDQFHSUpVHQWHYRWUHVXSHUXSRXUYRLUDjOHXUVEHVRLQV
DQTXHOHXUVXSHUXSRXUYRLHSDUHLOOHPHQWDX[Y{WUHVHQVRUWH
TXLO\DLWpJDOLWpVHORQTXLOHVWpFULW&HOXLTXLDYDLWUDPDVVp
beaucoup navait rien de trop, et celui qui avait ramass peu
nen manquait pas. 2 Corinthiens 8.12-14

3RXU DSSOLTXHU FHV SULQFLSHV LO YD GH VRL TXH OHV QDQFHV QH
GRLYHQWSDVrWUHJpUpHVVHXOHPHQWSDUFHX[TXLHQSURWHQWPDLV
par un groupe de personnes intgres et en toute transparence.
3UDWLTXHPHQW ORUJDQLVDWLRQ HW OHV QDQFHV GH OD FRPPXQDXWp
devraient tre gres par un comit de responsables et en tenant
des comptes dtaills sur les dons et les attributions. Le dcompte
des dons et la gestion de largent de lglise devraient toujours se
faire deux ou trois, de manire viter quune personne cde
la convoitise et ne vole dans la caisse.

En dessous de 40 familles (soit environ 160 personnes), le poids et les charges


QDQFLqUHV GXQH FRPPXQDXWp ORFDX[ DFWLRQV GDLGHV VHUYLFHV DVVLVWDQFH
vanglisation, etc.) ne permettent pas de librer un salaire. Il faut donc
travailler totalement selon un principe de collgialit bnvole.

161

glise

Choisis la vie...

Dmarches pratiques
Ce chapitre nous a permis dtudier la nature de lonction qui
est descendue sur lglise la Pentecte. Aujourdhui encore,
cette onction contient la sagesse et la puissance qui permettent
dapporter la vie et la lumire dans notre monde.
Les quelques questions qui suivent peuvent servir de pistes de
UpH[LRQ HW GH PpGLWDWLRQ SRXU FRQVWUXLUH GHV FRPPXQDXWpV
rayonnantes.
Quelles sont les personnes de votre rgion qui ont le cur
bris et ont besoin de gurison, de dlivrance, de libert, de
la grce de Dieu et de retrouver la vue ?
Comment sassocier lEsprit de Dieu pour leur apporter
une aide spirituelle et matrielle ?
Dans les activits actuelles de votre communaut, quelles
sont les choses qui ne sont pas conformes lvangile et
qui devraient tre changes ?
Quels sont les activits et le programme qui permettraient
GH SUHQGUH VRLQ HW GpGLHU OHV SHUVRQQHV HW OHV IDPLOOHV
prsentes dans la communaut ?
Comment grer intelligemment les ressources matrielles et
QDQFLqUHVSRXUDFFRPSOLUOHPDQGDWGHVHUYLFH"
Quelles sont les personnes qui ont reu une vocation
particulire et comment les encourager servir ?
*****
$WWHQWLRQjODIDoRQGRQWYRXVYLYH]YRXVSRXUULH]ELHQrWUHOD
seule Bible que des personnes liront jamais . W.J. Toms
7RXWFHTXHMHVXLVMHOHGRLVj-pVXV&KULVWUpYpOpjPRLGDQV
son divin livre. David Livingstone (1813-1873), grand explorateur
OD%LEOHOHVKRPPHVUHWRXUQHURQWHWSRXUTXRL"3DUFHTXLOV
ne peuvent fonctionner sans elle. Matthew Arnold (1822-1888)
SURIHVVHXUGHSRpVLHj2[IRUGFULWLTXHOLWWpUDLUHHWVRFLDOWUqVLQXHQW

162

Choisis la vie...

glise

Citations bibliques: le service dans lglise


9RXVDYH]pWppGLpVVXUOHIRQGHPHQWGHVDS{WUHVHWGHVSURSKqWHV
-pVXV&KULVW OXLPrPH pWDQW OD SLHUUH DQJXODLUH (Q OXL WRXW OpGLFH
bien coordonn, slve pour tre un temple saint dans le Seigneur.
phsiens 2.20

Je vous exhorte donc, moi, le prisonnier dans le Seigneur, marcher


dune manire digne de la vocation qui vous a t adresse, en toute
humilit et douceur, avec patience, vous supportant les uns les autres
DYHFDPRXUYRXVHIIRUoDQWGHFRQVHUYHUOXQLWpGHO(VSULWSDUOHOLHQ
de la paix. phsiens 4.1-3
Quil ne sorte de votre bouche aucune parole mauvaise, mais, sil y a
OLHXTXHOTXHERQQHSDUROHTXLVHUYHjOpGLFDWLRQHWFRPPXQLTXHXQH
grce ceux qui lentendent. phsiens 4.29
$\H]HQYRXVOHVVHQWLPHQWVTXLpWDLHQWHQ-pVXV&KULVW/XLTXLHVW
de condition divine, il na point regard son galit avec Dieu comme
XQ EXWLQ j DUUDFKHU PDLV LO VHVW GpSRXLOOp OXLPrPH HQ SUHQDQW OD
condition dun serviteur () Philippiens 2.5-7
Si quelquun aspire la charge dvque, il dsire une uvre excellente.
Il faut donc que lvque soit irrprochable, mari dune seule femme, sobre,
modr, rgl dans sa conduite, hospitalier, propre lenseignement.
,OIDXWTXLOQHVRLWQLDGRQQpDXYLQQLYLROHQWPDLVLQGXOJHQWSDFLTXH
dsintress. Il faut quil dirige bien sa propre maison, et quil tienne
ses enfants dans la soumission et dans une parfaite honntet ; car si
TXHOTXXQQHVDLWSDVGLULJHUVDSURSUHPDLVRQFRPPHQWSUHQGUDWLO
VRLQGHOeJOLVHGH'LHX",OQHIDXWSDVTXLOVRLWXQQRXYHDXFRQYHUWL
GHSHXUTXHQpGRUJXHLOLOQHWRPEHVRXVOHMXJHPHQWGXGLDEOH,OIDXW
DXVVLTXLOUHoRLYHXQERQWpPRLJQDJHGHFHX[GXGHKRUVDQGHQHSDV
tomber dans lopprobre et dans les piges du diable. Les diacres aussi
doivent tre honntes, loigns de la duplicit, des excs du vin, dun
gain sordide, conservant le mystre de la foi dans une conscience pure.
Quon les prouve dabord, et quils exercent ensuite leur ministre,
sils sont sans reproche. (...) ceux qui remplissent convenablement leur
ministre sacquirent un rang honorable, et une grande assurance
GDQVODIRLHQ-pVXV&KULVW 1 Timothe 3.1-13
Obissez vos conducteurs et ayez pour eux de la dfrence, car ils
veillent sur vos mes dont ils devront rendre compte ; quil en soit ainsi,
DQTXLOVOHIDVVHQWDYHFMRLHHWQRQHQJpPLVVDQWFHTXLQHYRXVVHUDLW
daucun avantage. Hbreux 13.17

163

Notes personnelles

164

CHOISIS LA VIE...
6. TRAVAIL
Dans la vie professionnelle, je mengage travailler avec
honntet et ne pas cder la cupidit ou des dmarches
conduisant exploiter les autres. Pour offrir les meilleurs
SURGXLWV HW SUHVWDWLRQV MH GpVLUH rWUH XQH SHUVRQQH DEOH
respectant sa parole, intgre dans la gestion des richesses et
capable de rsister la spirale de la corruption.
Si jai une responsabilit ou une fonction dans les services de
VDQWp PpGHFLQ LQUPLHU DGPLQLVWUDWHXU HWF  MH PHQJDJH
respecter le principe dassistance qui place les soins aux
souffrants comme une priorit.1

Le travail
La premire mention du travail dans la Bible apparat au dbut
du livre de la Gense, lorsque lhomme est plac dans le jardin
dden pour le cultiver.
/eWHUQHO'LHXSULWOKRPPHHWOHSODoDGDQVOHMDUGLQGeGHQ
pour le cultiver et pour le garder. Gense 2.15

'DQVOHWH[WHRULJLQDOOHPRWeGHQVLJQLHSODLVLUGpOLFH
Le geste de Dieu qui consiste placer lhomme dans ce jardin de
dlices est donc un cadeau qui exprime la bont de Dieu envers
les hommes.
Rappelons que lespace de ce jardin, avec ses arbres et ses
animaux, ne se limite pas des ralits physiques. Larbre de vie
par exemple, reprsente une dimension spirituelle et symbolique.
/D UHVSRQVDELOLWp GRQQpH j OKRPPH GH FXOWLYHU FH  MDUGLQ 
VRXOLJQHODVSpFLFLWpGHODYRFDWLRQGHOKRPPHGDQVODFUpDWLRQ
1

Les premires versions de la Charte+QHPHQWLRQQDLHQWTXHODVSHFW6DQWp


et avaient le texte suivant : Si jai une responsabilit ou une fonction dans
OHVVHUYLFHVGHVDQWp PpGHFLQLQUPLHUDGPLQLVWUDWHXUHWF MHPHQJDJHj
respecter le principe dassistance qui place les soins aux souffrants comme
une priorit. Dans les cas durgence, je promets de prter assistance mon
SURFKDLQVDQVFRQVLGpUDWLRQGHVRQQLYHDXVRFLDORXGHVHVPR\HQVQDQFLHUV
Dans ce sens, je mengage combattre les concepts visant utiliser les services
de sant dans une vision cupide et mopposer aux dmarches qui visent
extorquer de largent des personnes sans moyens.

165

Travail

Choisis la vie...

Dans la nature, loccupation principale des animaux est dassumer


leurs besoins et de chercher survivre ainsi qu se reproduire.
Lhomme en revanche a reu un mandat diffrent. Certes, il a des
besoins vitaux satisfaire, mais sa vocation ne se limite pas sa
propre vie ; il a reu une responsabilit de grant pour entretenir
et dvelopper la cration.

LA VOCATION DE GRER

Le jardin de
la cration

Le couple

/KRPPHDUHoXGH'LHXOHPDQGDWGHFXOWLYHUHWGHGpYHORSSHUOHMDUGLQGH
la cration. Cette vocation lui permet dexprimer ses comptences pour valoriser
son environnement par son travail.

La plante, avec ses mcanismes, sa diversit et ses innombrables


espces vivantes, est un espace privilgi pour lhumanit. Il
serait impossible de faire linventaire de toutes les choses qui
sexpriment constamment dans les activits humaines (sciences,
projets, constructions, dveloppements, crations, inventions,
recherches, etc.). Ce fantastique travail fait cho au mandat donn
lhomme et celui-ci y trouve une trs grande satisfaction.
Ainsi, le roi Salomon disait en son temps :
Le prcieux trsor dun homme, cest lactivit. Proverbes 12.27

Pourtant, aprs avoir contempl la belle facette du travail, il est


temps de prter attention sa partie sombre. Car, si le travail peut
tre une grande source de plaisir, il peut galement se transformer
en un enfer.
Dans le projet initial, lhumanit devait grer la cration en
sappuyant sur lassistance de Dieu. Mais lorgueil de lhomme
le conduit une arrogante autonomie lgard de son Crateur.
&HWWHDWWLWXGHDGHJUDYHVUpSHUFXVVLRQVHWOKRPPHHVWQDOHPHQW
chass de lespace privilgi du jardin o Dieu rgne.
166

Choisis la vie...

Par cette situation de rupture, lhomme se retrouve


seul et livr une cration sauvage et hostile.1
Son mandat de grant est fortement troubl et son
travail, qui devait tre agrable, devient laborieux
et se fait au prix de sa sueur.2

Travail
0 R Q W UH  P R L
lendroit o tu
habites et je te
dirai si tu es un
bon grant.

Cette dramatique perversion, qui transforme le travail en


souffrance, est une ralit qui traverse lHistoire. Luttes contre la
nature sauvage, esclavages, travaux forcs, ouvriers exploits
&RPELHQGHSHLQHVHWGHVRXIIUDQFHVVRQWFDXVpHVSDUOHVGLIFXOWpV
environnementales ou par la mchancet humaine ?
/H PRQGH DFWXHO QpFKDSSH SDV j FHV pDX[ HW OHV V\VWqPHV
conomiques modernes sont le plus souvent construits sur
lexploitation de malheureux et avec une distribution ingale du
travail et des richesses.
Face ces ralits du travail, la CHARTE+QRXVLQYLWHjUppFKLU
jODPDQLqUHGRQWQRXVSRXYRQVLQXHQFHUOHPRQGHGXWUDYDLOHQ
tant porteurs de bndictions. Bien sr, ce nest pas parce que
nous sommes chrtiens que tout va devenir facile et harmonieux ;
la dure ralit du travail npargne pas les croyants et chacun de
nous peut se retrouver dans une condition professionnelle trs
GLIFLOHRXPrPHVDQVHPSORL
Dans la majorit des cas, apporter des valeurs chrtiennes dans
OHPRQGHGXWUDYDLOHVWXQJUDQGGp&HSHQGDQWOeYDQJLOHHVW
DXVVLXQHIDQWDVWLTXHSXLVVDQFHTXLSHXWUDGLFDOHPHQWPRGLHUOH
monde professionnel et lconomie dun pays.
Limportance du travail
Lorsque nous abordons la question du travail, nous le considrons
souvent dans sa dimension personnelle. Ainsi beaucoup de
personnes valuent les professions selon des critres de salaires
ou de position sociale. Cette manire de considrer le travail selon
GXQLTXHVSURWVPDWpULHOVRXVRFLDX[LJQRUHOHQMHXIRQGDPHQWDO
du travail. Celui-ci vise prendre en charge le destin de notre
MDUGLQ
1

Voir Gense 3.23-24.

Voir Gense 3.17-19, Gense 5.29, Exode 5.5-18.

167

Travail

Choisis la vie...

Par consquent, le potentiel de maldiction ou de bndiction du


travail ne se limite pas aux individus. Il concerne le dveloppement
de lendroit o nous vivons.
Cet aspect est trs important et les chrtiens doivent comprendre
que le monde du travail est un espace crucial pour le dveloppement
personnel, familial, social et conomique.
La sant, les ressources alimentaires, la prosprit, la qualit de
vie, lducation, les infrastructures, les logements, les services, les
communications, etc., toutes ces choses essentielles reposent sur
les capacits de lhomme grer les ressources qui se trouvent dans
la cration. Un mauvais jardinier dtruira son patrimoine alors que
FHOXLTXLVDLWFXOWLYHUVRQFKDPSSURWHUDGHQRXYHOOHVULFKHVVHV
Ce contraste peut sobserver lchelle mondiale. Certains pays
sans ressources particulires sont riches et dvelopps tandis que
GDXWUHV EpQpFLDQW GH WUqV JUDQGHV UHVVRXUFHV QDWXUHOOHV VRQW
dans la pauvret et le chaos.
/DFDSDFLWpGHVKRPPHVjFXOWLYHUOHMDUGLQMRXHGRQFXQU{OH
considrable. En tant que chrtien, notre dsir est de favoriser la
bndiction dans notre environnement, il sagit donc de rechercher
les principes qui apportent une saine transformation et lvent la
qualit de vie.
La cration de richesses
Le processus qui permet lhomme de valoriser son environnement
sappuie sur lextraordinaire potentiel de dveloppement que Dieu
a dpos dans sa cration.
Ainsi, si lhomme peut planter des graines, cest la puissance cache
dans les semences qui accomplit la multiplication qui permettra la
rcolte. Lhomme peut cultiver son champ et larroser, mais la cl
GHVRQSURWUHSRVHVXUXQHLPSXOVLRQGHGpYHORSSHPHQWLQVFULWH
dans la nature. Il va de soi quun jardinier qui pose ses graines
sur des cailloux ne verra rien pousser. Son travail doit suivre les
lois inscrites dans la cration. Sil respecte ces principes, il pourra
SURWHUGHVSURFHVVXVGHPXOWLSOLFDWLRQVLOV\RSSRVHLOQDXUD
SDVGHSURW
Grce labondance inscrite par Dieu dans la cration, la nature
est un fantastique gnrateur qui permet de rcolter davantage que
ce quon a sem.

168

Choisis la vie...

Travail

Les minerais, la vgtation, les poissons, les animaux et toutes les


ressources naturelles qui nous entourent sont des sources vitales
que la sagesse humaine peut exploiter.

Les diffrents degrs dexploitation du potentiel de la nature

Rcoltes directes et utilisation des richesses disponibles naturellement:


chasse, pche et cueillette des fruits et lgumes sauvages.
Les abris naturels sont utiliss comme habitations.

Amnagement visant favoriser le potentiel des ressources naturelles:


plantations, cultures et levages danimaux.
Les matriaux disposition sont utiliss pour les constructions,

Exploitation de ressources ncessitant une transformation basiquedes


lments prsents dans la nature: mtallurgie, industries.
Les constructions et les objets sont raliss avec des matriaux
faonns.

Ralisation permettant de crer des composants et des processus


non disponibles naturellement : chimie, lectronique, informatique,
physique nuclaire, biologie molculaire, etc.
Les constructions et les objets sont raliss avec des matriaux
complexes.

Comme le montre ce tableau, le potentiel de la nature est form


GHSOXVLHXUVFRXFKHVTXHOKRPPHSHXWH[SORLWHUHQXVDQWGH
ses connaissances et de ses capacits technologiques. Selon cette
disposition, ce sont les outils sommaires du premier niveau qui
permettent dexploiter les ressources du deuxime, les nouveaux
outils de ce niveau permettant leur tour daccder des ressources
plus complexes et ainsi de suite.
Cette imbrication des ressources et de la technologie met en
vidence que le dveloppement est un processus de conqute qui
sobtient en ajoutant le travail au travail.
Une civilisation capable dadditionner ses comptences va crotre
alors que celle qui en est incapable ne pourra pas progresser.
Le sage Ecclsiaste avait dj mis en vidence que le travail
commun apporte un gain plus lev :
Deux valent mieux quun, car ils retirent un bon salaire de
leur travail. Ecclsiaste 4.8

169

Travail

Choisis la vie...

La majorit des pays dvelopps ont pu sortir de la pauvret et


du chaos par un long processus de travail ; les routes, les canali-
sations, les voies de transport, les ponts, les tunnels, les rseaux
deau, dlectricit, les btiments.

LADDITION DU TRAVAIL

DVELOPPEMENT

Infrastructures
Rseaux routiers
Btiments, etc.

Travail des
gnrations

TEMPS

Le dveloppement ne peut sobtenir rapidement. Il se ralise par un processus


qui permet dadditionner le travail travers le temps. Investir et travailler avec
sagesse aujourdhui, cest amliorer la qualit de la vie de demain.

Tout cela a t patiemment construit sur plusieurs sicles. Ce


capital investi dans les infrastructures a permis aux gnrations
VXLYDQWHVGHSURWHUGHFHVUHVVRXUFHVSRXUDOOHUSOXVORLQ

CAPACITS

LHRITAGE DES GNRATIONS

Transfert des
capacits

3 gnrations
~40 ans
DVELOPPEMENT

CHELLE DU TEMPS
Ce schma prsente la superposition des diffrentes gnrations. Le processus de
transfert des capacits doit se raliser durant les 40 ans (environ) de vie active des
individus, soit un espace dans lequel environ trois gnrations cohabitent.

170

Travail

Choisis la vie...

Selon ces principes lmentaires, les richesses et les dveloppe-


ments dpendent de la capacit mettre en commun le travail.
Grce la complmentarit des mtiers et des comptences, les
travailleurs peuvent former un rseau dchanges et de services
TXLSURWHQWjOHQVHPEOHGHODSRSXODWLRQ&HVWSDUFHVPpFD-
nismes dchanges que lhomme peut sortir de la pauvret. Par
exemple, le forgeron fabrique une charrue qui permet au paysan
de labourer et de cultiver son champ, ce dernier apporte du bl
au boulanger qui en fait du pain qui sert nourrir le forgeron, le
paysan et le reste du village.

UN PRINCIPE DCHANGES

Boulanger
Cultivateur

Forgeron
Transfert de
comptences
La prosprit et llvation de la qualit de vie reposent sur la mise en commun du
travail. Grce aux changes des comptences et la spcialisation des entreprises,
la socit lve son niveau de dveloppement.

Cette boucle, qui met en jeu des mtiers diffrents, permet


dexploiter collectivement la force de multiplication prsente dans
la nature. Une personne seule dsirant assumer toutes ces tapes
de travail ne pourrait runir les capacits et le temps ncessaire.
Cest par lintgration du travail individuel dans un ensemble que
ODFUpDWLRQGHULFKHVVHVHVWODSOXVHIFDFH
Le dveloppement ne
vient pas de rien, cest
un processus qui prend
du temps.

Lorsque les individus dune socit


parviennent collaborer, la mise en commun
des comptences et des prestations favorise
OHIFDFLWpHWOHUHQGHPHQWGXWUDYDLO

171

Travail

Choisis la vie...

