Vous êtes sur la page 1sur 116

PUBLICATIONS DE L'llSTITUT DE CIVILISATIOI lllDIElllE

aiRI IN_.. l'A8010ULS at


HYMNES
DE
ABHINAVAG-UPTA
'rRADUITS ET COMMENT:a;,:s
PAR
..
LILIAN SILBURN
0JRBCTBUK DB RBCBBRCBB
AU C8"TRB DB L R ~ R C H SCll!MTIPIOUB
DEUXIME DITION
PARIS
diteur : Collge de France
lnstitut de Civilisation Indienne
1986
Dpositaire exclusif : DE BoccAR ,DITIOND1PFUS10N
11, rue de Mdicis, 75006 Paris
PUBLICATIONS DE L'INSTITUT DE CIVILISATION INDIENNE
Srie in-8
Fasc. 1. RENDU (l.). - tudes diques et pii1.1inennes. Tome 1. 1955. 132 p.
(rimpression 1980).
Fasc. 2. RENOU (L.). - tudes vdiques et Tome Il, 1956. 154 p.
(rimpression 1986).
Fasc. 3. (A.). - Trois nigmes sur les cent chemins. Recherches sur le
Satapatha-Brhmm.za. Tome Il, 1956. 423 p. (rimpression 1987).
Fasc. 4. RENOU (L.). - tudes diques et pii1.zinen11es. Tome III. 1957. 136 p.
(rimpression 1986 ).
Fasc. 5. SILBURN (l.). - Le Paramiirthasiira. Texte sanskrit dit et traduit. 1957.
106 p. (rimpression 1979).
Fasc. 6. RENDU (L.). - tudes vdiques et pc1.1inen11es. Tome IV. 1958. 138 p.
Fasc. 7. SEYFDRT RUEGG (0.). - Contihutions /'histoire de la philosophie linguis-
tique indienne, 1959, 135 p.
Fasc. 8. Sn.BURl" (L.). - Viitlaniitlw-Siitra, mec le commentaire d"Ananta!wkti-
piida. 1959. 109 p. (2c dition corrige 1995).
Fasc. 9. RENOU (l.). - tudes vdiques l'i pii1.zi11e1111es. Tome V. 1959. 116 p.
Fasc. 10. RENOU (l.). - tudes diques et Tome VI. 1960. 86 P
Fasc. 11. VARENNE (J. ). - La Mahii-Nariirana-Upanisad. avec. en annexe. la
Prii11iignihotra-Upa11isad. Tome J : texte. et notes. 1960.
156 p. (rimpression i 986 ).
Fasc. 12. RENOU (l.). - tudes vdiques et p1.1i11e1111es. Tome VII. 1960. 106 P
Fasc. 13. Y (J.). --:- La Mahii-Nariiym.za-Upani.yad. Tome Il : tude. tables.
mdex et appendices. 1960. 146 p. (rimpression 1986).
Fasc. 14. ( L_). - tudes vhliques eT pii1.1ine1111es. Tome VII 1. 1961. 1 34 P
(rc1mpress1on 1980).
Fasc. 15. StLBURI" (l.). - Le Viji'iiina-Blwiram. Texte traduit et comment. 1961.
223 p. (rimpressions 1976. 1983).
Fasc. 16. ( L). - tudes Mique.\ et piii.linhJlm's. Tome J X. 1961. 1 34 p.
(rc1mpress1on 1980).
Fasc. 17. RENOll ( L). - tudes dique.\ <'I pninfrnnes. Tome X. 1962. 122 p.
Fasc. 18. RE1'iOU ( L). - tudes diqis et pi.;inennes. Tome XI. 1963. 146 p.
Fasc. 19. S!LBURN ( L). - La hhakti. Le Stamcinumani de Blw!{aniiriiym.za. Texte
traduit et comment. 1964. 160 p. (rimpression 1979).
Fasc. 20. REN<>U ( l.). tudl'S diques <'I p1.1i11c1111es. Tome XII. 1964. 129 p.
Fasc. 21. PADOUX (A.). - Recherches sur /a symbolique et de la parole dans
certains textes tantriques. J 964. 389 p. (rimpression 1975).
Fasc. 22. RENOU (l.). - tudes diques et pninemus. Tome XIII. 1964. 165 p.
Fasc. 23. Rt:Nou (l.). - tudes Miques t'I p;1i11e1111e.\. Tome XIV. 1965. 133 P