LES BOUCLES DE LCONOMIE


Prestations

Investissements

Services

Connaissances

Gestions
Synergies
changes

Valorisation
Prts

Interactions

Collaborations
Techniques

Aides

Assistances

Comptences

La cration de richesses et le dveloppement sobtiennent par la mise en place


GHQRPEUHX[pFKDQJHV/HVERXFOHVGpFKDQJHVRQWOHVURXDJHVTXLGRLYHQW
tourner pour assurer le fonctionnement du moteur conomique.

Le dveloppement conomique et social sappuie sur de


QRPEUHXVHVERXFOHVGDQVOHVTXHOOHVOHVWUDYDLOOHXUVH[HUFHQW
XQ U{OH VSpFLTXH &HV pFKDQJHV FRQWLQXV GH SUHVWDWLRQV VRQW
FRPPHOHX[VDQJXLQHVVHQWLHOjODYLHELRORJLTXHLOVYDORULVHQW
OHV UHVVRXUFHV HW SHUPHWWHQW j FKDFXQ GH SURWHU GXQ DIX[ GH
richesses. Cette vision globale nous permet de comprendre le rle
particulier (et souvent mal compris) jou par un acteur essentiel
de lconomie : largent.
La nature de largent
Beaucoup de personnes voient en largent le potentiel de richesse
quil reprsente. Pour eux, largent est une denre qui permet
dobtenir de la nourriture, dacqurir des biens et des services.
Les publicits renforcent cette image en murmurant quil faut de
ODUJHQWSRXUDFKHWHUGHVSURGXLWVREWHQLUSURWHU

Certes, largent et les devises reprsentent une valeur que lon peut
amasser ou dpenser pour acqurir des richesses. Mais largent
est bien plus que cela et le considrer uniquement selon la valeur
quil reprsente est lune des mprises qui conduisent de graves
172

Choisis la vie...

Travail

problmes conomiques.
Deux confusions opposes
/LGpHTXHORQVHIDLWGHODUJHQWHVWOXQGHVIRQGHPHQWVTXLGpQLVVHQW
notre vision de la socit. Ainsi, le fait de considrer largent selon sa
valeur en capital conduit deux erreurs politiques opposes :
A. La premire erreur consiste considrer largent selon le potentiel
de richesses statiques quil reprsente. Largent est peru comme
ayant une vertu en lui-mme. Avec cette vision cupide, la recherche du
EpQpFHHWODXJPHQWDWLRQGXFDSLWDOVRQWOHVEXWVjSRXUVXLYUH&HWWH
idologie cruelle et conqurante conduit des dcisions absurdes
comme fermer une entreprise rentable, mais qui ne fait pas assez de
SURWV/DTXDOLWpGHODYLHKXPDLQHHVWDLQVLpFUDVpHDXSURWGXQH
vision goste et abstraite des richesses.
B. La deuxime erreur se nourrit paradoxalement dune vision tout
aussi cupide de largent, mais en prtendant rpartir mcaniquement
ces richesses dans la population.
6HORQFHWWHLGpRORJLHLOVXIWGRXYULUOHVFRIIUHVGHVEDQTXHVRXGH
ponctionner les riches et les patrons pour rsoudre la pauvret. Il va
de soi que cette approche trouve un cho trs favorable auprs des
dmunis. Mais lapplication de cette thorie, par exemple dans le
communisme et dans le socialisme, a conduit plonger les pays dans
la pauvret.
/HSUREOqPHIRQGDPHQWDOGHFHVGHX[YLVLRQVSROLWLTXHVHVWGRXEOLHU
que largent est un vhicule dchange entre des prestations humaines.
Cest lexcellence du travail et la complmentarit des rles et des
services qui permettent de construire une conomie de qualit pour la
socit.

Comme nous lavons vu prcdemment, la cration de richesses


repose sur la facult de travailler et dchanger les comptences.
Cette mise en commun des ressources ncessite de crer des
FDQDX[GHSDUWDJH
Dans les socits primitives, lhomme pouvait changer le fruit
de son travail en faisant du troc, le cultivateur pouvait offrir
ses lgumes au chasseur qui lui donnait de la viande. Comme
ces changes directs ne pouvaient se faire quavec des choses
matrielles et transportables, lhomme a d trouver un systme
plus pratique en reportant la valeur des choses sur des objets quil
173

Travail

Choisis la vie...

SRXYDLWIDFLOHPHQWHPSRUWHUDYHFOXL$XOGXWHPSVOHVELMRX[
les mtaux prcieux et les devises sont devenus des moyens
dchanges et largent est devenu le support privilgi qui permet
dchanger des contreparties au sein de la socit.
Selon ce principe, il va de soi que la valeur dun billet de banque
ne repose pas sur le prix du papier, mais sur une convention sociale
TXL GpQLW VD YDOHXU /H ELOOHW HVW HQ TXHOTXH VRUWH  FKDUJp 
GXQHVRPPHGHYDOHXUWUDYDLOTXHMHSHX[WUDQVSRUWHUGDQV
ma poche. Avec ce billet, je pourrai retrouver un quivalent
de richesse en payant des heures de travail ou en achetant des
biens ou des prestations. Dans largent se cachent le temps et les
comptences des autres, et cest cette dimension qui est la plus
importante pour lconomie.
Avec son statut de valeur dchange, largent joue un rle crucial
GDQVODYDORULVDWLRQGXWUDYDLOLOHVWOHXLGHYLWDOTXLSHUPHW
lconomie de faire circuler les comptences et les ressources.
Avoir de largent, cest comme possder un vhicule et cest dans
la mesure o celui-ci se dplace quil peut apporter des richesses
dans la socit.
Lhomme avis comprend que largent est
&H TXL DSSRUWH OD EpQp
un moyen qui lui permet dinvestir et de diction, cest le travail
faire fonctionner la machine crer des qui sinscrit dans un
richesses, alors que le fou va simplement ensemble et qui permet
voir dans largent la possibilit de possder de servir la communaut.
avoir plus.
En tant que chrtiens, notre regard sur largent devrait tre inspir
par la sagesse biblique qui permet de discerner la dimension
humaine. Car derrire les chiffres et la valeur des devises se
cachent du temps et de la sueur. Un regard clair sur largent et les
richesses qui nous entourent doit aussi nous conduire comprendre
les processus qui permettent de dvelopper lconomie. Car, si
lconomie a besoin de vhicules pour dplacer les richesses,
son bon fonctionnement dpend essentiellement des rgles de
circulation qui seront appliques.

La cration de richesses
Lillustration suivante prsente le processus de cration de
richesses dune entreprise de menuiserie. Comme le montre ce
174

Travail

Choisis la vie...

schma, le processus de valorisation commence par lexploitation


des ressources naturelles de la fort. Par ces qualits, le bois
devient la matire premire sur laquelle lhomme va pouvoir
travailler. Grce aux diverses comptences, le bois est sci et
faonn en vue den faire des objets utiles. Lors de ce processus,
lentreprise dpense des ressources, consomme de lnergie et
rtribue ses ouvriers.
7RXWHVFHVGpSHQVHVVRQWSURJUHVVLYHPHQWGpSRVpHVGDQVOHV
produits qui seront proposs sur le march. Lors de la vente, la
valeur investie dans le produit sera change par une contrepartie
qui permettra de couvrir les salaires et les frais de lentreprise.

LE PRINCIPE DE lENTREPRISE
Processus de valorisation

Matires
premires

Outils
nergies

Ouvriers
Artisans

Patron
Transport
Administration Vhicules

Ventes
Magasins

Distribution des richesses


Le fonctionnement dune entreprise consiste appliquer un processus de
valorisation qui permettra doffrir un produit ou un service. Lchange
de ces prestations lors de la vente apporte un retour de richesses qui permet de
rembourser les investissements (matires, travail, administration, nergie, etc.).

Ce schma sapplique bien sr aux autres entreprises, industrielles


ou de services. Pour un agriculteur, la matire premire sera son
champ dans un commerce, les produits vendre dans une
agence de voyages, les offres touristiques, etc. Si la matire
premire change, le principe qui consiste offrir des prestations
qui rpondent des ncessits demeure. Ainsi, cest dans les
besoins des clients que se cache la raison dtre dune entreprise.
Son succs commercial dpend de ses capacits raliser quelque
chose qui reprsente une valeur pour les autres.
Si le menuisier aime bien faire des chaises mais que le pays est
dj satur, son activit ne dbouchera sur aucune vente. Cest
175

Travail

Choisis la vie...

pourquoi une entreprise doit absolument rpondre un besoin


rel ; pour cela, elle doit analyser les besoins en vue de trouver les
produits et les services qui sont ncessaires la population.
Il va de soi que la force dune entreprise repose sur ses capacits
offrir des comptences qui ne peuvent pas tre ralises facile-
ment. Si lentreprise offre un savoir-faire suprieur aux autres,
elle prend la tte de son secteur. Les comptences sont lune des
ressources les plus importantes et de grandes entreprises telles
Boeing ou Airbus abritent plus dune centaine de milliers dem-
ploys qui travaillent ensemble la ralisation davions de pointe.
La complexit des comptences mises ensemble et leurs facults
GHUpSRQGUHDX[GpVWHFKQLTXHVOHXUSHUPHWWHQWGrWUHOHVOHDGHUV
mondiaux de laronautique.
Ainsi, la force dune entreprise, petite ou grande, dpend de sa
capacit additionner les prestations de ses employs. Cette
UqJOH VHORQ ODTXHOOH FKDTXH WUDYDLOOHXU MRXH XQ U{OH VSpFLTXH
pour un projet commun sapplique aux grandes et aux petites
entreprises. Crer une entreprise consiste donc organiser une
chane de comptence et de travail ; cela nest toutefois pas
facile et de nombreuses rgions ny arrivent pas.
Quel est donc le secret qui permet de crer des entreprises capables
doffrir du travail et de crer des richesses ?
Quelles sont les bases qui permettent des ouvriers de travailler
ensemble ?
Laddition du travail nest pas aise, car elle requiert une solide
LQWpJUDWLRQGHVGLIIpUHQWHVTXDOLFDWLRQVFRPSpWHQFHVHWIRQFWLRQV
Pour un tel assemblage, lentreprise a besoin dun ciment capable
dunir les personnes dans un projet commun. Certes, lintrt pour
OH VDODLUH HVW XQ PRWHXU LPSRUWDQW PDLV FHOD QH VXIW SDV HW OD
recherche tout prix de richesses peut au contraire devenir un
facteur de destruction. Pour quune entreprise fonctionne, elle a
besoin que les acteurs soient habits par de bonnes valeurs et un
profond respect des collgues.
Plus ce respect envers lautre sera fort, plus il sera possible de
construire des entreprises consquentes. Car travailler, cest offrir
une part de soi-mme en donnant du temps, des efforts et des
comptences.
176

Choisis la vie...

Travail

CHANE UNIE

Chaque individu est intgre: lentreprise prospre


Le fonctionnement dune entreprise repose sur la capacit crer des chanes
de comptence. Lorsque les personnes sont intgres, les maillons sont forts et la
chane peut assumer de grands projets conomiques.

Donner son temps et ses comptences au sein dune quipe


reprsente un risque car louvrier peut tre ls par ses collgues
RXVRQSDWURQOXQSHXWSDUWLUDYHFODUJHQWXQDXWUHSURWHUGH
la situation, etc.
Pour ces raisons, le dveloppement conomique dpend
HVVHQWLHOOHPHQW GX GHJUp GH FRQDQFH TXH ORQ SHXW DYRLU GDQV
OHVDXWUHV6LXQFOLPDWGHFRQDQFHSHXWVpWDEOLULOHVWSRVVLEOH
de travailler ensemble pour former des chanes de richesses. Mais
VLOHVSDUWHQDLUHVQHVRQWSDVDEOHVODFKDvQHVHFDVVHHWFHVWOD
pauvret.

CHANE BRISE

La ngligence dun collaborateur fait chouer le projet


La solidit dune chane se mesure la rsistance de son plus faible maillon.
Cette rgle sapplique parfaitement aux entreprises humaines dans lesquelles
ceux qui ne sont pas intgres ou comptents cassent le projet commun.

177

Travail

Choisis la vie...

La capacit de travailler ensemble


Dans les pays les plus dvelopps, la cration des richesses se fait
principalement par des petites et moyennes entreprises (les PME).
Ainsi, ce rseau dentreprises, qui compte de 10 250 ouvriers,
est le plus grand employeur des pays industrialiss ; dans certains
pays les emplois pris en charge par les PME concernent les deux
tiers de lensemble des places de travail.1 De ce fait, elles sont le
fondement de la prosprit des pays riches.
Dans la majorit des pays pauvres, ce tissu de petites et moyennes
entreprises est peu dvelopp et lconomie repose principalement
sur les emplois de ltat et quelques grandes entreprises. Ces
dernires sont souvent des compagnies internationales qui offrent
des services commerciaux ou exploitent des ressources. Comme
les petites et moyennes entreprises sont absentes, la cration de
richesses est anmique et ltat contribue renforcer ce problme
en prlevant des taxes qui touffent encore davantage lconomie.
Ce contexte conduit logiquement une trs grande pnurie de
postes de travail. Ainsi, dans plusieurs pays dAfrique le taux
de chmage est suprieur 30% et dans de grandes cits on trouve
des taux qui dpassent 85% de la population active !2

Avec de tels problmes conomiques, les peuples se retrouvent


enferms dans la pauvret. La souffrance et la frustration qui en
dcoulent contribuent rendre le pays instable et les populations
considrent que leur situation de pauvret est cause par de
PDXYDLVHVJHVWLRQVSROLWLTXHVORFDOHVHWLQWHUQDWLRQDOHV6LQRXV
1

65% au Canada, 70% en Europe (qui compte environ neuf millions


dentreprises), 84% en Suisse (dans ce pays, 99.7% des entreprises emploient
moins de 250 collaborateurs et 85% moins de dix).

/HV WDX[ GH FK{PDJH VRQW VRXYHQW WUqV GLIFLOHV j HVWLPHU GDQV OHV SD\V
dAfrique car les critres et les statistiques pour estimer les populations actives
font dfauts. En Rpublique Dmocratique du Congo, certains estiment le taux
40%, celui-ci pouvant, suivant les rgions, monter 85%, voire 95% si lon
prend les chiffres de la Banque Mondiale. Pour le Burkina Faso : 77% et pour
OH&DPHURXQj1RWRQVHQQTXHOHVWDX[GXFK{PDJHQHVRQWSDVOHVVHXOV
indicateurs des problmes de lconomie. 57,7% des Africains vivant dans les
pays subsahariens vivent avec moins dun dollar par jour, et 87,1% avec moins
de deux dollars.

178

Travail

Choisis la vie...

QDYRQVSDVGHWUDYDLOFHVWODIDXWHjQRWUHJRXYHUQHPHQW/HV
dirigeants doivent dvelopper notre rgion et crer des postes de
WUDYDLO6LQRXVVRPPHVXQSD\VSDXYUHFHVWjFDXVHGHV
SD\VULFKHVTXLQRXVH[SORLWHQW&HVWSDUFHTXHOHVEDLOOHXUV
LQWHUQDWLRQDX[QHGRQQHQWSDVDVVH]TXHQRXVQDYRQVULHQ
lexemple de ces rcriminations, beaucoup de personnes
considrent que la responsabilit de lchec conomique se situe
une chelle suprieure ou lextrieur de leurs frontires. Certes,
les contraintes conomiques internationales exercent de trs fortes
pressions sur les peuples. Cependant, ces aspects ne sont pas les
VHXOVjLQXHQFHUOHGpYHORSSHPHQWpFRQRPLTXHHWFHUWDLQVSD\V
VHGpYHORSSHQWHWSURWHQWGHVpFKDQJHVFRPPHUFLDX[DORUVTXH
dautres sont constamment la trane, malgr toutes les aides
internationales.
O se situe le cur du problme ?
Est-il lchelle internationale ou dans les structures et modes de
fonctionnement du pays ?
Lorsquon tudie ces questions, lon est rapidement confronts
une loi conomique universelle : les pays les plus pauvres sont
ceux o la cupidit et la corruption sont les plus actives.
/RUVTXHOHVGLIFXOWpVHWOHGpFLWGHYDOHXUVPRUDOHVSHUYHUWLVVHQW
la vision du travail, celui-ci nest plus peru comme un outil crer
des richesses communes, mais un moyen dobtenir des privilges
SHUVRQQHOV&HWWHYLVLRQFXSLGHFRQGXLWOHVHPSOR\pVjSURWHUGH
leur position professionnelle pour obtenir des avantages ou voler.
Cette mentalit touche toutes les couches sociales et, lorsque
la situation se dgrade totalement, il nest mme plus possible
GH IDLUH FRQDQFH j VHV DPLV RX j GHV PHPEUHV GH VD IDPLOOH
Ceux-ci nhsiteront pas, le cas chant, voler de largent ou du
matriel pour leurs besoins personnels. Dans un tel contexte, il est
impossible de sassocier et de crer des entreprises denvergure,
FDU LO VXIW TXH OXQ GHV SDUWHQDLUHV VXFFRPEH j OD WHQWDWLRQ HW
dtruise le capital de lentreprise.
La qualit des entreprises est
la mesure de lintgrit des
travailleurs.

179

Travail

Choisis la vie...

LE TRANSFERT DES RICHESSES


CORRUPTION

Transfert partiel

INTGRIT

Transfert de toute la somme

OK

Lconomie repose sur la facult de pouvoir changer les richesses entre les
individus et les entreprises. Lorsque les personnes sont incapables de transporter
de largent sans en voler une part, ils dtruisent les fondements de lconomie.
&HWWHFXSLGLWpVWXSLGHOHVFRQGDPQHjQHMDPDLVSRXYRLUSURVSpUHU

Ainsi, lorsque les ouvriers volent largent ou ne prennent pas


soin des outils qui servent au fonctionnement de lentreprise, la
chane de production sarrte et la machine crer des richesses
est dtruite.
Dans ces conditions, la cration dentreprises est impossible et
cela conduit automatiquement la faillite de lconomie.
$YHFFHGpFLWGHFRQDQFHOHVHXOPR\HQGHVXUYLYUHSDVVHSDU
une structure conomique individuelle ; comme il nest pas possible
GH VDVVRFLHU DYHF GHV SDUWHQDLUHV DEOHV OHV HQWUHSUHQHXUV HQ
VRQWUpGXLWVjFUpHUGHVQDQRHQWUHSULVHV1 dans lesquelles ils
devront assumer toutes les tapes.
1

/H PRW  QDQR  GpQLW XQH GLPHQVLRQ GXQ PLOOLDUGLqPH VRLW LQIpULHXUH j
PLFUR XQPLOOLRQLqPH 

180

Choisis la vie...

Travail

Le cultivateur, par exemple, devra Celui qui aime largent


cultiver, transporter et vendre lui-mme nest pas rassasi par
ses produits pour tre sr den toucher les largent. Ecclsiaste 5.10
EpQpFHV
Comme le soulignent ces propos, la principale barrire la
cration de petites et moyennes entreprises se situe dans la sphre
morale et rsulte de lincapacit travailler ensemble pour un
bien commun.
Lexemple de la banque
2Q SHXW REVHUYHU OD SDUW LQGLVSHQVDEOH GH OD FRQDQFH GDQV OH
fonctionnement dune banque. Contrairement une ide reue,
la banque nest pas forcment propritaire de grandes sommes
dargent et la plupart dentre elles ont commenc avec des
ressources modestes. Le vrai capital de la banque repose sur sa
FDSDFLWpjLQVSLUHUXQVHQWLPHQWGHFRQDQFHTXLSXLVVHFRQGXLUH
OHVFOLHQWVjOXLFRQHUGHODUJHQW
Cette tche nest pas facile car largent est une richesse qui suscite
un grand attachement. Pour cette raison, la tendance humaine
naturelle est de cacher et de garder prcieusement ses richesses.
Les banquier doivent donc convaincre les clients de lcher leurs
SUpFLHX[ ELHQV DQ GH OHV FRQHU j OHXU pWDEOLVVHPHQW &HVW OH
SUHPLHUFHUFOHGHFRQDQFHHVVHQWLHOjODFUpDWLRQGXQHEDQTXH
(QHIIHWVLOHEDQTXLHUPDQJHRXYROHODUJHQWTXLOXLHVWFRQp
LOSHUGUDDXVVLW{WVDUHQRPPpHHWSOXVSHUVRQQHQHOXLFRQHUDVHV
richesses.
La banque doit donc tre un lieu de trs grande intgrit et cest
parce que dans le pass cette valeur chrtienne a pntr la
conscience des Suisses que les banques de ce pays sont connues
et apprcies dans le monde entier.1
0DLV OH JUDQG Gp GH OD EDQTXH QHVW SDV VHXOHPHQW GH WURXYHU
GHVSHUVRQQHVTXLOXLFRQHQWGHVIRQGV/RUVTXHODUJHQWDUULYH
HOOHGRLWHQRXWUHWURXYHUOHVPR\HQVGHOHFRQHUjGHVSHUVRQQHV
TXLOHIHURQWIUXFWLHU&HGHX[LqPHFHUFOHGHFRQDQFHTXLGRLW
1

/DFULVHHWOHVVFDQGDOHVQDQFLHUVGHODQQpHRQWPLVHQOXPLqUHTXHFHV
valeurs dintgrit ntaient plus autant prsentes. Cela a fortement entam le
FDSLWDOFRQDQFHGHJUDQGHVEDQTXHVVXLVVHVHWFRQGXLWGHQRPEUHX[FOLHQWVj
retirer leur argent.

181

Travail

Choisis la vie...

se crer envers ceux qui elle prte les richesses est essentiel.
Si celui qui a reu de largent de la banque pour mener un projet
nest pas comptent, ou sil vole, la banque perd largent qui lui
HVWFRQpHWWRXWVpFURXOH

LE FONCTIONNEMENT DE LA BANQUE

Prts

Emprunteurs

Reoit

Donne

Intrts

Bnfices

Prts

Prteurs

Boucles de confiance
Le fonctionnement dune banque repose sur sa capacit prendre soin des
ULFKHVVHVTXLOXLVRQWFRQpHVHWVXUOLQWpJULWpHWOHVpULHX[GHVHVSDUWHQDLUHV6L
OXQHGHFHVGHX[ERXFOHVGHFRQDQFHVHEULVHODEDQTXHHVWSHUGXH

/HV GHX[  ERXFOHV GH FRQDQFH  VRQW HVVHQWLHOOHV DX ERQ


fonctionnement dune banque. Lexistence et la sant des banques
GpSHQGHQW GRQF IRQGDPHQWDOHPHQW GX QLYHDX GH FRQDQFH TXL
peut sexercer dans un pays. Si les habitants agissent avec respect
et intgrit, la banque peut jouer son rle de plaque dchange
GHOD YDOHXU WUDYDLO PDLV VLOHVKRPPHVQHVRQWSDV DEOHV
tout scroule et les entreprises ou les familles ne trouvent pas de
soutien pour des investissements.
Lanalyse du tissu conomique permet de mettre en vidence le
GHJUp GH FRQDQFH HW OHV YDOHXUV PRUDOHV TXL VRQW HQ YLJXHXU
dans une population. Si ce degr est bas, lconomie est malade
alors que, lorsquil slve, le dveloppement et lconomie
peuvent progresser. Beaucoup de discours politiques prtendent
rsoudre les problmes conomiques par des plans de relance,
des redistributions des richesses, etc. Pourtant, toutes ces choses
sont fragiles et illusoires lorsquon oublie que lconomie et la
cration de richesses dun pays dpendent des valeurs qui habitent
les individus.

182

Travail

Choisis la vie...

RELIGIONS ET DVELOPPEMENT

CAPACIT DE DVELOPPEMENT

Judo-chrtiennes

Bible: Dieu au-dessus de la cration


Dieu pourvoir au Salut (grce)...

Confucennes

Sagesse, connaissances, comptences...

Musulmanes

Coran: Confessions, prires, jene,


plerinages, aumnes, guerre...

1. Juifs
2. Protestants
3. Catholiques
4. Orthodoxes

-3x
-8x
- 14 x

Bouddhistes

Rincarnation, dtachement matriel,


fusion du corps...

Hindoues

Plusieurs dieux, rincarnations, castes,


animaux sacrs, offrandes...

- 20 - 30 x

Animistes

Cultes des anctres, superstitions


mythologies, magies, sorcelleries...

Ce tableau illustre le facteur de richesse produite par les diffrentes religions ;


il est tir dune tude ralise par deux chercheurs concernant les liens entre
les religions et le dveloppement.1 Dans cette analyse, limpact de la religion
a t mesur en tenant compte du potentiel gographique. Ainsi, lvaluation
des performances a t ralise en comparant des groupes religieux habitants
sous les mmes latitudes ou avec le mme potentiel de dveloppement.

Le classement des meilleurs producteurs de richesses est proportionnel la
pntration des valeurs bibliques. Les Juifs et les protestants sont les plus
performants, ils sont suivis par les catholiques et les orthodoxes (qui sont
PRLQVLQXHQFpVSDUOHWH[WHELEOLTXH (QPR\HQQHXQPXVXOPDQSURGXLW
fois moins de richesse quun juif, et un animiste 20 30 fois moins. Notons
ce propos que les Juifs sont aussi ceux qui ont obtenu le plus de prix Nobel
par habitant, soit soixante fois de plus que la moyenne mondiale.
noter que les religions confucennes (prsentes en Asie) sont aussi trs
fortes dans le dveloppement car elles favorisent les ambitions de la socit.
Les performances conomiques se font toutefois souvent au mpris des
droits individuels.
1

Couplet Xavier, Heuchenne Daniel, Religions et dveloppement, 1998, conomica,


Paris, France.

183

Travail

Choisis la vie...

Le besoin dintgrit
&HV GLYHUVHV UpH[LRQV VXU OH WUDYDLO HW OpFRQRPLH VRXOLJQHQW
combien les dveloppements conomiques et sociaux dpendent
des valeurs morales et que la prosprit ne peut simplanter dans
un terrain corrompu.
&HWWH GpPRQVWUDWLRQ HVW DJUDQWH GDQV OHV SD\V TXL SHUGHQW OH
VHQV GH OLQWpJULWp  OHV HQWUHSULVHV VH IUDJLOLVHQW HW QLVVHQW SDU
GLVSDUDvWUH8QHIRLVTXHOHWLVVXGHFRQDQFHDpWpGpWUXLWLOHVWWUqV
GLIFLOHGHUHPRQWHUODSHQWHFDUODSOXSDUWGHVSHUVRQQHVMXVWLHQW
OHXU FRUUXSWLRQ HQ LQYRTXDQW OHV SUREOqPHV pFRQRPLTXHV   -H
suis corrompu, car tout le monde lest et je ne pourrai pas survivre
DXWUHPHQW
Avec ce type dattitude, lconomie du pays senfonce encore
SOXVGDQVODSDXYUHWp&HUWHVLOHVWWUqVGLIFLOHGpFKDSSHUjOD
corruption, et lon peut comprendre que certains soient obligs de
travailler selon un systme fond sur le vol et les privilges. Par
exemple, un policier qui nest pas pay par ltat pourra tre forc
de se servir en volant la population. Mais en le faisant ne dtruit-il
pas le sens mme de sa fonction ?
Lobjectif de la CHARTE+ est dinviter les chrtiens porter les
valeurs de lvangile dans le travail. Par leur combat vivre dans
lintgrit, ils peuvent progressivement apporter une bndiction
sur lespace conomique de leur rgion.
La juste comprhension des principes bibliques peut aussi les aider
fonder des entreprises srieuses. Le rseau de la CHARTE+ peut
DLQVLGHYHQLUXQHVSDFHGHFRQDQFHSULYLOpJLpSRXUOHVKRPPHV
daffaires chrtiens.
Pour remonter la pente et dvelopper lconomie, il faut sopposer
j WRXWHV OHV IRUPHV GDEXV TXL GpWUXLVHQW OD FRQDQFH &HVW
seulement en appliquant et en dveloppant lintgrit des hommes
quun pays peut construire une conomie qui apporte la prosprit.
Celui qui veut senrichir par tous les moyens entrane sa
famille dans le malheur, mais celui qui dteste la corruption
vivra longtemps Proverbes 15.27*

184

Choisis la vie...

Travail

Dfinition de lintgrit
/HPRWLQWpJULWpYLHQWGXWHUPHODWLQLQWHJULWDVTXLVLJQLHQHSDV
rWUHFRUURPSX,OSHXWVDSSOLTXHUSRXUGpQLUXQHFKRVHTXLHVWUHVWpH
intacte, entire, et qui na pas t altre : lintgrit dune uvre dart,
OLQWpJULWp GXQ WHUULWRLUH &HVW OLQYHUVH GH  OKRPPH SDUWDJp  GRQW
SDUOHODS{WUH-DFTXHVGDQVOHSUHPLHUFKDSLWUHGHVDOHWWUHRXGHOLO
SDUWDJp PDODGH GRQWSDUOH-pVXVGDQV0DWWKLHX
/D FRUUXSWLRQ VLJQLH  XQ pWDW GH SRXUULVVHPHQW GH GpFRPSRVLWLRQ 
Un homme corrompu mprise sa dignit. Comme de lacier rouill, il se
laisse manger par la cupidit et perd ainsi une part de lui-mme.

Les attitudes dun homme intgre


Tenir sa parole et ses engagements.
Respecter ses collaborateurs, ses employs ou ses chefs.
Venir lheure, tre prcis dans son travail et tenir les dlais.
tre exigeant envers son travail et viser la qualit.
Prendre soins des outils et des investissements.
Garder le bien dautrui, savoir grer un prt et le rendre
son terme.
Transporter une somme dargent sans y toucher.
Ne pas mentir ou dissimuler une fraude.

Comme le montrent ces caractristiques, lintgrit est un


fondement essentiel lentreprise. Pour tre une personne de
FRQDQFHLOVDJLWGDVVXPHUDYHFH[FHOOHQFHVHVUHVSRQVDELOLWpV
Dans le cadre professionnel, lintgrit donne une conscience
du bien commun et du travail bien fait. Grce elle, lentreprise
chappe la passivit et aux malversations en offrant des services
ou des produits de qualit. Une entreprise construite avec des
hommes intgres satisfait ses clients par le srieux de son travail
et sa renomme grandit :
6R\H]GDQVODMRLHSHUIHFWLRQQH]YRXVFRQVROH]YRXVD\H]XQ
mme sentiment, vivez en paix ; et le Dieu damour et de paix
sera avec vous. 2 Corinthiens 13.11

185

Travail

Choisis la vie...

Des principes universels


/DORLGHODSHVDQWHXUVDSSOLTXHGDQVWRXWOXQLYHUVFHODVLJQLHTXHVL
je saute dune falaise en Asie, en Afrique ou en Europe, je vais tomber et
me faire mal. Comme la loi sapplique lensemble de la Terre, il ny a
pas dendroit o je peux chapper aux forces inscrites dans la cration.
Il en est de mme pour les lois divines qui concernent la vie personnelle
et sociale.
Lorsque Dieu nous invite ne pas voler notre prochain, il le dit parce
quil sait que le fait de voler est le moyen le plus sr de dtruire la socits
et lconomie dun pays.
Ne pas aimer et ne pas respecter les droits de son prochain nous exposent
collectivement subir un processus de chute et de destruction.
linverse, la mise en pratique des lois de Dieu conduit forcment la
bndiction. Par ces lois divines, nous sommes face la vie ou la mort.
Cest pourquoi Dieu nous dit :
&KRLVLVODYLHDQTXHWXYLYHVDeutronome 30.19

Pour approfondir le thme du travail...


1RWUHFDSDFLWpjFUpHUGHVULFKHVVHVLQXHQFHGLUHFWHPHQWQRWUH
qualit de vie et le dveloppement social. Ces enjeux conomiques
ainsi que les aspects thoriques et pratiques de lentrepreneuriat
sont abords plus en dtail dans le livre $LGHFRQVHLOFUpHUHW
grer une entreprise . Voir les informations la page 238.

*****

Voici toutes les bndictions qui se rpandront sur toi et qui


seront ton partage, lorsque tu obiras la voix de lternel,
WRQ'LHXWXVHUDVEpQLGDQVODYLOOHHWWXVHUDVEpQLGDQVOHV
champs. Le fruit de tes entrailles, le fruit de ton sol, le fruit de tes
troupeaux, les portes de ton gros et de ton menu btail, toutes
ces choses seront bnies. Ta corbeille et ta huche seront bnies.
() Lternel ordonnera la bndiction dtre avec toi dans
tes greniers et dans toutes tes entreprises. Il te bnira dans le
pays que lternel, ton Dieu, te donne. Deutronome 28.2-8
/DYpULWDEOHLQXHQFHGHOD%LEOHQHSHXWrWUHPHVXUpHHOOHHVW
reconnue seulement en termes de curs qui ont t encourags,
de dcisions qui ont t changes, dhommes et de femmes qui,
en rponse ses demandes impntrables, ont rendu justice,
aim la bont et march humblement avec Dieu. J. Carter Swain

186

Choisis la vie...

Travail

Exercer un travail dans les services de sant


La maladie, la faim, les accidents et la souffrance sont de terribles
pDX[TXLWURXEOHQWOHPRQGH/RUVTXLOVIUDSSHQWODYLHEDVFXOHHW
mme lhomme le plus solide se retrouve gmissant et dmuni.
Lorsque nous parlons de la sant, il est bien de se rappeler que
chaque personne a commenc sa vie dans une condition de grande
fragilit et de dpendance. Dj en tant que nouveau-ns il a
fallu que dautres personnes nous prennent en charge. Ensuite,
avec lenfance, nous avons d affronter diverses maladies ou des
accidents.
lautre extrmit de la vie, la vieillesse est aussi une priode
ULVTXpH  OH FRUSV VDIIDLEOLW HW OHIFDFLWp GHV IRQFWLRQV YLWDOHV
diminue, lhomme devient une proie facile pour les dgnrescen-
ces et les maladies.
Ainsi, telle une frontire mouvante, la souffrance ondule prs
de nous et chacun peut tre happ par un accident ou par une
maladie. Ceux qui se portent bien ne doivent donc jamais oublier
que leur bonne sant est un privilge prcieux et fragile et quils
peuvent leur tour basculer dans une condition de souffrance et
de dpendance.
Malheureusement, lorsque nous sommes en bonne sant, nous
oublions facilement combien la souffrance rend la vie terrible :
OpWDXRSSUHVVDQWGHVGRXOHXUVLQWHQVHVOHVqYUHVODUHVSLUDWLRQ
haletante et le sentiment dtouffer, lincapacit de se nourrir et de
se laver, la faiblesse, les pertes de connaissance, les angoisses, les
handicaps lis la perte dune main, dune jambe, de la vue
Lorsque ces choses arrivent, les appuis et les scurits se drobent
et lhomme plonge dans un tragique dnuement ; incapable
de survenir ses besoins vitaux, il est dsormais rduit ltat de
mendiant et suspendu au bon vouloir de ceux qui lentourent.
Cette terrible dpendance du souffrant envers son entourage est
un aspect rvlateur qui met en lumire la nature des liens tisss
entre les hommes.
187

Travail

Choisis la vie...

Ainsi, dans un contexte goste, le bien portant qui ne ressent


pas la souffrance refusera de prter assistance au malheureux
qui a besoin de lui. Par cette attitude, il fera la dmonstration de
labsence de lien entre sa vie et celle de son prochain.
linverse, celui qui prte assistance au malheureux fait la d-
monstration que des attaches invisibles lunissent son prochain.
Ainsi, sans lavoir cherch, le souffrant va mettre en lumire les
valeurs morales qui habitent son entourage.
Cest pour illustrer ce rle rvlateur du souffrant que le Christ
raconte la clbre histoire du bon Samaritain.1 Cette histoire sym-
bolique napparat pas sans raison. Elle fait suite une question
pose par un docteur de la loi :
0DvWUHTXHGRLVMHIDLUHSRXUKpULWHUODYLHpWHUQHOOH"

Face cette question essentielle, Jsus renverse la question et


demande lhomme ce quil a dcouvert dans son tude de la
Bible. Le religieux contraint de rpondre sa propre question
donne ce commandement :
Tu aimeras le Seigneur, ton Dieu, de tout ton cur, de toute
ton me, de toute ta force, et de toute ta pense ; et ton prochain
FRPPHWRLPrPH

Que dire de plus ? Ces paroles rsument admirablement la rv-


lation biblique ; Jsus invite donc son interlocuteur mettre ce
commandement en pratique Fais cela et tu vivras (tu auras
la vie ternelle).
Mais le docteur de la loi, pris au pige par ses paroles, essaie de se
MXVWLHUHWGHPDQGH4XLHVWPRQSURFKDLQ"
Cest dans ce contexte que Jsus met en scne lhistoire dun
homme bless qui agonise au bord dun chemin. En prenant
lexemple de ce souffrant, bless et dpouill, Jsus dcrit la
condition de lhomme suspendu au bon vouloir des autres.
Le destin de cet inconnu qui na plus rien offrir est entirement
VXVSHQGXDXIDLWGrWUHOHSURFKDLQFHFHX[TXLSDVVHURQWSUqV
de lui.
1

Luc 10.25-37.

188

Choisis la vie...

Travail

Dans son rcit, Jsus fait passer trois hommes, soit deux Juifs et
un Samaritain. Les Samaritains ntaient pas des Juifs de souche,
PDLVGHVGpSRUWpVTXLDYDLHQWpWpIRUFpVGHVpWDEOLUHQ,VUDsO$XO
du temps, ils staient convertis partiellement au judasme. Ainsi,
ces trois passants sont des croyants et partagent un point commun
essentiel : ils connaissent, tous les trois, linvitation de lcriture
aimer Dieu et son prochain. Le troisime ntait sans doute pas le
champion de la thorie, car la thologie des Samaritains tait loin
dtre parfaite. Cependant, cet homme est le seul qui va accomplir
le commandement divin et prter assistance son prochain.
En loccurrence, il faut se rappeler que lenjeu du propos est de
GpQLUTXLHVWOHSURFKDLQHWTXHFHWWHKLVWRLUHFKHUFKHjUpSRQGUH
une question sur la vie ternelle. Il ne sagit donc pas dun
simple exemple de premiers secours, mais dun message fonda-
mental sur notre manire de faire la volont de Dieu. Et, dans ce
domaine, lattitude que nous avons envers ceux qui ont besoin de
notre assistance parle plus que tous les sermons, lenjeu concerne
la vie ternelle ! Cest ce que Jsus souligne lorsquil parle du
grand jugement des nations.1
Lorsque le Fils de lhomme viendra dans sa gloire, avec tous
les anges, il sassira sur le trne de sa gloire. Toutes les nations
seront assembles devant lui. Matthieu 25.31-32

Selon ce passage biblique, un jour viendra o tous les peuples de


la Terre seront convoqus pour paratre devant leur Crateur. Lors
de cet vnement tonnant, toutes les anciennes barrires seront
bannies et il ne sera plus question de sexes, de races, de pays,
de langues ou de priode de lHistoire. Toutes ces particularits
VHIIDFHURQWGHYDQWOHQMHXVROHQQHOGHFHMXJHPHQWTXLGpQLUD
la nouvelle et dcisive frontire sparant pour toujours les morts
des vivants.
1

Comme lindique Jsus dans le chapitre prcdent (Matthieu 24.37), le dluge


qui est arriv au temps de No ou la destruction de Sodome au temps de Lot
/XF   VRQW GHV SUpJXUDWLRQV GX MXJHPHQW GHUQLHU DQQRQFp GDQV GH
nombreux textes bibliques. Notons ce propos que, dans ces deux cas, le
jugement exerce une sparation entre ceux qui tombent dans la mort et ceux
qui reoivent la vie. Ci-aprs, quelques rfrences bibliques sur le jugement
(appel aussi le jour du Seigneur) : sae 13.6-9, Jrmie 46.10, Malachie 4.5,
Psaume 50.1-6, 2 Pierre 3.10-14, 1 Timothe 5.2, Apocalypse 20.11-15, etc.

189

Travail

Choisis la vie...

Qui sera pris, qui sera cart lors de ce jour qui verra saccomplir le
jugement annonc depuis longtemps dans la rvlation biblique ?
Selon la vision donne par Jsus, les critres appliqus par Dieu
lors de cette grande slection ne sappuient pas sur des perfor-
mances religieuses. Ainsi, les hommes ne seront pas jugs selon
leur connaissance biblique, le nombre de prires, les louanges, ou
selon la quantit de travail accompli.
La trame sous-jacente au jugement est construite tout entire sur
une dimension relationnelle. Pourrait-il en tre autrement ? Dieu
est amour1 et il est donc logique que les exigences qui sappliquent
la frontire de son Royaume soient celles de lAmour.
Ainsi, le jour du jugement apporte un clairage important sur la
ncessit dappliquer les commandements qui nous invitent
aimer Dieu et notre prochain. Comme le souligne la Bible, cest
la lumire de ces commandements que nous serons prouvs.
Car jai eu faim, et vous mavez donn manger ; jai eu soif,
et vous mavez donn boire ; jtais tranger, et vous mavez
recueilli ; jtais nu, et vous mavez vtu ; jtais malade, et
vous mavez rendu visite ; jtais en prison, et vous tes venus
vers moi. Matthieu 25.35-36

Ltude attentive de ces paroles permet de dcouvrir que les deux


facettes du commandement sont runies dans le jtais . Ainsi,
par cette parole il nest plus question de faire la distinction entre
Dieu et le prochain, car les deux sont dpendants.2
(WOHURLOHXUUpSRQGUD-HYRXVOHGLVHQYpULWpWRXWHVOHVIRLV
que vous avez fait ces choses lun de ces plus petits de mes
frres, cest moi que vous les avez faites. Matthieu 25.40

Cette vision apporte un merveilleux clairage sur la capacit unique


de lamour. Le vrai amour pour le prochain est une expression
1

Celui qui naime pas na pas connu Dieu, car Dieu est amour. 1 Jean 4.8.

Notons aussi que cette unit entre lamour de Dieu et du prochain rend absurde
le fait de prtendre aimer son prochain et de refuser lamour du Christ qui sest
donn aux hommes. Celui qui aime vraiment devrait forcment accueillir le
Dieu damour dans sa vie. Il faut toutefois pour cela que lvangile qui lui
est prsent tmoigne rellement de cette nature aimante de Dieu, ce qui nest
malheureusement pas souvent le cas.

190

Choisis la vie...

Travail

de lamour divin. Ainsi, tout acte de bont pour un pauvre et un


malheureux est aussi un cadeau pour Dieu ; les deux sont unis
dans lamour.
Cest dans cette vision que laide aux pauvres et les soins aux
malades ont pris une place fondamentale dans lapplication de
lvangile.
vangile et services de sant
Comme latteste le livre des Actes, les premires communauts se
sont construites en cherchant appliquer concrtement lamour
du Christ leur entourage. Cest ainsi que lglise primitive de
Jrusalem va sillustrer par un partage des ressources qui permet
doffrir une assistance aux veuves et aux dmunis.1
Dans ce travail, les aptres jouent une place importante et ils
taient eux-mmes impliqus pour servir les malheureux.2
Au vu de la description donne par la Bible, il est certain que
les pasteurs en costume-cravate ne correspondent pas au modle
donn par les aptres du Christ servant aux tables et prenants
soins des malheureux de Jrusalem. Ce travail dassistance prend
une place considrable dans la premire glise et ncessitera de
nommer des serviteurs supplmentaires.3
Ainsi, des ministres dvanglistes impressionnants tels que celui
dtienne ou de Philippe ont t consacrs avec une fonction de
serviteur et pour rpondre aux besoins des dmunis.

Ce devoir dassistance aux pauvres sera lun des seuls


commandements qui seront imposs aux nouvelles glises.
Ils nous recommandrent seulement de nous souvenir des
pauvres, ce que jai eu bien soin de faire. Galates 2.10

Ces principes indissociables de lvangile vont conduire les


glises sinvestir dans laccueil des pauvres et dans les soins aux
malades.
Dans lEmpire romain du 1er sicle, lempereur tait consid-
r comme un dieu et les valeurs sociales taient fondes sur le
1

Voir Acte 2.33-34.

Avec le dveloppement de lglise, cette situation posera mme un problme


aux aptres qui narriveront plus suivre. Voir Actes 6.1-2.

Voir Actes 6.1-5.

191

Travail

Choisis la vie...

statut, la richesse et le pouvoir. Faire souffrir ou mettre mort un


esclave ou un prisonnier taient des pratiques courantes qui ne
choquaient pas. Ainsi, les Romains se distrayaient en allant voir
des spectacles mettant en scne des combats et donnant souvent
lieu des massacres dinnocents. Cest dans cette socit profon-
dment btie sur la violence que les premiers chrtiens auront la
lourde tche dannoncer lvangile. Leur message, dnonant les
prtentions divines de lempereur et les valeurs paennes de lem-
pire, les conduira subir une forte adversit.
Durant plusieurs sicles, les chrtiens seront sauvagement pers-
cuts et des milliers seront torturs et mis mort publiquement.
Mais lvangile est une puissance extraordinaire qui ne peut tre
contenue par la force ; son message touche les populations et
commence gagner le pouvoir politique. En lan 313, lempereur
&RQVWDQWLQVHFRQYHUWLWDXFKULVWLDQLVPHHWPHWQDX[SHUVpFXWLRQV
en proclamant la libert de culte.1
Grce cet appui inattendu, lvangile peut apporter librement
ses valeurs spirituelles et morales dans la socit. Cette conqu-
te conduit une transformation progressive des mentalits et de
la vision de Dieu et du prochain. Cette pntration des valeurs
chrtiennes permettra dimportantes rformes juridiques, dont le
fameux code de Justinien rdig en 529. Ce document important
GpQLW OH QRXYHDX GURLW URPDLQ HQ VDSSX\DQW VXU GHV SULQFLSHV
bibliques. Lgalit et la protection des faibles deviennent des fon-
dements de la justice ; ces nouveaux droits permettent dinstituer
le concept des hpitaux et de rglementer leur fonctionnement.2
$YHFOLQXHQFHFURLVVDQWHGHOeYDQJLOHOHSULQFLSHGHODFKDULWpHW
laccueil des souffrants deviennent des expressions indissociables
dune vie spirituelle conforme la volont de Dieu. Ces valeurs
changent progressivement les valeurs sociales.
Au Moyen ge, lglise construit de nombreux couvents qui ont
pour mission daccueillir les dmunis et dexercer la misricorde
HQYHUVOHVDILJpV
1

Cest lui qui tablit le dimanche comme un jour fri (en 321).

Le code de Justinien est lun des fondements qui permettront de faire natre
le concept des droits de lhomme. Bien que cela soit souvent oubli, ce sont
bien les valeurs issues de la chrtient qui ont permis dintroduire une vision
dgalit et de respect dans les socits.

192

Choisis la vie...

Travail

partir du 11e sicle, lexercice de la charit est considr comme


un devoir qui sapplique aux responsables et aux membres des
glises. Cette vision de servir les malheureux par lamour du
Christ conduit la cration de corporations de moines spcialiss
(Ordre du Saint-Esprit, de Saint Jean de Jrusalem, etc.).
 FHWWH pSRTXH OHV K{SLWDX[ VRQW VRXWHQXV QDQFLqUHPHQW SDU
des dons individuels. Placs sous lautorit dvques, ils font
partie du patrimoine des glises et offrent leurs services dans de
nombreux villages.
Avec le dveloppement des villes, les hpitaux prennent de nou-
velles formes en offrant laccueil aux pauvres et aux malades.
Ces centres de soins sont aussi des centres de recherche et de
VDYRLUTXLVHUYHQWjODIRUPDWLRQGHVPpGHFLQVHWGHVLQUPLqUHV
Ce patrimoine et son fabuleux capital de comptence sont
lorigine de la plupart des instituts et centres de sant moderne.
Comme le souligne ce succinct rsum, lvangile nest pas
juste un message pour le salut spirituel, il est une puissance de
vie qui apporte des valeurs concrtes dans la socit. Grce
VRQLQXHQFHOKRPPHSUHQGFRQVFLHQFHGXOLHQTXLOXQLWjVRQ
prochain, il partage donc sa souffrance.
Ce sentiment de compassion a conduit des millions de croyants
soigner et prendre en charge les malheureux. Cest aussi cette
mme force de lEsprit qui bouleversera de destin dHenri Dunant ;
mu devant la souffrance de soldats agonisants, il consacrera sa
vie aider les malheureux et fondera la Croix-Rouge en 1863.1
Aujourdhui, beaucoup des personnes impliques dans les services
de sant nont pas conscience que leur travail fait suite la cons-
cration de chrtiens dsirant appliquer lamour du prochain.
Lune des raisons de cet oubli est lie au transfert ltat des ser-
vices de soins qui taient auparavant grs par les glises.
1

Le projet de crer une organisation pour secourir les blesss vient du


VSHFWDFOH WHUULDQW DXTXHO D DVVLVWp OH 6XLVVH +HQUL 'XQDQW DSUqV OD EDWDLOOH
de Solferino en juin 1859. Ses efforts pour crer un service daide aux blesss
de guerre permettront dorganiser une confrence internationale en 1864.
Cette convention, reconnue par 14 pays, accordera limmunit aux personnes
apportant les secours. Le fondateur de la Croix-Rouge recevra le prix Nobel de
la paix en 1901.

193

Travail

Choisis la vie...

Avec cette transition, les hpitaux ne sont plus considrs comme


lexpression des valeurs spirituelles mais selon leur capacit
offrir des services la population. Cette conception laque sac-
compagne aussi de fortes pressions conomiques. Ainsi, avec la
sophistication des soins, le prix des mdicaments, ses nombreux
mtiers, lhpital est devenu un rouage important de la vie cono-
mique.
Le capital commercial des services de soins permet
PDOKHXUHXVHPHQWGHFpGHUjODWHQWDWLRQGXSURW$LQVLGDQVGH
nombreux cas, les soins ports aux malades ne sont plus la priorit
de ltablissement ou des collaborateurs. Le souffrant nest plus
le prochain assister, mais un client prendre en charge contre
rmunration. Cet esprit de cupidit qui considre les souffrants
FRPPH GHV  FRQVRPPDWHXUV  VH[SULPH SDU H[HPSOH GDQV OD
UHFKHUFKHGHEpQpFHVGHVFRPSDJQLHVSKDUPDFHXWLTXHV&RPPH
FHV HQWUHSULVHV FRWpHV HQ %RXUVH YLVHQW j SOXV GH SURWV HOOHV
GpODLVVHQWOHVUHFKHUFKHVVXUGHVPDODGLHVSHXUHQWDEOHVRX[HQW
des prix exorbitants pour leurs produits. Dans ce cas, la maladie
nest plus lennemi combattre, mais la mine dor qui permet de
senrichir.
Ses chefs (...) perdent les mes pour assouvir leur cupidit.
zchiel 22.27

Ceux qui veulent senrichir tombent dans la tentation, dans


le pige, et dans beaucoup de dsirs insenss et pernicieux qui
plongent les hommes dans la ruine et la perdition. Car lamour
GHODUJHQWHVWXQHUDFLQHGHWRXVOHVPDX[HWTXHOTXHVXQVHQ
pWDQWSRVVpGpVVHVRQWpJDUpVORLQGHODIRLHWVHVRQWMHWpVHX[
mmes dans bien des tourments. 1 Timothe 6.9-10

Cette sournoise idologie touche malheureusement aussi le


personnel soignant et certains mdecins ou employs dhpitaux
mettent leur priorit dans le salaire quils retirent.
La ville de Kinshasa a t le thtre de cette funeste cupidit
lorsquune femme sur le point daccoucher et prsentant des
complications a t amene dans une clinique.
Comme la femme navait pas de quoi payer, personne ne voulait
lassister. Les supplications de la souffrante nont ouvert ni le
194

Choisis la vie...

Travail

FXU GX SHUVRQQHO QL OD SRUWH GH OD FOLQLTXH HW OD IHPPH D QL
par mourir dans la cour. Le comble de cette histoire est que sur la
porte de ltablissement, cr auparavant par des missionnaires,
tait encore crites ces paroles :
Venez moi, vous tous qui tes fatigus et chargs, et je vous
donnerai du repos. Matthieu 11.28

Cette tragique histoire nest malheureusement pas un cas unique


et, lors de mes voyages avec lassociation ENTRAID, jai eu la
triste surprise de dcouvrir que certains tablissements hospitaliers
DSSOLTXDLHQW OLPSODFDEOH ORL GX SURW VXU OHXUV SDWLHQWV /H
comble de cette cupidit tant sans doute atteinte par les hpitaux
dans lesquels de jeunes mamans, ayant accouch et ne pouvant
rgler la facture, sont emprisonnes jusqu ce quelles trouvent
de quoi payer. Ces mres, qui ont dj souffert pour donner la
vie, se retrouvent spares de leur famille et certaines y restent
plusieurs annes !1
Ces exemples accablants permettent de mesurer la duret qui
sinstalle dans le cur des hommes quand ils perdent le contact
avec les valeurs divines. Ainsi, la recherche de la gloire, du pouvoir
RX GX SURW FRQGXLW LQH[RUDEOHPHQW j GpWUXLUH OLQGLVSHQVDEOH
amour du prochain.
Face ces drives, lengagement de la CHARTE+ invite les
chrtiens qui travaillent dans les services de sant considrer
leur profession selon le mandat dassistance que Dieu a donn
lglise.
Celui qui soigne et assiste son prochain avec amour est un serviteur
de Dieu au mme titre quun pasteur ou quun vangliste.2
Le travail dans un service de sant est donc particulirement
honorable et prcieux et le chrtien y a une mission essentielle de
tmoin de lamour de Dieu.
1

Soulignons la stupidit de ces mesures car les femmes ainsi retenues continuent
doccuper des lits et donc dengendrer des frais.

La parabole du bon Samaritain dmontre que la vraie spiritualit ne se mesure


pas la qualit des prdications, de la thologie ou une fonction mais notre
manire daimer et de servir ceux qui nous entourent. Lassistance aux malades
et aux personnes dmunies nest donc pas rserve ceux qui exercent une
profession mdicale.

195

Travail

Choisis la vie...

Quelques pistespour le travail dans les services de sant

Montrer de la disponibilit pour les souffrants et ne pas tre


SULVSDUGHVUDLVRQQHPHQWVFDOFXODWHXUVVXUOHSURWjWLUHU
des consultations, des traitements ou des soins.
Toujours considrer le patient comme une personne de
valeur qui mrite le respect et la dignit.
Rsister dans la mesure du possible aux systmes de soins
qui sappuient sur la cupidit, la corruption et lexploitation
des souffrants.
Ne pas tre absorb par le titre ou le prestige du souffrant,
soigner le pauvre ou le riche de la mme manire.
En tant que mdecin, il est important de ne pas se sentir
suprieur et de collaborer harmonieusement avec les autres
soignants.
Grer les services avec intelligence en visant un quilibre
HQWUHODYRFDWLRQGDLGHUHWOHVEHVRLQVQDQFLHUVHWPDWp-
riels ncessaires la marche de ltablissement.
Garder lesprit que lon ne peut pas prendre en charge
tous les problmes et la souffrance du monde. La priorit
est de bien faire ce que lon peut faire sans se laisser
dtruire par la pression des besoins. Prendre du temps pour
VHUHVVRXUFHUHWUppFKLUHVWLQGLVSHQVDEOHSRXUSUHQGUHOHV
bonnes dcisions et pour dispenser des soins de qualit.
Ne pas se laisser gagner par lhabitude de la souffrance et
chercher discerner la prsence du Christ dans celui qui a
besoin de soins.

196

Travail

Choisis la vie...

Citations bibliques: le travail


0LHX[YDXWrWUHGHFRQGLWLRQPRGHVWHHWVXIUHjVHVEHVRLQVTXHGH
faire lhomme important et navoir rien manger. Proverbes 12.9*
Dans la demeure de lhomme sage, on trouve de prcieux trsors
et des rserves dhuile, mais linsens dilapide tout ce quil gagne.
Proverbes 21.20*

Ceux qui travaillent dur sassurent la direction des affaires, mais les
nonchalants resteront tributaires des autres Proverbes 12.24*
Une prvoyance active mne labondance, mais agir avec
prcipitation cest courir vers le dnuement. Proverbes 21.5*
&RQQDLVVH]YRXVXQKRPPHKDELOHGDQVFHTXLOIDLW",OQHUHVWHUDSDV
parmi les gens obscurs, mais il entrera au service des rois. Proverbes 22.29*
Se relcher dans son travail, cest se dclarer frre de celui qui
dtruit. Proverbes 18.9*
La main paresseuse appauvrit, mais le bras actif enrichit. Proverbes 10.4*
Celui qui travaille sa terre aura du pain en abondance, mais qui court
aprs des futilits sera rassasi de misre. Proverbes 28.19*
$VVXUHWRLXQWUDYDLODXGHKRUVDSSOLTXHWRLjPHWWUHWHVFKDPSVHQ
bon tat. Aprs cela tu pourras btir ta maison. Proverbes 24.27*
Celui qui opprime le pauvre pour raliser un gain et fait des cadeaux
DX[ULFKHVQLUDGDQVODSDXYUHWp Proverbes 22.16*
Les biens mal acquis ne donnent pas de vrai bonheur, mais vivre selon
la justice sauve de la mort. Proverbes 10.2*
Nous vous exhortons, frres, abonder toujours plus dans cet amour
et mettre votre honneur vivre tranquilles, vous occuper de vos
propres affaires, et travailler de vos mains, comme nous vous lavons
recommand, en sorte que vous vous conduisiez honntement envers ceux
du dehors, et que vous nayez besoin de personne. 1 Thessaloniciens 4.10-12
Que celui qui drobait ne drobe plus ; mais plutt quil travaille, en
faisant de ses mains ce qui est bien, pour avoir de quoi donner celui
qui est dans le besoin. phsiens 4.28
Les citations des proverbes rfrences avec un astrisque (*) sont des traductions dAlfred Kuen.

197

Travail

Choisis la vie...
Citations bibliques sur lassistance

La religion pure et sans tache, devant Dieu notre Pre, consiste


YLVLWHUOHVRUSKHOLQVHWOHVYHXYHVGDQVOHXUVDILFWLRQVHWjVHSUpVHUYHU
des souillures du monde. Jacques 1.27
Pourvoyez aux besoins des saints. Exercez lhospitalit. Romains 12.13
Persvrez dans lamour fraternel. Noubliez pas lhospitalit ; car en
OH[HUoDQWTXHOTXHVXQVRQWORJpGHVDQJHVVDQVOHVDYRLU6RXYHQH]
vous des prisonniers, comme si vous tiez aussi prisonniers ; de ceux
TXL VRQW PDOWUDLWpV FRPPH pWDQW DXVVL YRXVPrPHV GDQV XQ FRUSV
Hbreux 13.1-3

0HVIUqUHVTXHVHUWLOjTXHOTXXQGHGLUHTXLODODIRLVLOQDSDVOHV
XYUHV"/DIRLSHXWHOOHOHVDXYHU"6LXQIUqUHRXXQHVXUVRQWQXVHW
manquent de la nourriture de chaque jour et que lun dentre vous leur
GLVH$OOH]HQSDL[FKDXIIH]YRXVHWUDVVDVLH]YRXVHWTXHYRXVQHOHXU
GRQQLH]SDVFHTXLHVWQpFHVVDLUHDXFRUSVjTXRLFHODVHUWLO",OHQHVW
DLQVLGHODIRLVLHOOHQDSDVOHVXYUHVHOOHHVWPRUWHHQHOOHPrPH
Jacques 1.14-17

 *XpULVVH] OHV PDODGHV UHVVXVFLWH] OHV PRUWV SXULH] OHV OpSUHX[


FKDVVH]OHVGpPRQV9RXVDYH]UHoXJUDWXLWHPHQWGRQQH]JUDWXLWHPHQW
Matthieu 10.8

 9RLFL OH MHQH DXTXHO MH SUHQGV SODLVLU  GpWDFKH OHV FKDvQHV GH OD
mchancet, dnoue les liens de la servitude, renvoie libres les opprims
et que lon rompe toute espce de joug ; partage ton pain avec celui qui
a faim et fais entrer dans ta maison les malheureux sans asile. Si tu vois
XQKRPPHQXFRXYUHOHHWQHWHGpWRXUQHSDVGHWRQVHPEODEOH$ORUVWD
lumire poindra comme laurore et ta gurison germera promptement ;
ta justice marchera devant toi et la gloire de lternel taccompagnera.
sae 58.6-12

4XHOTXXQSDUPLYRXVHVWLOGDQVODVRXIIUDQFH"4XLOSULH4XHOTXXQ
HVWLOGDQVODMRLH"4XLOFKDQWHGHVFDQWLTXHV4XHOTXXQSDUPLYRXVHVW
LOPDODGH"4XLODSSHOOHOHVDQFLHQVGHOeJOLVHHWTXHOHVDQFLHQVSULHQW
pour lui, en loignant dhuile au nom du Seigneur. Jacques 5.13-17

198

CHOISIS LA VIE...
7. SOCIT
En tant que citoyen(ne), je mengage servir ma rgion et mon
pays de manire contribuer la construction dun tat bti
sur des principes de droits et de devoirs et dans le respect de la
cration.
Dans la mesure de mes possibilits, je mengage servir la
socit en assumant honntement mes responsabilits et selon
un partage collgial du pouvoir.
Si jai une responsabilit dans une fonction dautorit (justice,
police, arme, politique), je mengage appliquer les lois dans
le respect de la dignit humaine.
6L MH GRLV H[HUFHU OD MXVWLFH RX LQWHUYHQLU GDQV GHV FRQLWV MH
mengage agir avec quit, sans parti pris arbitraire et en
respectant un principe de proportionnalit dans lusage de la
force.

Les profits sociaux de lvangile


Dans ma rgion il existe un petit village plac dans un endroit
PHUYHLOOHX[ 6XVSHQGX DX DQ GXQH FROOLQH LO SURWH GXQH
ravissante vue sur un lac : un lieu rellement paradisiaque.
Pourtant, cette belle situation est trompeuse et le village est connu
la ronde pour la mauvaise ambiance qui y rgne. Les habitants se
perscutent les uns les autres. Mdisance, colres, cris, disputes
Beaucoup de personnes pensent que le dveloppement social
dpend des moyens matriels et que les problmes seront rsolus
DYHFGDYDQWDJHGHPR\HQVQDQFLHUV6HORQFHFRQFHSWGDYDQWDJH
dargent serait gal davantage de prosprit.
Une telle vision du dveloppement est une illusion et lon ne
compte plus les checs cuisants de mcnes ou dONG qui, par
bonne volont, ont voulu aider des dmunis en leur donnant
des richesses. Largent et les moyens matriels matriels censs
apporter la solution nont pas rempli leurs promesses et ceux qui
ont reu ces aides les ont dilapides de manire goste ou stupide
et sans tenir compte dun dveloppement long terme.
199

Socit

Choisis la vie...

Le rsultat est pire que la situation initiale ; laide matrielle a


dvelopp la corruption et cass la juste vision du travail. Le
soutien qui aurait d permettre de sortir de la misre a dform les
mentalits et conduit les gens attendre une aide extrieure qui
viendrait les sortir de leurs problmes. Cest une utopie paralysante
et trs propice la pauvret.
Au vu de ce constat, il est vident que les cls du dveloppement
ne reposent pas sur la capacit des richesses ou des ressources
matrielles. On peut ainsi observer que des peuples avec peu de
ressources sont aujourdhui la pointe du dveloppement alors
que dautres qui ont potentiellement de grandes ressources sont
dans la pauvret.
Quelles sont donc les cls qui permettent une socit de progresser
en apportant une relle qualit de vie ses membres ?

Le potentiel de lvangile
Lune des tendances actuelles conduit considrer la foi comme faisant
partie dune dimension prive et intrieure. Dans ces conditions,
lhomme est libre de croire ce quil veut car cela fait partie de ses
convictions intimes. On peut naturellement se rjouir de la libert
de croyance accorde dans la plupart des socits modernes ;
cette libert est bonne (et aussi applique par Dieu qui nous laisse
libres de le suivre). Mais la foi nest pas limite la dimension
LQWLPHHOOHSHXWSURIRQGpPHQWPRGLHUODVRFLpWp
Dans la Bible, la premire raison de lvangile est dapporter la vie
ternelle ; pour cela il touche et transforme le cur des individus.
Cette uvre qui apporte une esprance future vise aussi ce que
la justice et lamour de Dieu descendent parmi les hommes. Cette
ambition sociale de lvangile se manifeste dans le nom de la ville
qui accueillera le Temple des Juifs et o le Christ offrira sa vie :
-pUXVDOHP&HWWHYLOOHGRQWOHQRPVLJQLHIRQGpHVXUODSDL[
est le pivot de la rvlation biblique et se retrouve de manire
symbolique dans les textes de lApocalypse.
Dans la Bible, la cration du monde commence avec un couple
dans un jardin, elle sachve avec la vision dune ville de
paix dans laquelle Dieu rgne.

200

Socit

Choisis la vie...

Dans cette nouvelle Jrusalem, il ny a plus de mal ni de souffrance,


mais on y trouve la paix, lamour et la prsence de Dieu.1

BNDICTION OU MALDICTION ?

HOMMES

Unis Dieu
et aimants
Idoltres
et hassants

PAYS

Prosprit

Dsolation

Choisis la vie... Cette invitation divine prend tout son sens lorsque lon tudie
limpact ngatif de lidoltrie sur les socits. Logiquement, cest dans la
communion avec le Crateur que la cration et lhumanit peuvent spanouir.

Malheureusement, les chrtiens ne saisissent pas toujours ce


projet de Dieu pour la socit et rduisent lvangile une
simple dimension de pit intrieure. Cette vision limite conduit
logiquement les communauts se focaliser sur leur fonctionnement
interne et ne pas avoir dambition pour le changement de leur
environnement, de leur rgion ou de leur pays.
Face ce manque de vision, il faut souligner que la transformation
EpQpTXHGHODVRFLpWpHVWOHSOXVSUpFLHX[PLUDFOHTXHOeYDQJLOH
peut accomplir sur la Terre.
Les miracles, les gurisons ou les dlivrances sont des moyens qui
permettent aux hommes de sortir de la souffrance et des oppressions,
mais ils ne peuvent servir de fondement notre vie quotidienne.

Dans les vangiles, les gurisons et les miracles sont trs prcieux.
Ils sadressent ceux qui doivent saisir la puissance de lvangile.
Lglise doit donc sappuyer sur cette force qui gurit, dlivre et
apporte le salut. Mais la dmonstration de puissance des prodiges
ne constitue pas un but en soi, cest un signe qui conduit un
miracle beaucoup plus grand.
1

Apocalypse 21.

201

Socit

Choisis la vie...

Ce miracle, cest le Royaume de Dieu, cest--dire un espace


plac sous la gouvernance et sous lamour de Dieu. Grce cette
direction divine, le mal est cart et la qualit de vie ainsi que les
relations humaines sont restaures.
Par ce miracle global, Dieu dsire nous offrir une vie de qualit
qui, lexemple du jardin dden, offre un espace de dlice.
Le voleur ne vient que pour drober, gorger et dtruire ; moi,
MHVXLVYHQXDQTXHOHVEUHELVDLHQWODYLHHWTXHOOHVODLHQWHQ
abondance. Jean 10.10

Ces objectifs du Christ pour apporter la vraie vie et labondance


visent carter toute forme doppressions et transformer les
relations et lenvironnement.
Nous demandons souvent Dieu de faire des miracles et nous lui
prsentons nos urgences par des prires de ce style :
 6HLJQHXU GRQQHPRL GX WUDYDLO JXpULV PRQ HQIDQW pYLWHPRL
GHVDFFLGHQWVJDUGHPRLGHODYLROHQFH
Ce genre de prire est lgitime et Dieu peut agir ponctuellement
dans ces domaines, mais lexaucement pour rgler durablement
ces problmes ncessite de construire une socit sur de bons
fondements.
Personne nest une le et comme nous sommes tous ancrs dans
les multiples rseaux de la socit, il est impossible damliorer la
qualit de vie des individus sans toucher au cadre global.
Le chrtien est dans le monde et nchappe pas non plus son
environnement. Si une guerre clate dans sa rgion, il sera lui aussi
touch par la destruction et la violence. De mme si lconomie
est dtruite, il ne trouvera pas de travail, etc.
linverse, si lconomie est bonne il y aura du travail, si
lenvironnement est propre et que les rgles dhygine sont
appliques il y aura moins de maladies, si les gens sont aviss et
prudents sur la route il y aura moins daccidents, etc.
Par consquent, un mode de vie et un environnement qui mvitent
de tomber malade ne sont-ils pas prfrables un chemin de
maladie, dt-il se terminer par une gurison spectaculaire ?
Devant de tels enjeux, le croyant ne doit pas aspirer seulement
des miracles pour changer sa situation, mais dsirer que les
valeurs de lvangile agissent en profondeur et conduisent la
socit sous la bonne gouvernance de Dieu.
202

Choisis la vie...

Socit

Cest le cur de la prire que Jsus enseigne lorsquil nous invite


demander :1
Que ta volont soit faite sur la terre comme au ciel.
Que ton rgne vienne.

Il va de soi que le champ de ces prires ne se limite pas la


dimension spirituelle ou lglise. Ces demandes visent
transformer notre monde en profondeur en invoquant laide de
Dieu dans la construction de la socit.

Lvangile et lorganisation sociale


Dans la nature, ce qui se construit se fait selon une logique
surprenante. Aujourdhui, nous savons par la science que notre
univers gigantesque et insondable est sorti dune microscopique
boule remplie de puissance. Toutes les toiles, le Soleil et la Terre
taient contenus dans ce minuscule espace. Aujourdhui encore,
FHVW GDQV OLQQLPHQW SHWLW TXH VH FDFKHQW OHV IRQGHPHQWV GH
notre monde. Ainsi, ce sont les forces qui habitent les particules
de la matire qui permettent aux choses dexister.
Ces principes sappliquent galement aux espces vivantes qui
commencent sous la forme dune petite cellule ; chaque jour, des
milliards de minuscules semences donnent naissance des arbres
imposants, des plantes et toutes sortes despces animales.
Toute la cration est btie sur le fait que ce ne sont pas les grandes
FKRVHVTXLGpQLVVHQWOHVSHWLWHVPDLVOHVSHWLWHVFKRVHVTXLIRQW
les grandes.
&HUWHV OHV JUDQGHV FKRVHV LQXHQFHQW pJDOHPHQW OHV SHWLWHV HW
la nature est construite sur de savants quilibres entre le grand
et le petit ; dans cette harmonie, lenvironnement joue un rle
dterminant et cest grce un contexte accueillant que les espces
peuvent se dvelopper. Ce qui est petit ne peut donc natre sans
la bienveillance du grand. Pourtant cest bien le petit qui joue le
rle principal.
Dans la Bible, Dieu nous est prsent comme un Dieu humble et
doux qui cache sa puissance dans de petites choses et qui intervient
au travers de ce qui semble faible et mprisable.
1

Voir Matthieu 6.9-13.

203

Socit

Choisis la vie...

Dimensions et dveloppement
Comme le montre ce tableau, cest paradoxalement la conqute du
petit qui permet la conqute des grandes choses !
On peut ainsi observer que lessor des technologies et le
dveloppement industriel dpendent directement des chelles de
longueurs que lhomme arrive matriser.
Dans les socits les plus rudimentaires, la matrise des longueurs
est le centimtre, alors que les pays les plus avancs dans les
recherches travaillent avec des chelles de longueurs plus petites
que le milliardime de mtre.
/D FRQTXrWH GH OLQQLPHQW SHWLW QpFHVVLWH GHV FRPSpWHQFHV
des structures et des investissements toujours plus consquents.
7RXWHIRLV FHVW JUkFH j VD PDvWULVH TXH OH PRQGH SURWH GH
rvolutions dans le domaine des matriaux, des techniques de
communication, de linformatique, de la mdecine, etc.

Units* Dimensions
Prcisions et dveloppement
-2
Centimtre Agriculture, habitations rudimentaires, etc.
10
Roues, techniques et outils sommaires, etc.
10-3 Millimtre
10-4 Dixime de paisseur dune feuille de papier : moteurs
millimtre

vapeur, armes feu, mcanique simple, etc.

10

Centime de
millimtre

7 8 fois plus petits que lpaisseur dun cheveu:


moteur explosion, industrie de prcision, etc.

10-6

Micromtre
Millionime

7 fois plus petit que le diamtre dune cellule


du sang : optique, lectronique, horlogerie,
chimie, etc.

10-9

Nanomtre
Milliardime

Taille molculaire : sciences gntiques, informatiques, etc. (les pistes des processeurs
dordinateurs sont graves ~30 nanomtres).

10-12

Picomtre
Billionime

Taille dun atome de carbone: recherches sur la


matire, physique nuclaire, etc.

10-15

Femto
Billiardime

Taille des particules (la taille du noyau dun


atome est denviron 10 femto). Recherches
fondamentales, physique quantique, etc.

-5

* Ces chiffres avec un exposant font rfrence au mtre (nombre de zros aprs la virgule).

204

Choisis la vie...

Socit

Cette rvlation dun grand Dieu qui travaille avec ce qui apparat
PpSULVDEOH YD FRQWUH OD YLVLRQ  SDwHQQH  TXL GpLH FH TXL HVW
imposant et cherche slever pour rejoindre la puissance divine.
Cest pourquoi, sans lextraordinaire rvlation de lhumilit
de Dieu, lhomme est enferm dans des concepts stupides qui
le conduisent crer des systmes centraliss qui prtendent
rsoudre les problmes de la socit par des jeux de pouvoir.
Pourtant, il est impossible de vouloir dvelopper la cration sans
sappuyer sur les lois et les principes que le Crateur a mis en
SODFH%kWLUVDQVOXLQLWIRUFpPHQWjpOHYHUGHVWRXUVTXLIDXWH
de rels appuis, seffondrent et divisent. Dj dans la Gense les
hommes se sont runis pour construire la tour de Babel avec la
SHQVpHGHVpOHYHUHWGHFUpHUXQFHUFOHGLQXHQFHXQLYHUVHO0DLV
cette arrogante construction cense toucher le Ciel ne montera pas
VLKDXW'LHXQLWSDUGHVFHQGUHHWFHFRORVVDOSURMHWVHWHUPLQH
par une grande faillite.1
Lhistoire de la tour de Babel, qui donnera plus tard naissance la
ville de Babylone, est lexemple typique dune idologie qui pense
DSSRUWHUOHVDOXWDX[SHXSOHVHQEkWLVVDQWXQV\VWqPHGLQXHQFH
et de contrle imprial.
Selon ce concept, cest au sommet de la pyramide quincombe le
droit de changer le destin des familles et des individus. Comme
tout est une question de pouvoirs, il faut centraliser les structures
politiques dun pays pour que les rgions et les villes connaissent
un rel dveloppement.
Ce culte pour un systme de contrle global colle bien lesprit
humain qui se laisse volontiers sduire par le mythe de la grandeur
et par des structures hirarchiques et pyramidales.
Cependant cette vision ne fonctionne pas et tous les systmes
politiques qui se sont construits selon ces principes totalitaires
QLVVHQWGDQVGHWUDJLTXHVIDLOOLWHV
Ainsi, les grands empires qui dsiraient imposer leur mainmise
VXUOHVSHXSOHVRQWQLSDULPSORVHUVHGLVVRXGUHHWODLVVHUOHXU
peuple dans la division et la pauvret.
1

Voir Gense 11.1-9.

205

Socit

Choisis la vie...

Les cercles dinfluences


Limage des cercles permet de comprendre que notre destin
individuel est fortement dpendant de notre entourage ; les cercles
SOXVODUJHVH[HUFHQWGHVLQXHQFHVGpWHUPLQDQWHVVXUOHVFHUFOHV
intrieurs et plus petits, et cela jusqu lchelle mondiale.
Ainsi, les villes, les rgions ou les pays ne sont pas autonomes,
mais dpendent fortement des autres cercles qui les entourent.
LES CERCLES DINFLUENCES

3. Localit

3. Rgion

5
2. Famille

4. Pays
6

1. Individu

6. Monde

La structure sociale de lhumanit est comme un chafaudage dont les tages


sappuient sur les cercles infrieurs et dont la base repose sur les valeurs prsentes
dans lindividu. Si celui-ci est en communion avec Dieu, cela peut clairer sa vie,
sa famille, sa ville, sa rgion, son pays et le monde.

Si lon remonte cette cascade jusqu son point culminant,


RQ WRXFKH DX FHUFOH GH OD JOREDOLVDWLRQ PRQGLDOH TXL PRGLH
OpFRQRPLH HW OD SROLWLTXH GHV FRQWLQHQWV &HV LQXHQFHV QH VH
limitent pas aux pays, mais descendent dans les cercles infrieurs
SRXUQDOHPHQWPRGLHUOHGHVWLQLQGLYLGXHO
(QSULVHDYHFFHVGHX[FRXUDQWVGLQXHQFHLOHVWQpFHVVDLUHGH
respecter le principe divin qui consiste placer la puissance dans
ce qui est humble. Selon cette vision, ce nest pas la socit qui
doit faire lhomme, mais lhomme de faire la socit. Bien sr,
ODVRFLpWpH[HUFHXQHJUDQGHLQXHQFHHWFHVWHOOHTXLGRLWGRQQHU
206

Socit

Choisis la vie...

un cadre, mais ltat nest pas un but en soi. Il est au service


de la population et la qualit de sa gouvernance dpend de son
obissance aux principes donns par le Crateur.
Des proverbes et des citations mditer
Quand une nation nest pas bien gouverne, elle dcline, le salut se
trouve dans le grand nombre de conseillers. Proverbes 11.14*
Un roi qui gouverne selon la justice donne de la stabilit son pays,
mais celui qui multiplie les impts le ruine. Proverbes 29.4*
Mieux vaut avoir peu et respecter Dieu que de possder une grande
fortune avec du tourment. Proverbes 15.16*
Mieux vaut un enfant pauvre et sage quun roi vieux et insens qui
ne sait plus couter les avis. Ecclsiaste 4.13

*****
La moralit de la Bible est, aprs tout, la scurit de la socit.
Francis Cassette Monfort

 7RXW OHVSRLU GH SURJUqV KXPDLQ UHSRVH VXU OLQXHQFH WRXMRXUV


grandissante de la Bible. William Henry Seward, (1801-1872), secrtaire dtat
amricain

Quand vous commencez un mouvement fond sur la Bible, cela


VLJQLHXQHUpYROXWLRQXQHUpYROXWLRQWUDQTXLOOHFRQWUHOHVWpQqEUHV
et le crime. Toyohiko Kagawa (18881960), vangliste japonais et activiste social
 /D %LEOH D WRXMRXUV pWp SHUoXH FRPPH IDLVDQW SDUWLH GH OD ORL
commune dAngleterre. Sir William Blackstone (1723-1780), juriste anglais,
professeur de loi commune Oxford, auteur des Commentaires sur les lois de lAngleterre
TXLRQWHXXQHLQXHQFHFRQVLGpUDEOHVXUOLPSRUWDWLRQHWODGDSWDWLRQGHODORLFRPPXQH
Anglaise aux tats-Unis

Aucune nation nest meilleure que son livre sacr. Dans ce livre,
ses idaux les plus levs sont exprims, et aucune nation ne slve
DXGHVVXV GH FHV LGpDX[ /D QDWLRQ DPpULFDLQH GHSXLV OH SUHPLHU
fort Jamestown jusqu maintenant est fonde et imprgne sur les
principes de la Bible. Plus la Bible entrera dans notre vie nationale,
plus cette vie deviendra grande, pure et meilleure. David Josiah Brewer
(1837-1910), juge la Cour suprme des tats-Unis

207

Socit

Choisis la vie...

Lvangile et la politique
Alors que la mission de lglise est dtendre la royaut du Christ
sur la terre, il est trs important de comprendre la nature de cette
gouvernance et son application parmi les hommes.
Dj lpoque de Jsus, le rapport entre le royaume de Dieu et
les pouvoirs politiques tait une question importante.
Ntait-il pas annonc que Dieu tablirait un jour son Messie pour
conduire les hommes ? Les grands du monde ntaient-ils pas
venus saluer lenfant Jsus, le roi des Juifs dans la crche ?
Alors que le pays tait occup par les Romains, lattente politique
tait trs forte et les vangiles nous informent que de nombreuses
personnes dsiraient que Jsus prenne le pouvoir ; certains ont
mme fait le projet de lenlever de force pour ltablir roi !
%LHQ GHV SHUVRQQHV DXUDLHQW pWp DWWpHV SDU FHV H[KRUWDWLRQV j
prendre les rnes du pays cependant, face ces pressions, Jsus
choisit de se retirer lcart.1
Oui, Jsus est bien un roi et cest avec ce titre que
les soldats le frappent ou quil sera jug par Pilate.2
Jsus recevra une couronne dpines et sera
QDOHPHQWPLVjPRUWDYHFXQHSDQFDUWHLQGLTXDQW
en plusieurs langues :
&HOXLFLHVW-pVXVOHURLGHV-XLIVMatthieu 27.37

Lattitude du Christ envers sa vocation royale souligne que son


Royaume nest pas un pouvoir politique habituel.
Le monde et toute la cration appartiennent Dieu. Les pouvoirs
des hommes passent, mais le rgne du Christ est ternel.

Dans le chapitre sur lglise, nous avons soulign que le monde


est dans un temps particulier et que lonction qui est sur Jsus
se limite rpandre la grce sur les hommes. Dans ce contexte,
OD FRQTXrWH GX URL -pVXV QH YLVH DXFXQHPHQW j  GRPLQHU  OHV
hommes, mais conqurir leurs curs pour y apporter la vraie
vie.

Voir Jean 6.15.

Voir Jean 19.

208

Choisis la vie...

Socit

Lvangile et la politique agissent dans deux espaces


complmentaires, on peut lexpliquer en prenant lexemple de la
circulation routire.
Lorsquune personne conduit une voiture, elle se dplace sur un
rseau public qui est la disposition de tous les usagers de la route.
6D PDQLqUH GDJLU GDQV FHW HVSDFH FRPPXQDXWDLUH VHUD GpQLH
par ses capacits matriser son vhicule et prendre garde aux
autres et aux dangers.
Si le conducteur de la voiture a conscience de sa responsabilit
et conduit prudemment, il nest pas ncessaire de renforcer les
contrles. Par contre sil na pas de respect, il sera ncessaire de
le forcer bien se comporter en employant, si ncessaire, des
mesures de contraintes.
Par consquent, plus le conducteur est mauvais, plus la force
policire doit sexercer. linverse, lorsque lon conduit bien, la
police na pas de raison dexercer une contrainte.
Politique
interactions

vangile

Dans une socit o chacun aime son


prochain comme soi-mme, il sera trs
facile de crer un cadre harmonieux et
paisible ; par contre, une socit habite par
la mchancet sera chaotique et violente,
elle ncessitera une police puissante,
de nombreuses lois et des mesures de
contraintes.

La dmocratie nest rien dautre quune tentative dappliquer


les principes de la Bible la socit humaine. Wallace C. Speers

Lorganisation politique agit depuis lextrieur de notre vie en


cherchant organiser et conduire le rseau de la socit. Pour
cette tche elle doit prendre en compte les valeurs prsentes dans
la population. Face au mal, elle doit rpondre par la force.
La Bible souligne que lusage de la force est lgitime quand
elle sert limiter le mal. Lhomme de loi ou le policier sont des
serviteurs de Dieu car ils agissent de manire rduire le mal.
209

Socit

Choisis la vie...

Le magistrat est serviteur de Dieu pour ton bien. Mais si tu


fais le mal, crains ; car ce nest pas en vain quil porte lpe,
tant serviteur de Dieu pour exercer la vengeance et punir
celui qui fait le mal. Il est donc ncessaire dtre soumis, non
seulement par crainte de la punition, mais encore par motif de
conscience. Cest aussi pour cela que vous payez les impts. Car
les magistrats sont des ministres de Dieu entirement appliqus
j FHWWH IRQFWLRQ 5HQGH] j WRXV FH TXL OHXU HVW G  OLPS{W j
qui vous devez limpt, le tribut qui vous devez le tribut, la
crainte qui vous devez la crainte, lhonneur qui vous devez
lhonneur. Romains 13.4-7

Lorganisation politique a pour mission de grer le cadre de la


socit et de lorganiser avec des rgles et par le dveloppement
de ses structures. Elle est par contre incapable de changer le fond
des personnes. Ainsi, si je suis quelquun de trs malveillant et
que je hais profondment les autres, la politique ne me changera
pas. Elle tablira seulement un cadre juridique qui essaiera de
limiter limpact de ma mchancet.
Lvangile est diffrent, car de par sa dimension spirituelle, il
peut agir depuis lintrieur de lhomme et changer son cur.
Jamais, Bible en main, nous ne pouvons priver les autres
de leurs droits que, dans les mmes circonstances, nous
UpFODPHULRQVSRXUQRXVPrPHVGardiner Spring (1785-1872), pasteur
de Brick Presbyterian Church New York

Il est impossible de gouverner droitement le monde sans Dieu


et sans la Bible. George Washington

Un homme politique dsirant le bien-tre de la population et


un vangliste ou un pasteur poursuivent les mmes objectifs :
permettre aux hommes de vivre en paix et de prosprer
harmonieusement.
Leur objectif est le mme, mais il ne faut pas confondre lespace
de la foi avec celui de la politique. Le responsable politique devra
entre autres faire respecter la loi en condamnant si ncessaire
les coupables. Cest par exemple lexercice de ce pouvoir qui a
conduit le brigand sur la croix. Le Christ en revanche, lui, a choisi
de mourir sur la croix ct du brigand ; il a choisi de venir
lintrieur du jugement des hommes pour apporter la grce ce
pcheur.
210

Socit

Choisis la vie...

FOI ET POLITIQUE

POLITIQUE

Gestion terrestre
Dimension matrielle

Autorit

GLISE

Royaume de Dieu
Dimension spirituelle

Alliance

Justice

Amour du prochain

Scurit

Valeurs de respect

conomie

Gnrosit et dons

Infrastructures
Sant

Conscration
Assistance

Comme le montre ce tableau, les champs daction du politique et de lglise ne


sopposent pas, ils sont complmentaires et doivent reconnatre humblement les
limites du mandat qui leur a t donn par Dieu.

Cette distinction entre les mandats de lglise et du monde


politique est fondamentale. Chaque fois que lglise a voulu
prendre le pouvoir pour soi-disant tablir politiquement le
5R\DXPHGH'LHXHOOHVHVWpJDUpHHWGLVTXDOLpH
Ceux qui exercent un ministre daptre, de pasteur ou
dvangliste ne doivent pas dnaturer leur mandat en prenant une
fonction politique. Leurs vocations sadressent tous les hommes
et sans parti pris.
Par contre, il est trs souhaitable que de nombreux chrtiens
simpliquent en politique. Dans ce cas, ils peuvent user de leur
211

Socit

Choisis la vie...

responsabilit de citoyen en prenant une part dans la gouvernance


du pays. Une fonction de maire, de juge ou de notable peut en effet
permettre un chrtien de servir et de sinvestir dans la gestion
des ressources de la socit.

Grce aux valeurs de lvangile et sa communion avec Dieu,
un chrtien peut contribuer organiser la socit sur de bons
fondements ( condition, bien sr, quil sache rsister la tentation
corruptrice attache au pouvoir !).
 3RXU FRQQDvWUH FH TXLO \ D GDQV XQ KRPPH GRQQH]OXL GX
pouvoir. Winston Churchill (1874-1965), premier ministre du Royaume-Uni
durant la Seconde Guerre mondiale

Aujourdhui, de nombreux pays sont gouverns selon un concept


dmocratique. Grce leur citoyennet, les chrtiens reoivent une
SDUWGHODVRXYHUDLQHWpHWSHXYHQWGRQFLQXHQFHUODJRXYHUQDQFH
de leur pays en donnant leurs suffrages des hommes ou des
orientations politiques.
Cette responsabilit doit tre prise au srieux et il est important
que les chrtiens usent de leurs droits dmocratiques en cherchant
dfendre les valeurs de lvangile. Dans cette dmarche, il est
important de prier pour les autorits et de choisir avec soin les
personnes ou les orientations dignes dtre soutenues.
Prendre une part dans les mdias
Dans le monde actuel, les chanes de tlvision, les radios, la
SUHVVHHWOLQWHUQHWRQWXQHJUDQGHLQXHQFHVXUODVRFLpWp$YHFOH
dveloppement des technologies, ils sont devenus les tribunes qui
permettent de transmettre les valeurs des socits. L aussi, il est
important que des chrtiens puissent prendre leur responsabilit et
H[HUFHUXQHLQXHQFHEpQpTXH
Trouver des personnes comptentes, investir avec sagesse dans les
mdias et transmettre un contenu de qualit sont les moyens qui
permettent de tmoigner de lamour de Dieu un large cercle.
En tant que chrtiens, nous
devons reconnatre la ncessit
de lorganisation politique et
avoir du respect envers les lois.

212

Choisis la vie...

Socit

Les fondements dune bonne politique


Nous avons vu prcdemment que lvangile agit principalement
GDQVXQHGLPHQVLRQLQWpULHXUH&HODQHVLJQLHSDVTXHOD%LEOH
ne peut pas donner de bons conseils sur lorganisation du cadre
politique. La plus grande partie de la Bible a t crite alors que le
peuple juif devait tre conduit et organis et de nombreux textes
de lAncien Testament abordent les questions politiques relatives
aux structures nationales, aux rgles de gouvernance et aux
principes qui concernent lorganisation sociale.1
Dans la Bible, laventure du peuple juif et des nations du Moyen-
Orient est raconte sans complaisance. Le lecteur peut donc
dcouvrir la grandeur ou la bassesse des dirigeants et des systmes
politiques qui se sont succd durant plusieurs sicles.
Suivre le destin des rois despotiques, des processus qui conduisent
DX[ FKDRV HW j OD JXHUUH RX j OLQYHUVH SURWHU GHV H[FHOOHQWV
principes appliqus par les dirigeants qui ont fait prosprer leur
pays, est un trsor inestimable.
Cette fresque est une mine inpuisable de connaissance et les
meilleurs dirigeants du monde moderne reconnaissent y avoir
trouv linspiration ncessaire lexercice de leur mandat
politique.2 Ainsi, lhomme politique avis a, dans la Bible, un
ODERUDWRLUH TXL OXL SHUPHW GH SURWHU GHV H[SpULHQFHV SDVVpHV
en discernant les bons ou les mauvais choix. La Bible est donc
loutil indispensable pour celui qui dsire exercer un mandat de
responsabilit dans la socit.
Sans la Bible, nous ne pourrions savoir ce qui est juste ou
ce qui ne lest pas... Toutes les choses les plus dsirables pour
OHERQKHXUGHOKRPPHLFLEDVHWDXGHOj\VRQWGpSHLQWHV
Abraham Lincoln (1809-1865), Prsident des tats-Unis qui a t le principal acteur
de labolition de lesclavage dans son pays.

Ces aspects se trouvent en particulier dans le livre du Deutronome, les livres


de Samuel et des Rois.

Ce fut le cas par exemple de Winston Churchill (premier ministre britannique


qui sest illustr durant la Seconde Guerre mondiale), de Thomas Jefferson, de
George Washington (et dautres prsidents des tats-Unis), de Martin Luther
King (lun des principaux acteurs de lintgration des Noirs dans la socit
amricaine), de Nelson Mandela (opposant lapartheid et prsident de
lAfrique du Sud), et de beaucoup dautres

213

Socit

Choisis la vie...

Le miracle de la collgialit
Dans certains pays, les dirigeants sont entours dun grand faste,
ils habitent de somptueuses demmeures, possdent de nombreux
serviteurs et, lorsquils se dplacent, ils sont prcds par un
cortge de voitures avec escortes et sirnes. Ils aiment montrer
quils sont les chefs du pays en multipliant les apparats et les
signes de pouvoir.
La folie se drape dapparat, Pourtant, souvent et malgr toute
alors que la comptence cette gloire, le pays est mal gr et la
VKDELOOHGHIFDFLWp
population subit le chaos et la pauvret.

loppos, il existe des chefs dtat qui exercent leurs fonctions


discrtement, leur logement et le nombre demploys sont adapts
leurs besoins, ils se dplacent simplement et ne recherchent
DXFXQHPHQW j VDIFKHU FRPPH DXGHVVXV GHV DXWUHV FLWR\HQV
/HXU FRQGXLWH SROLWLTXH HVW SRXUWDQW WUqV HIFDFH HW OHXU SD\V
progresse et se dveloppe.
Comme le montrent ces deux exemples, la manire de gouverner
peut se manifester trs diffremment.
Lorsquune personne est investie dune responsabilit, elle obtient
un pouvoir qui lui permet dexprimer ses ambitions personnelles.
Sa manire dexercer lautorit sera donc dicte par ses dsirs et
sa vision des autres. Lexercice du pouvoir est donc un puissant
rvlateur des valeurs qui habitent les dirigeants.
Dans de nombreuses cultures, le pouvoir est prsent
comme une position qui permet dexercer un droit sur
lautre.
Les rois ou les chefs sont lus pour dominer, ils
SHXYHQWGRQFSURWHUde leur entourage pour obtenir des faveurs.
Fondamentalement, cette forme de pouvoir part du principe que
lhomme peut slever au-dessus de ses semblables pour prendre
un rle de divinit.
Dans lAntiquit, cette prtention divine du roi tait clairement
DIFKpH HW OHV HPSHUHXUV HW OHV GRPLQDWHXUV pWDLHQW FRQVLGpUpV
comme des dieux.
'DQVOHFRQWH[WHPRGHUQHLOHVWSOXVGLIFLOHGHVHIDLUHSDVVHU
pour un dieu et ceux qui sattribuent ce privilge sont fortement
214

Choisis la vie...

Socit

critiqus ou rduits diriger des sectes. Pourtant, mme sil


nest plus politiquement correct de diviniser le roi, lexercice
du pouvoir est trs souvent bas sur lide que le chef est dune
nature suprieure.
Cette tendance est particulirement forte dans les cultures
inspires par lanimisme et dans lesquelles on considre quune
personne reoit une position dominante selon sa position dans le
clan ou en fonction de la bienveillance des esprits. Ds lors, lan
GHVJDUoRQVVHUDVRXYHQWFRQVLGpUpFRPPHOHURLpWDEOLVXUVHV
frres et surs.
Lenfant choisi et ceux qui lentourent vont donc grandir avec la
vision que le pouvoir donne le droit de dominer les autres.
Comme cest une lection arbitraire qui donne le pouvoir, les
dirigeants nauront pas le souci dtre comptents dans lexercice
de leurs responsabilits.

LES DSIRS DU TYRAN

Domination

Richesses
Directeur Grand chef
Prsident

Gloire

Prestige

Pouvoirs

Conqutes

Le tyran type est une personne qui se considre comme le centre du monde avec
ODPELWLRQGREWHQLUGHVGURLWVGLYLQVVXUVRQHQWRXUDJH&HGpVLUGHSRXYRLU
et de contrle soppose totalement lamour de Dieu et du prochain.

&HW H[HPSOH GH OLQXHQFH GH ODQLPLVPH VXU OD FRQVFLHQFH


des dirigeants souligne que ce sont les valeurs spirituelles qui
GpQLVVHQWODPDQLqUHGH[HUFHUOHSRXYRLU
On peut observer ce lien de cause effet au travers des diffrentes
formes de pouvoirs que dveloppent les idologies et les
religions.
215

Socit

Choisis la vie...

Religions et concepts de gouvernances


Religion

Facteur dlection

Attitudes

Animisme

Superstitions,
liens du sang

Tribalisme, privilges, infantilisme,


abus de pouvoir, favoritisme...

Athisme

Idologie sociale,
performances

Totalitarisme, pense unique,


ingrence, individualisme...

Islam

Soumission la,
charia, hrosme

Domination du clan, fatalisme,


lgalisme oppressif, guerres...

Hindouisme

Cosmologie
religieuse, castes

Sacralisation, justifications des


ingalits, favoritismes...

&H WDEOHDX SUpVHQWH VRPPDLUHPHQW OLQXHQFH GHV FRQFHSWV UHOLJLHX[ VXU OHV
valeurs et les processus qui conduisent attribuer lautorit. Comme le montrent
OHVGLIIpUHQWHVFRORQQHVODUHOLJLRQLQXHQFHOHIDFWHXUGpOHFWLRQHQGpQLVVDQWFH
qui est honorable au sein dune population. Ces critres, qui serviront dsigner
OHVPDvWUHVVHURQWORJLTXHPHQWDSSOLTXpVSDUOHSRXYRLU
'H IDLW OD FUR\DQFH GpQLW OHV YDOHXUV IRQGDPHQWDOHV TXL IRUPHQW OD VWUXFWXUH
sociale. Ce processus est particulirement prsent dans lislam o la loi religieuse
(la charia) a une ambition politique exclusive et donc oppose la sparation
entre lespace laque et religieux.

Dans ce tableau, nous avons volontairement omis de mentionner


le christianisme de manire analyser plus prcisment les
principes de gouvernance quil engendre. Ainsi, dans la vision
biblique, lexemple ultime du roi choisi pour rgner se focalise
sur le Christ ; il a reu de Dieu son autorit suprme, il est le
chef et le conducteur des hommes Pourtant, malgr toutes ces
prrogatives dautorit, il ne domine pas ses sujets, mais il donne
sa vie pour eux !
Comme le souligne Jsus, ce modle de gouvernance
rvolutionnaire nest pas limit son mandat, il est aussi celui
quil propose ses disciples lorsquils cherchent valuer leurs
positions hirarchiques :
Vous savez que ceux quon regarde comme les chefs des nations
les tyrannisent, et que les grands les dominent. Il nen est pas de
mme au milieu de vous. Mais quiconque veut tre grand parmi
vous, quil soit votre serviteur ; et quiconque veut tre le premier
parmi vous, quil soit lesclave de tous. Car le Fils de lhomme
est venu non pour tre servi, mais pour servir et donner sa vie
FRPPHODUDQoRQGHEHDXFRXSMarc 10.41-45 (voir Luc 22.24-27)

216

Choisis la vie...

Socit

Selon ces paroles, le fait de vouloir slever au-dessus de son


prochain est lexpression logique du culte de la domination qui
habite le cur de lhomme. Cest pourquoi la bonne gouvernance
a toujours eu beaucoup de peine sappliquer, et cela mme
dans les pays fortement christianiss. Trs souvent, lglise sest
associe des formes de pouvoir en totale opposition avec le
modle de lvangile. Quel dommage !
Avec ces drives, lexemple de serviteur donn par le Christ est
une dmonstration de la juste et divine manire de conduire les
peuples. Enracine dans lamour et le respect de lautre, elle
apporte une vision nouvelle sur la manire dexercer lautorit et
de construire la socit.
&H SRWHQWLHO EpQpTXH SHXW rWUH REVHUYp GDQV OH SURFHVVXV TXL
permet une dmocratie de natre. Dans un systme de pouvoir
dominateur, cest le chef et ses allis qui dcident. Ceux-ci seraient
bien sr prts accorder un droit de vote ceux qui pensent
comme eux, mais, pour que la dmocratie sapplique rellement,
il en faut beaucoup plus.
De fait, la vraie dmocratie exige un
/DPDQLqUHGHGLULJHULQXHQFH
toutes les facettes de la socit pWDW GHVSULW WUqV GLIFLOH &KDFXQ
et peut donc conduire au dclin doit accepter quil puisse perdre au
ou la prosprit.
SURWGXGURLWGHVDXWUHV
Accepter de perdre, alors que lon aurait les moyens dutiliser la
violence, nest pas facile et cela ncessite que lon soit habit par
un profond respect des autres.
Cest pourquoi linvitation biblique se considrer comme le
serviteur de son prochain est lune des valeurs essentielles qui ont
permis lclosion des dmocraties dans les pays occidentaux.
Le tyran type
Le tyran potentiel est foncirement gocentrique et a donc un besoin
viscral dtre au centre de la socit. Cette tendance lentrane accorder
une grande importance son nom et son image. Une part importante de
son pouvoir va donc consister se mettre en avant et imposer son image
DX[DXWUHV$YHFFHVGpULYHVOHVJUDQGHVW\UDQQLHVQLVVHQWWRXMRXUVSDU
un culte forc destin satisfaire larrogance du dictateur. Cette dvotion
est impose au peuple par des milliers de portraits, des statues colossales,
des hymnes glorieux, etc.

217

Socit

Choisis la vie...

Les symptmes de la tyrannie


La mgalomanie stupide et pathtique des tyrans pourrait prter
sourire mais elle saccompagne le plus souvent dune effroyable
HW GLDEROLTXH PDFKLQH j pFUDVHU OHV DXWUHV HW FHOD QLW SDUIRLV SDU GHV
V\VWqPHVGHFDPSVGLQWHUQHPHQWHWGHWHUULDQWVJpQRFLGHV
Hitler
Massacre de 6 millions de Juifs, de Tziganes et dun grand nombre
dopposants dans des camps de concentration. Il est lorigine dune
guerre dagression mondiale ayant conduit 60 millions de morts.
Staline
Vingt millions de morts pour raisons politiques, dont 13 millions par
GHVGpSRUWDWLRQVHWSDUGHVWUDLWHPHQWVGDQVGHVFDPSVRLOVpWDLHQW
rduits ltat desclaves et affams.
Pol Pot
Une folie meurtrire et idologique qui le conduira diriger un systme
torturant et assassinant un quart de son peuple, soit plus dun million de
personnes.
Mao
Lorgueil de cet homme et son systme tyrannique conduira la Chine
dans une idologie brutale qui causera entre 65 et 70 millions de morts.
La liste des tyrans et des meurtriers de masse serait interminable si
lon ajoutait tous ceux qui se sont succd travers lHistoire. Chaque
empire et chaque civilisation a t marqu par lorgueil des hommes et
des violences organises conduisant des massacres ou lesclavage de
populations. Notons aussi quil y a aujourdhui encore de grands tyrans
et gnocidaires qui ravagent des rgions et des pays.
Suis-je un tyran potentiel?
Ce qui sapplique en petit est limage de ce qui sapplique en
grand. Celui qui est violent et cruel dans sa famille et son entourage
est potentiellement aussi dangereux que lhomme qui commandite
le massacre de millions de personnes. Si votre image est importante
pour vous, si vous avez le souhait que votre nom soit connu au loin, si
vous ntes pas sensible la souffrance des autres, si vous utilisez les
rglements ou votre position sociale pour dominer les autres et que vous
navez pas de scrupule voler le bien dautrui, vous avez le potentiel
pour devenir un tyran.

218

Socit

Choisis la vie...

Une rforme du pouvoir


Comme nous lavons vu avec limage de la pyramide, la tendance
naturelle du puissant est de construire un systme qui lui permet
de dominer les plus faibles. Comme ce concept totalitaire est
lantithse des principes dgalit et damour du prochain, il y a
forcment un choc entre la vision humaine de gouverner et celle
prsente par le Christ.

LES SYSTMES DE GOUVERNANCE


Systme cellulaire
Pouvoir dcentralis
Systme pyramidal
Pouvoir centralis

TYRANNIE

COLLGIALIT

Ce dessin prsente les deux types de gouvernance :


/H SUHPLHU LPSUpJQp SDU GHV YDOHXUV SDwHQQHV GpLH OH SRXYRLU HW YLVH j XQ
contrle centralis. Cest le syndrome de Babel.
Le second, inspir par la vision biblique, considre quil y a galit entre les
hommes et que la gouvernance se fait sur un principe de collgialit.

'DQV OHV SD\V OHV SOXV LQXHQFpV SDU OeYDQJLOH OD SULVH GH
conscience de lgalit entre les hommes a conduit dnoncer
les abus de la tyrannie. Dans ce processus, lexercice individuel
du pouvoir a t progressivement remplac par des formes de
gouvernances collgiales.
Cette rpartition de lautorit au sein de groupes a apport de
nombreux avantages. Comme lorgane suprme nest pas suspendu
la versatilit et la sant dun homme, il est bien plus stable et
se renouvelle constamment. De plus, avec ses divers membres, il
permet une bonne reprsentation des tendances politiques et des
minorits.
219

Socit

Choisis la vie...

Les diverses comptences prsentes au sein du conseil dirigeant


apportent aussi des capacits tendues.
Avec toutes ces qualits, ce mode de fonctionnement permet
dappliquer un principe de services et peut aussi sappliquer avec
SURWGDQVWRXWHVOHVHQWUHSULVHVKXPDLQHV
Sur un plan gographique, lapplication des principes de
collgialit permet de reconnatre la capacit des rgions se
prendre en charge. Alors que les dsirs tyranniques cherchent
tout contrler, lorganisation collgiale conduit crer des
structures de gouvernance qui accordent aux autres des droits
lautodtermination. Dans la pratique, cela consiste distribuer
les comptences en accordant le maximum dautonomie aux
communes et aux rgions. Grce cette structure dcentralise,
chacun prend cur ses responsabilits et le pays est bien gr.
Cest ce mode de fonctionnement fdraliste qui permet un
grand pays comme les tats-Unis dtre performant.
Un exemple
En Suisse, la prsidence du pays est assume par un collge de sept
personnes lues dmocratiquement. Dans ce groupe dhommes et de
femmes, chacun a les mmes pouvoirs. La fonction de prsident du pays
HVWKRQRULTXHHWDWWULEXpHFKDTXHDQQpHjXQPHPEUHGHFHFRQVHLO
Cette rpartition du pouvoir selon une structure collgiale ne peut se
construire sans un fort sens du droit des autres et du partage. Notons
quavec ce systme, la prise de dcision est plus lente et ncessite de
trouver des consensus qui respectent les diverses sensibilits politiques.

Comme le montrent ces exemples, ce sont les valeurs de lvangile


qui ont permis de construire un systme de gouvernance politique
fond sur les avantages de la collgialit. Ces valeurs ont montr
que le commandement daimer son prochain comme soi-mme ne
pouvait sassocier un systme de commandement tyrannique.
Cela est trs important, car certains considrent que les valeurs
chrtiennes sont des concepts virtuels que lon peut impunment
poser sur tous les supports. Cest faux, lapplication des valeurs
de lvangile conduit toujours transformer le fond et la forme.
220

Socit

Choisis la vie...

Logiquement, un systme tyrannique et centralis ne peut


accueillir durablement les valeurs chrtiennes. Soit il devra
changer, soit il pervertira le message du Christ en lui donnant une
forme dominatrice.
Cest pourquoi notre manire de nous 0RQWUHPRLFRPPHQWWX
conduire ou dexercer lautorit est gouvernes et je te dirai
lexpression des valeurs qui nous ce que tu crois.
habitent.
Lorsque lvangile est intgr, il conduit une reconnaissance de
lgalit du prochain (homme et femme) et la libert. Pour se
conformer ces valeurs, la forme de gouvernance est base sur la
collgialit.
Dans cet exercice de la collgialit, tous les membres dun conseil
doivent tre habits par un profond respect de lautre.

LARBRE DU DVELOPPEMENT

Forces

CRATION

Dveloppements

Qualit de vie, scurit, ressources


infrastructures, richesses...

Pense

Sagesse, connaissances, comptences,


anticipations, technologies...

me

Respect des autres, assistances,


construction de la famille...

Foi, humilit, valeurs morales,


conscience, identit profonde...

Cur

DIEU

Intelligence
Relations

Spiritualit

Ce dessin illustre les liens entre les dimensions intrieures de lhomme et leurs
impacts dans lenvironnement et la socit. Cest pour cette raison que la Bible
QRXVLQYLWHjDLPHU'LHXGHWRXWQRWUHFXUGHWRXWHQRWUHkPHGHWRXWHQRWUH
SHQVpHHWGHWRXWHQRWUHIRUFHDLQVLFHVWGDQVODPHVXUHRXOKRPPHVRXYUH
Dieu que celui-ci peut clairer et bnir les dimensions spirituelles, sociales,
intellectuelles et environnementales.

221

Socit

Choisis la vie...

Quelques rgles pour bien gouverner


Mose tait un dirigeant de trs grande qualit que Dieu avait
choisi pour librer son peuple. Ce leader a d affronter un pouvoir
tyrannique, user de diplomatie, convaincre et gouverner un
peuple nombreux et pas docile, organiser lconomie, grer des
problmes, etc. En toutes ces choses, il sest montr la hauteur.
0DLV QXO QHVW pWHUQHO HW 0RwVH D QL ORJLTXHPHQW SDU GHYRLU
cder sa place. Cet pisode est relat dans le livre biblique du
Deutronome.
Au dbut de ce livre, Mose commence par rappeler lexprience
quil a vcue lorsquil a pris conscience de lampleur de sa
tche. Face la multitude des familles de son peuple, il confesse
avoir ralis quil lui tait impossible de gouverner seul. Cette
remarquable humilit la donc conduit choisir des hommes
mme de le soutenir. Pour cela, il invite le peuple choisir des
hommes de qualit :
Prenez dans vos tribus des hommes sages, intelligents et
connus, et je les mettrai votre tte. Deutronome 1.13

Cette proposition a plu au peuple qui a choisi dmocratiquement


des hommes rpondant ces critres. Moise les a tablis dans leur
fonction en leur donnant les instructions suivantes :
coutez vos frres, et jugez selon la justice les diffrends de
chacun avec son frre ou avec ltranger. Vous naurez point
gard lapparence des personnes dans vos jugements ; vous
couterez le petit comme le grand ; vous ne craindrez aucun
homme, car cest Dieu qui rend la justice. Et lorsque vous
WURXYHUH]XQHFDXVHWURSGLIFLOHYRXVODSRUWHUH]GHYDQWPRL
pour que je lentende. Deutronome 1.16-17

Bien quil serait trs intressant de continuer la lecture du


Deutronome, nous allons nous arrter sur les deux principes mis
en vidence par Mose.
1. Choisir les bonnes personnes
Il y a chaque anne des scandales retentissants causs par des
SHUVRQQHVTXLRQWPDOJpUpHWGpWUXLWFHTXLOHXUpWDLWFRQp$LQVL
LOVXIWGHTXHOTXHVPRLVSRXUTXXQGLULJHDQWVWXSLGHRXDYLGH
conduise son entreprise ou son pays la ruine.

222

Choisis la vie...

Socit

linverse, il y a des personnes de qualit qui sont capables de


remonter la pente. Tel patron est capable de relever et de faire
SURVSpUHU VRQ HQWUHSULVH GDQV GHV WHPSV GLIFLOHV WHO SROLWLFLHQ
montrera le bon exemple en prenant des dcisions salutaires pour
son pays.
Dans toute entreprise, cest le choix des hommes qui est dtermi-
nant et cet aspect passe bien avant les considrations matrielles
HWQDQFLqUHV
Comme le souligne Mose, la qualit dun homme ne se juge pas
en considrant ses diplmes, ses richesses ou son apparence, mais
en valuant ses valeurs morales.
Choisis parmi tout le peuple des hommes capables, craignant
Dieu, des hommes intgres, ennemis de la cupidit. Exode 18.21, 21

Car, pour bien choisir, il faut valuer ce quune personne est capable
de faire dans la ralit. Mose poursuit en invitant son peuple
FKRLVLUGHVSHUVRQQHVVDJHVLQWHOOLJHQWHVHWFRQQXHV
Ces trois qualits font rfrence aux aptitudes indispensables que
lon doit trouver dans ceux qui gouvernent.
a. Choisir des personnes sages
La sagesse est la capacit de fonder sa vie sur des fondements
solides. La Bible indique ainsi que le commencement de la
sagesse est la crainte de Dieu.1 Lhomme sage a conscience quil
est entour de choses plus grandes que lui et quil doit chercher
les comprendre. Le sage aime et recherche la vrit ; il ne sappuie
pas sur ses propres ambitions, mais cherche ce qui est juste.
La vraie sagesse saccompagne toujours dune grande humilit
envers son destin et ses capacits humaines. Cest pourquoi le
sage aime lcoute de Dieu, la connaissance et linstruction, car il
sait que la russite sobtient en respectant les principes tablis.
La sagesse est un arbre dont les fruits donnent la vie ceux
qui se lapproprient. Et ceux qui savent la garder sont heureux.
Proverbes 3.18

Si quelquun dentre vous manque de sagesse, quil la demande Dieu, qui


donne tous simplement et sans reproche, et elle lui sera donne. Jacques 1.5,
voir aussi le chapitre 3.13-18

223

Socit

Choisis la vie...

b. Choisir des personnes intelligentes


2Q SRXUUDLW GpQLU OLQWHOOLJHQFH FRPPH OD FDSDFLWp GH IDLUH
quelque chose de bon avec ce que lon a disposition. La
technologie, les constructions, lorganisation sociale, lconomie,
le dveloppement, la sant tous ces domaines peuvent progresser
dans la mesure o lon sait utiliser les ressources qui nous
entourent. Un monde sans intelligence est chaotique, dsordonn,
pauvre et misrable.
Lintelligence consiste trouver des solutions pour rsoudre
les problmes. Pour cela, il ne sagit pas de sappuyer sur des
habitudes mais danalyser la situation relle et danticiper.
Lintelligence trouve le chemin qui portera du fruit ; elle est une
denre indispensable un bon responsable.
Celui qui acquiert du sens aime son me ; celui qui garde
lintelligence trouve le bonheur. Proverbe 19.8

c. Choisir des personnes connues


Le mot utilis dans le texte original fait rfrence au fait de bien
connatre, de discerner ; dans certaines versions bibliques il est
DXVVLWUDGXLWSDUpSURXYp
/D VLJQLFDWLRQ GH FH PRW VRXOLJQH XQ DVSHFW HVVHQWLHO  LO IDXW
choisir les personnes en fonction des capacits quelles ont prou-
ves rellement par leurs actes. Par consquent, ce nest pas celui
qui fait de grandes promesses quil faut choisir, mais celui qui
est capable dapporter de bonnes choses par son attitude et ses
comptences. Un bilan du pass et le tmoignage honnte des per-
sonnes qui lentourent sont dterminants pour bien choisir :

A-t-il russi face ladversit ?


Est-il comptent ?
Sait-il se matriser ?
A-t-il du respect pour son prochain ?
Quels sont les fruits positifs qui dcoulent de son travail ?

Quand le dsordre svit dans le pays, les chefs se multiplient,


mais avec un homme intelligent et expriment, lordre rgne et
le gouvernement est stable. Proverbe 28.2*

224

Choisis la vie...

Socit

2. Avoir un sens aigu de la justice


La principale exigence que Mose demande aux hommes qui
gouvernent est davoir un sens aigu de la justice. Lors de son
sjour en gypte, le peuple hbreu a t durant plusieurs annes
rduit lesclavage. Cette longue exprience de linjustice a
profondment marqu Mose. Lui-mme avait failli mourir noy
cause dune loi royale dcrtant de tuer les nouveau-ns hbreux.
Il avait ensuite pu voir le racisme et les plus grandes cruauts
sexprimer contre son peuple.
Ce peuple, maintenant libr de ses oppresseurs, va-t-il reproduire
ces injustices envers les autres ? Cela ntait pas impossible, car
les anciennes victimes deviennent parfois de terribles bourreaux
quand elles peuvent prendre le dessus.
Mais Mose et le peuple savent que Dieu ne supporte pas linjus-
tice ; ils ont vu sa colre envers les oppresseurs, ils savent que
Dieu entend les malheureux et quil prend fait et cause pour eux.
Pour que le peuple progresse et quil soit bni, il doit tre juste,
car la justice est le fondement politique dune nation et la denre
essentielles toute organisation sociale. Et, comme le souligne
Mose, lexercice de la justice sappuie sur un principe dgalit
essentiel :
Vous naurez point gard lapparence vous couterez le
petit comme le grand verset 16

Lingalit dans lexercice de la justice cest de linjustice !


De fait, il est particulirement scandaleux de voir des ministres,
des gouverneurs, des juges ou des hommes de loi faire le mal.
Si le policier vole et se comporte en brigand sans tre sanctionn,
le sens mme de la justice est dtruit et le pays se retrouve livr
la mchancet.
Si un ministre utilise les biens publics pour ses besoins personnels
ou fait le mal et quil reste impuni cause de sa fonction, cela
dtruit le lien essentiel qui lie le politique la socit et le pays
court la ruine.
/H pDX GH OD FRUUXSWLRQ TXL GpWUXLW OpFRQRPLH HVW WRXMRXUV OD
consquence de labsence dune justice impartiale. Si la police et
le juge sont intgres, le mal ne pourra sexprimer impunment,
mais sils sont eux-mmes pervertis, qui sopposera au mal ?
225

Socit

Choisis la vie...

La justice apporte la bndiction quand elle sapplique tous ; ainsi


tout homme politique ou ayant une responsabilit dans la socit
doit reconnatre que la justice est suprieure sa position, son
prestige ou ses richesses. Donc, quelles que soient sa fonction
ou ses relations, il accepte que la justice puisse latteindre.
Accepter cette primaut de la justice sur sa vie est une humilit
salutaire et la preuve que lon a compris que la justice vient du
Crateur : car Dieu est juste !
Dautres livres ont t donns pour notre information. La
Bible fut donne pour notre transformation.

Quelques paroles du livre des Proverbes sur la justice


La justice lve une nation, mais le pch est la honte des peuples.
Proverbes 14.34

Les terres en friche du pauvre pourraient produire des vivres en


abondance, mais plus dun prit par linjustice Proverbes 13.23*
La voie du mchant est en abomination lternel, mais il aime
celui qui poursuit la justice. Proverbes 15.9
Mieux vaut peu avec justice, que beaucoup de revenu sans ce qui est
juste. Proverbes 16.8
Cest une abomination pour les rois de pratiquer liniquit ; car, par
la justice, le trne est rendu ferme. Proverbes 16.12
Qui poursuit la justice et la bont trouvera la vie, la justice, et la
gloire. Proverbes 21.21
 2XYUH WD ERXFKH MXJH DYHF MXVWLFH HW IDLV GURLW j ODILJp HW DX
pauvre. Proverbes 31.9
Ce nest pas bien de favoriser le mchant par gard pour sa personne
et de lser les droits du juste. Proverbes 18.5*
/KRPPHFRUURPSXDFFHSWHGHVSRWVGHYLQVRXVOHPDQWHDXSRXU
faire entorse au droit Proverbes 17.23
Quand les mchants arrivent au pouvoir, les crimes se multiplient.
Proverbes 29.16*

226

Choisis la vie...

Socit

Quelques conseils sur la gouvernance


Racisme et frustrations
Lun des grands problmes de gouvernance est de grer la frus-
tration des populations dmunies. Comme nous lavons vu lors
de lpisode de Can, la frustration conduit souvent la haine de
lautre, en particulier de celui qui russit.
Cela peut se manifester dans la famille et entre voisins, mais aussi
contre des groupes ethniques ou des classes sociales.
Certaines idologies politiques utilisent cette frustration pour ob-
tenir du pouvoir.
Murmurer des pauvres quils sont dans le dnuement cause
des riches ou des trangers est un moyen facile de les acqurir
une cause.
Mais, comme nous lavons vu, la frustration conduit la haine et
la haine aux malheurs et aux meurtres.
Les rvolutions, les meutes, les violences et les saccages sont
gnralement laboutissement de la frustration larve qui habite
les populations.
Des hommes politiques de qualit doivent tre capables de discer-
ner ces tensions et de prendre des mesures pour les dsamorcer.
Par exemple, il y a maintenant en Afrique une forte immigration
HW LPSODQWDWLRQ GHQWUHSULVHV FKLQRLVHV /HIFDFLWp HW OHVSULW
conqurant des Asiatiques peuvent facilement susciter la haine,
dautant plus quand des dirigeants occidentaux dnoncent hypo-
critement les dangers de cette conqute.1
Cette tension entre les Africains, les Libanais ou les Chinois pour-
rait conduire une adversit croissante aboutissant des meutes
et des massacres.
Comment viter un drame qui conduirait la mort dinnocents et
loigner durablement des acteurs conomiques de ce continent ?
Les hommes politiques doivent dsamorcer cette vision de
ltranger pilleur de richesses et informer les populations du
besoin dtablir des partenariats intelligents avec ceux qui peuvent
apporter le dveloppement. Ds lors, la puissance des grands pays
peut devenir un bon moyen de raliser des infrastructures.
1

Les pays qui crient les plus forts ne se sont souvent pas privs de piller le
continent africain.

227

Socit

Choisis la vie...

Dans cette collaboration, il faut par contre veiller ne pas dilapider


les ressources et garder le contrle long terme. Cela peut se
faire, par exemple, en limitant les concessions minires dans le
WHPSVHWjOHXUpFKpDQFHLOVHUDSRVVLEOHGHOHVPRGLHU
Les Chinois, les Libanais et tous les trangers qui apportent leurs
comptences sont des employs qui travaillent dans un cadre
GpQL SDU OeWDW /HXU VXFFqV VLO HVW FDGUp SHXW FRQWULEXHU DX
dveloppement de la Nation.
Ces prcisions sont trs importantes pour lavenir des pays
dAfrique ; ainsi, une bonne politique devrait viser dsamorcer
les frustrations qui menacent la paix.
Contexte corrompu
Dans de nombreux pays, lexercice dune profession est en prise
DYHF OD FRUUXSWLRQ TXL IDLW RIFH GpFRQRPLH RX GH KLpUDUFKLHV
SDUDOOqOHV'DQVFHFRQWH[WHLOHVWWUqVGLIFLOHjXQLQGLYLGXGH
WUDYDLOOHUDYHFLQWpJULWpFDUVDVXUYLHSURIHVVLRQQHOOHHWQDQFLqUH
en dpend.
Dans un tel contexte, il serait inadquat dexiger une intgrit
absolue. Dans cette situation, le signataire ne doit pas se fondre
dans ces mauvais moules, mais les combattre en cherchant faire
la diffrence.
Ainsi, celui qui sengage avec la CHARTE+ peut tre forc de
suivre le courant global de corruption, mais il doit le faire
contrecur et en le combattant de manire crer un systme bti
sur lintgrit.
La corruption tire sa force des mensonges, des secrets et dautres
dissimulations qui lui permettent dexister.
Le signataire de la charte peut donc, dans la mesure du possible,
travailler rendre transparent ce qui ne lest pas, par exemple en
parlant sans pudeur de ce problme.
Lautre force de la corruption est de crer des alliances (mal-
TXHV  HQWUH GHV SHUVRQQHV$LQVL LO QH IDXW MDPDLV RXEOLHU TXH
celui qui me propose de participer une action illgale devient
dtenteur dun secret qui peut me nuire. Il prend donc un pouvoir
sur ma vie. Rsister certaines propositions est donc un moyen
de garder sa libert et dviter de tomber sous le coup de la justice
lorsque les autres vous dnoncent.

228

Choisis la vie...

Socit

Face aux pressions de la corruption, les signataires de la CHARTE+


peuvent chercher se rencontrer pour sencourager et essayer de
trouver les stratgies pour trouver dautres personnes qui seraient
SUrWHVjVHQJDJHUHWFUpHUXQUpVHDXGHFRQDQFH
&RPPHQW OHV YDOHXUV ELEOLTXHV SHXYHQWHOOHV LQXHQFHU OD
conduite politique dun pays ?
Homme dpendant ou rayonnant?
Lune des grandes tendances actuelles est de considrer lhomme comme
XQ DQLPDO HQIHUPp GDQV VRQ  HVSqFH  HW FRQGDPQp j UHSURGXLUH OD
culture qui lentoure. Selon cette vision ferme et sans Dieu, lindividu
est totalement dpendant des ressources matrielles et biologiques qui
lentourent. Cette dpendance de lextrieur fait de lui le rouage dune
PDFKLQHVRFLDOHjODTXHOOHLOQHVDXUDLWpFKDSSHU7RXWFHWpFKDIDXGDJH
idologique apparat bien fragile lorsquon considre que le monde a t
cr par Dieu. Dans ce cas, la source vitale nest pas lenvironnement et
la cration, mais le Crateur.
Lhomme nest donc pas un simple animal suspendu aux ressources qui
lentourent, il a la capacit dtablir un lien avec son Crateur. Grce ce
contact avec Dieu, lhomme peut devenir une source capable dappliquer
des solutions inspires pour rpondre ses besoins, ceux de sa famille
et de la socit. Ainsi, cest le lien avec Dieu qui est la source du
dveloppement.

Le monde a besoin de bons responsables


Dieu cherche des personnes qui portent les hommes dans leur
cur et qui soient prtes se consacrer la construction de la
socit.
Cette vocation rejoint lexemple biblique du bon berger qui prend
soin de son troupeau, vise pourvoir ses besoins et le conduit
vers des eaux paisibles (voir le Psaume 23).
Ceux qui exercent une responsabilit devraient la prendre au
srieux en considrant que leur engagement est un service
important pour le dveloppement de la socit. Ainsi, il ne sagit
pas seulement de parler ou davoir une belle apparence mais de
donner lexemple, de respecter la justice, dapporter des solutions
intelligentes et de viser un dveloppement social et conomique.
Car quand lvangile apporte ses valeurs dans la gouvernance il
transmet une force de dveloppement global la communaut.
229

Socit

Choisis la vie...

Quelle que soit notre responsabilit dans la conduite de la socit,


soyons des serviteurs humbles et aimants, conscients dtre placs
sous le regard de Dieu. Le mandat que nous avons reu ne nous
appartient pas, cest un service quil nous est donn dexercer
durant notre temps de vie. Visons en tre dignes.
Dmarche pratique
Voici les questions que lon peut se poser individuellement ou en
groupe pour progresser dans lexercice de ses responsabilits.

Quels sont les bons modles de responsables que je connais


et pourquoi sont-ils bons ?
Suis-je tent par le pouvoir sur les autres ou par les
sductions matrielles ? Si cest le cas, comment rsister ?
Comment appliquer des principes de collgialit dans
lexercice de mes responsabilits ?
4XHOOHV VRQW OHV SHUVRQQHV GH FRQDQFH TXH MH SRXUUDLV
consulter pour maider trouver les bonnes solutions ?
$YHF PD SRVLWLRQ VRFLDOH FRPPHQW SXLVMH LQXHQFHU
positivement mon entourage ?
Comment mettre en place une structure de travail ou de
direction qui permette de contrer la corruption ?
Comment encourager, former et amliorer les comptences
des personnes que je dirige ?

Deux conseils pour gouverner


Lors de sa prsidence, Nelson Mandela invitait appliquer ces deux
principes avant de prendre une dcision :
1. Ne jamais se prcipiter dans une option.
2. Consulter le plus grand nombre de personnes avises.

230

Choisis la vie...

Socit

Citations bibliques : le chrtien dans la socit


Soyez tous anims des mmes penses et des mmes sentiments, pleins
damour fraternel, de compassion, dhumilit. Ne rendez point mal pour
mal, ou injure pour injure ; bnissez, au contraire, car cest cela que
YRXV DYH] pWp DSSHOpV DQ GKpULWHU OD EpQpGLFWLRQ 6L TXHOTXXQ HQ
effet, veut aimer la vie et voir des jours heureux, quil prserve sa langue
du mal et ses lvres des paroles trompeuses, quil sloigne du mal et
fasse le bien, quil recherche la paix et la poursuive ; car les yeux du
Seigneur sont sur les justes et ses oreilles sont attentives leur prire,
mais la face du Seigneur est contre ceux qui font le mal. 1 Pierre 3.8-12
Ne rendez personne le mal pour le mal. Recherchez ce qui est bien
devant tous les hommes. Sil est possible, autant que cela dpend de
vous, soyez en paix avec tous les hommes. Romains 12.17-18
5HQGH]jWRXVFHTXLOHXUHVWGOLPS{WjTXLYRXVGHYH]OLPS{WOH
tribut qui vous devez le tribut, la crainte qui vous devez la crainte,
lhonneur qui vous devez lhonneur. Romains 13.7
Honorez tout le monde ; aimez les frres ; craignez Dieu ; honorez le
roi. 1 Pierre 2.17
Jexhorte donc, avant toutes choses, faire des prires, des
supplications, des requtes, des actions de grces, pour tous les hommes,
SRXUOHVURLVHWSRXUWRXVFHX[TXLVRQWpOHYpVHQGLJQLWpDQTXHQRXV
menions une vie paisible et tranquille, en toute pit et honntet. Cela
est bon et agrable devant Dieu notre Sauveur, qui veut que tous les
hommes soient sauvs et parviennent la connaissance de la vrit.
1 Timothe 2.1-4

5DSSHOOHOHXUGrWUHVRXPLVDX[PDJLVWUDWVHWDX[DXWRULWpVGREpLU
dtre prts toute bonne uvre, de ne mdire de personne, dtre
SDFLTXHVPRGpUpVSOHLQVGHGRXFHXUHQYHUVWRXVOHVKRPPHV Tite 3.1
1HYRXVOLYUH]SDVjODPRXUGHODUJHQWFRQWHQWH]YRXVGHFHTXH
YRXVDYH]FDU'LHXOXLPrPHDGLW-HQHWHGpODLVVHUDLSRLQWHWMHQH
tabandonnerai point. Hbreux 13.5
 /D VDJHVVH GHQ KDXW HVW SUHPLqUHPHQW SXUH HQVXLWH SDFLTXH
modre, conciliante, pleine de misricorde et de bons fruits, exempte
de duplicit, dhypocrisie. Le fruit de la justice est sem dans la paix par
ceux qui recherchent la paix. Jacques 3.17-18

231

Notes personnelles

232

CHOISIS LA VIE...
LA CHARTE+
La CHARTE+ permet de souligner les diffrentes
dimensions dans lesquelles lvangile peut et doit
apporter un plus.
Comme nous lavons vu au travers de ce livre, lvangile est une
puissance capable de changer les vies, les familles, lconomie et
la socit. Pour accomplir cette uvre, la Parole de Dieu ne doit
pas rester une simple thorie. Elle doit tre accueillie dans notre
cur, transformer nos sentiments et nos penses et nous entraner
dans de justes attitudes envers notre entourage.
Cet impact de lvangile dans notre vie nest pas un processus
facile, cest pourquoi la CHARTE+ vise nous encourager
tre des serviteurs de Dieu consquents qui portent des fruits
EpQpTXHVGDQVODVRFLpWp
Pratiquement, la charte se prsente sous la forme dune feuille qui
regroupe les diffrents en-ttes prsents aux dbuts des chapitres
de ce livre. Ce document de qualit et en couleur peut tre sign
par ceux qui dsirent sengager dans ce projet.

Notons que cette dmarche repose sur la bonne volont de ceux qui
dsirent trouver un encouragement suivre les valeurs chrtiennes
dans leur vie quotidienne.
Ainsi, la CHARTE+ essaie de tenir compte des risques lis des
serments dengagements. Ceux-ci peuvent parfois se retourner
contre ceux quils devaient servir. Pour cela, la charte vise trou-
ver un juste quilibre entre de bonnes exigences sans que celles-ci
ne deviennent pour autant des fardeaux lgalistes destructeurs.
Lobjectif est de tenir compte de la faiblesse humaine en permet-
tant ceux qui le dsirent de sengager dans une orientation qui
vise lexcellence et le service avec une vision communautaire et
construite sur un concept de rseau.
233

Charte+

Choisis la vie...

Les trois lments de la charte


Les divers lments relatifs la charte se prsentent sous la forme
suivante :
1. Le document signer
&H SDSLHU RIFLHO HW QXPpURWp HVW FRQp
solennellement ceux qui sengagent suivre
ses directives dans leur vie quotidienne.

Aprs signature, les signataires sont invits
DIFKHUODCHARTE+ dans un endroit qui leur
rappelle leurs engagements.
2. Linsigne dor
La petite broche pingler avec le logo de
la CHARTE+ est un moyen de tmoigner
publiquement de ses engagements et de se
reconnatre entre signataires pour tisser des
UpVHDX[GHFRQDQFH
Si vous perdez linsigne, il est possible den
obtenir dautres en prsentant votre charte
signe.
3. Le prsent livre
Cet ouvrage dveloppe les divers thmes abords
par la CHARTE+ et permet dapprofondir
ces sujets concernant la vie personnelle,
communautaire et sociale.
Ds lors, il est possible de travailler en groupe
les divers thmes en utilisant les diffrentes
GpPDUFKHV HW TXHVWLRQV SURSRVpHV j OD Q GHV
chapitres.

Dfinition
Une charte est une convention tablie en concertation sur des
valeurs partages, sur un code de relation et de vie en commun,
qui explicite les droits et les devoirs de chacun.

234

Choisis la vie...

Charte+

Un engagement de bonne volont

Par ces caractristiques, la CHARTE+ sadresse tout le monde


en tenant compte aussi des particularits professionnelles. Ds
ORUVOHVSHUVRQQHVTXLH[HUFHQWXQHIRQFWLRQGLQXHQFHSHXYHQW
trouver dans la charte le moyen de crer des rseaux et des groupes
de partage dans leurs lieux de travail.
Le port de linsigne est aussi loccasion de pouvoir retrouver des
personnes qui partagent les mmes convictions.
$LQVLGDQVGHVFRQWH[WHVFRUURPSXVOHVLJQHSHXWGHYHQLU
un symbole qui permet de trouver des personnes qui partagent les
mmes convictions et qui dsirent aussi trouver des collaborateurs
intgres.

La CHARTE+ vise favoriser les aspects suivants:


Construire sa vie sur des fondements de foi prouvs et

solides.
Encourager lintgration des valeurs chrtiennes dans la

vie quotidienne.
Encourager les personnes de bonne volont agir selon

des principes visant au respect des autres et la justice.
Amener lglise prendre conscience de son potentiel de
dveloppement.
Prsenter

les bases spirituelles et morales ncessaires la
socit.
Promouvoir

et former des attitudes constructives dans les
cercles de la famille, de lglise, des services de sant et
de la socit.
Responsabiliser

les personnes exerant un rle de modle
dans la socit : mdecins, pasteurs, responsables,
hommes politiques, journaliste, etc.
&RQVWUXLUHXQUpVHDXGHFRQDQFHHQWUHOHVVLJQDWDLUHV

235

Charte+

Choisis la vie...

Qualification des signataires


La charte est rserve aux chrtiens et le signe plus qui la
symbolise fait rfrence aux bouleversements positifs que le
Christ a apports par la croix. Cette uvre divine tend apporter
un gain rel dans notre vie personnelle et dans la socit.
/DOLPLWDWLRQGHODFKDUWHDX[FKUpWLHQVQHVLJQLHSDVFHSHQGDQW
quils sont les seuls pouvoir vivre dans le respect des autres. La
charte signale simplement que ceux qui font confession de suivre
le Christ ont une responsabilit spirituelle et morale appliquer
dans la socit
Les personnes qui signent la charte doivent tre capables de
discerner la porte de leurs engagements. Pour cette raison, la
charte nest pas adapte des enfants de moins de douze ans.
Prix de la charte
Le projet de la charte est sans but lucratif et sinscrit dans le cadre
des actions bnvoles de lassociation ENTRAID.
Comme la ralisation des chartes, des insignes et du prsent livre
UHSUpVHQWH GHV FRWV FKDTXH VLJQDWDLUH SDUWLFLSH QDQFLqUHPHQW
en versant une contribution.
Il nest pas permis de revendre les lments de la charte un
DXWUH SUL[ TXH FHOXL TXL HVW RIFLHOOHPHQW [p 7RXWH SHUVRQQH
FKHUFKDQW j SURWHU GH FH SURMHW VH GLVTXDOLHUDLW HQYHUV OHV
valeurs dfendues par la charte.
Port de linsigne
Linsigne de la charte nest pas un label de perfection et celui qui
le porte doit avoir conscience de sa faiblesse : ses engagements ne
sont pas des acquis, mais ils font partie dun processus dynamique
vivre avec laide de Dieu. En consquence, la CHARTE+ vise
nous encourager les uns les autres pour marcher selon des valeurs
dexcellence.
Porter linsigne reprsente toutefois une responsabilit. Cela
indique lentourage quil peut sattendre des attitudes et
GHVDFWHVFRQIRUPHVDX[YDOHXUVGHOeYDQJLOH&HOXLTXLDIFKH
le signe publiquement doit viter que la CHARTE+ perde son
crdit par un manque de mise en pratique. Il doit en outre veiller
tre consquent et se comporter dune faon conforme ses
engagements.

236

Charte+

Choisis la vie...

Pour cette raison, il est ncessaire davoir une discipline personnelle


et dtre cohrent avec les valeurs dfendues.
Par exemple, une personne qui vole les autres, qui est corrompue,
qui trompe son conjoint et qui vit dans la mchancet doit enlever
le signe de la charte qui apparatrait, juste titre, incomprhensible
pour le conjoint ou pour lentourage ls.1
Dans un tel cas ou si un signataire scarte rsolument de ses
engagements et sendurcit, nous invitons ces personnes ne plus
porter le signe.
Se montrer digne de ses engagements
Les engagements de la charte et le port de linsigne doivent se
vivre dans un climat de grce rciproque et en vitant de se juger
les uns les autres.
Ce respect envers les autres doit toutefois conduire sencourager
observer les valeurs de la charte. Par exemple, celui qui voit une
personne porter linsigne tout en trahissant rsolument ses valeurs
a le devoir de lui en parler et dessayer de lamener reprendre
ses engagements.
Frres, si un homme vient tre surpris en faute, vous qui tes
VSLULWXHOVUHGUHVVH]OHDYHFXQHVSULWGHGRXFHXU3UHQGVJDUGH
jWRLPrPHGHSHXUTXHWXQHVRLVDXVVLWHQWp Galates 6.1
Parlez et agissez comme devant tre jugs par une loi de
libert, car le jugement est sans misricorde pour qui na
pas fait misricorde. La misricorde triomphe du jugement.
Jacques 2.12-13
*****

Que le Seigneur et lEsprit saint vous aident marcher selon


OHVYRLHVGH'LHXDQGHQWHQGUHXQMRXUFHWWHSDUROH
 &HVW ELHQ ERQ HW GqOH VHUYLWHXU  WX DV pWp GqOH HQ SHX
GHFKRVHMHWHFRQHUDLEHDXFRXSHQWUHGDQVODMRLHGHWRQ
matre. Matthieu 25.21
1

Lors dun tel chec, il est important de garder les bonnes valeurs et de reconnatre
la pertinence du projet de Dieu pour le couple et la famille. Ds lors, mme si je
QDLSDVSXPHPDLQWHQLUGDQVODPRXUHWODGpOLWpHQYHUVPRQFRQMRLQWLOHVW
LPSRUWDQWGHQHSDVMXVWLHUPHVIDXWHV

237

Livres dcouvrir

Choisis la vie...

Pour aller plus loin...


Ces ouvrages sont loccasion dapprofondir des thmes spirituels,
relationnels et pratiques. Ces livres (et dautres) peuvent tre
tlchargs gratuitement sur le site internet : www.shekina.com.
Du mme auteur
AIDE-CONSEIL: LIRE ET TUDIER LA BIBLE
Cet ouvrage est un outil destin vous entraner dans laventure de la dcouverte
biblique. Tel un guide, il vous offre plusieurs itinraires et aussi des points de vue
panoramiques pour saisir limmense tendue de la rvlation que Dieu a donne
aux hommes.
Ce manuel intgre plusieurs ressources dont un tableau historique, des cartes,
une prsentation des diffrents livres de la Bible, un dictionnaire, des listes de
thmes, etc.
Ce livre est un outil prcieux pour les personnes qui dsirent approfondir leur connaissance de la Bible, il
est aussi une prcieuse sources de connaissance pour tout ceux et qui exercent un ministre dans lglise.

ditions Entraid, 240 pages. Avec de nombreuses illustrations.

AIDE-CONSEIL: CRER ET GRER UNE ENTREPRISE


Ce livre dvoile les principes appliquer pour crer des richesses et prendre en
charge son destin conomique.
La prsentation des divers aspects thoriques saccompagne de plusieurs
exemples pratiques pour faire un budget, trouver un financement, faire de bons
investissements, grer la comptabilit, engager du personnel, etc.
Un dictionnaire explicatif et un outil visant faciliter lorientation professionnelle
compltent encore cet ouvrage.

ditions ENTRAID, 304 pages. Avec de nombreuses illustrations.

COMMENT BIEN GRER SON CAPITAL DE VIE?


Ce livre est une occasion de prendre conscience de sa valeur et de trouver le
chemin qui permet de russir sa vie en accomplissant le projet que Dieu a pour
nous. Son contenu construit partir du commandement suprme donn par
Jsus aborde les domaines suivants:
Spirituels (libration, conversion, adoration, dons spirituels, etc.).
Psychologiques (relations, gurisons, restaurations, etc.).
Intellectuels (ambitions, valeurs, trouver la volont de Dieu, etc.).
Pratiques (gestion du capital de vie, service du prochain, etc.).
Le livre contient des dmarches concrtes et peut tre utilis comme manuel de groupe pour suivre un
processus ddification et de croissance la lumire de la Bible.

ditions Carrefour - Entraid, 200 pages. Avec de nombreuses illustrations.

238

Livres dcouvrir

Choisis la vie...

Dans la mme collection

AIDE-CONSEIL : POUR PASTEURS ET RESPONSABLES


Ce livre, dit par lassociation ENTRAID, vise soutenir les pasteurs et les
responsables qui travaillent dans un contexte africain. Avec ses diffrents
articles, il aborde des thmes couvrant des aspects spirituels, relationnels,
sociaux, conomiques, etc.
Ce livre est utile pour avoir une vision panoramique de la place de lglise dans
le monde.

ditions Entraid, 208 pages.

Autres livres

MOSAQUE 1, une collection denseignements


Ce livre regroupe les soixante meilleurs articles qui ont paru dans le journal du
Lien des Cellules de Prire.
Ces crits sont le fruit de plus de trente auteurs diffrents de toute lglise corps
de Christ (vangliques, rforms, catholiques, anglicans). Il vous offre une large
palette denseignements sur de multiples sujets de la foi chrtienne et de la vie
communautaire.

dition Le Lien des Cellules de Prire, 304 pages.

MOSAQUE2, une collection denseignements


Ce livre, le deuxime de la collection, vous offre une large palette denseignements sur de multiples sujets de la foi chrtienne. Ceux-ci enrichiront et dvelopperont votre vision de lglise ainsi que votre vie de prire personnelle et
communautaire.
La diversit des richesses de ce livre en fait un prcieux outil de formation pour
la cration et la croissance des groupes de maison. Il sera galement un excellent
compagnon pour les responsables de cellules de prire et les intercesseurs.

dition Le Lien des Cellules de Prire, 272 pages.

FAITES DES NATIONS MES DISCIPLES


Cls pour une rforme de nos socits.

La puissance de lvangile pour transformer la vie dindividus a t clairement


manifeste ; mais quen est-il cependant des tnbres et de la misre qui
emprisonnent des cultures, voire des nations entires?
Dans ce livre, Darrow Miller dmontre que la vrit brise les liens spirituels et
peut aussi dlivrer des socits entires de la fatalit et de la pauvret.

ditions Jeunesse en Mission, dition Afrique: Entraid, 310 pages.

239

Notes personnelles

240

CHOISIS LA VIE...

CHARTE +

Vie personnelle, famille, glise, travail et socit


Notre humanit prsente dtonnants contrastes. Alors que la mchancet, la cupidit et la
cruaut de certains sexpriment dans le mal et la destruction, dautres agissent selon la justice,
construisent un monde meilleur et usent de compassion envers leurs semblables.
Ces deux voies opposes rejoignent la rvlation biblique selon laquelle lhomme est plac
devant un choix crucial et quil a la possibilit dorienter son existence vers la vie ou vers la
mort... Face ces deux destins, Dieu invite les hommes choisir la vie...
Ce livre nous entrane suivre cette voie en mettant en lumire les principes qui permettent
lhomme daccomplir sa vocation spirituelle, de dvelopper ses capacits personnelles
et dapporter de rels dveloppements dans les dimensions familiales, communautaires,
conomiques et sociales. Les thmes de cet ouvrage font ainsi cho lengagement de la
CHARTE+ qui permet daffirmer son attachement de justes valeurs.
Cet ouvrage est un outil prcieux pour ceux qui ont conscience des enjeux de la vie et qui
dsirent apporter de bonnes choses dans leur entourage. Avec son contenu abondamment
illustr et son approche interactive, ce livre peut servir lanimation de groupes.

Jacques-Daniel Rochat est mari et pre de trois enfants; il exerce


depuis plusieurs annes un ministre denseignement biblique
et de formation dans la francophonie. Il est lauteur de livres et
de contenus multimdias visant diffuser lvangile avec des
outils modernes de communication. Jacques-Daniel est aussi
le fondateur et le prsident de lassociation ENTRAID. Cette ONG
travaille dans les pays dfavoriss en cherchant soutenir le
dveloppement personnel et social avec les valeurs de lvangile.

ditions
ISBN : 978-2-9700685-0-1
C 100 M 70 J 0 N 30
R 0 V 58 B 123
Pantone 294C

Version B4F

C 0 M 80 J 10 N 0
R 234 V 139 B 141
Pantone 7424C

9 782970 068501