Fasc. 24. BIARDEAU (M.). - Bhartr:Jwri, lll'<'C la
de 1964. 194 p.
Fasc. 25. CAILLAT (C.). - Les expiation.
5
clans le rituel ancien des religieux jaina.
1965. 239 p.
Fasc. 26. RENou (l.). - f:.:tudes rdiques et pninfrnnes. Tome XV. 1966. 185 p.
Fasc. 27. RL:NOU (l.). - tudes vdiques et p1.;i11e1111es. Tome XVI. 1967. 186 P
Fasc. 28. Mlanges d'i11dia11ismc
1
la mmoire de Louis Renou. 1968. xxxix-800 p.
Fasc. 29. S1LBURN ( L. ). La Malurrlwmaiijar de Mahe.frariinanda, al'ec des
extraits du Parimala. Traduction et introduction. 1968. 229 p. (2 .... dition
corrige 1995 ).
Fasc. 30. Rt:NOU (l.). -- ludes diques et p1_1ine1111es. Tome XVII. 1969. VIll-
96 p.
Fasc. 31. StLBURN ( L. ). --- Hymnes de Ahhinaagupta. traduits et comments. 1970.
108 p. (rimpression 1986).
HYMNES
I>E
ABHINAVAGUPTA
PUBLICATIONS DE L'INSTITUT DE CIVILISATION INDIENNE
SRIE IN-S FASCICULE 8t
HYMNES
DE
ABHINAVAGUPTA
TRADUITS ET COMMENTS
PAR
LILIAN SILBURN
DIRECTEUR DE RECHERCHE
AU CENTRE DE LA. RECHERCHE SCIENTIFIQUE
Ouvrage publi avec le concours du Centre National de la Recherche Scientifique
dileur:
INSTITUT DE
CIVILISATION INDIENNE
DE L'UNIVERSIT DE PARIS
1970
Dpositaire exclusif:
DITIONS E. DE BOCCARD
1
1
RUE DE MDICIS, }
PARJS 6e
Premire dition : Institut de Civilisation Indienne de l'Universit de Paris,
1970.
Deuxime dition : Collge de France, Institut de Civilisation Indienne, 1986.
Collge de France, Institut de Civilisation Indienne, Paris
ISBN : 2-86803-031-9
AU SWMI LAJ\SHMAN BRAHMACARIN
INTRODU<mON
. Publis pour la premire fois en l 935 par le Dr 1(. C. Pandey
<\ la fin de sa thse intitule
1
Abhinavagupta, nn Hislorical and
Philosophical Study '
1
, ces hymnes sont presque inconnus en Inde.
Seuls le Swmi Lakshman Brahmacarin et ses disciples avaient
routume d'en scander les stances pour lesquelles ils avaient une
grande admiration
2
Grce lui la tradition orale, aprs une
apparente clipse, s'est renoue solidement, car le swami, trs
va nt par:icf.il mais nussi vritable yogin et jiunin, a mystiquement
vcu ce qu'exposrent les anciens matres sivates du Cachemire et.
rn particulier, Abhinavaguptn. Trs jeune il de consacrer
vie au Trika ; il tudia textes et manuscrits auprs de deux des
meilleurs pm;uf.il du temps : Hara Bhatta Shstrin et Rajanaka
Mahesvara
3
, acqurant ainsi une science profonde et tendue dans
toutes les branches de la philosophie et de la mystique sivate
c:ichemiriennc. C'est avec lui que lors d'un de mes sjours Srinagar
j'ai lu et relu les hymnes d'Ahhinavagupta; au cours d'une ving-
taine d'annes j'ai mis profit sa vaste connaissance du Tantraloka
qu'il m'a aide traduire
4
. Qu'il veuille bien trouver ici l'expres-
sion de ma profonde gratitude.
Deux parmi les stotra dits par K. C. Pandey ne sont pus
l. P. 409 sqq. The Chowkhanda Sanskrit Scrics. Varai:iasi; et dans la seconde
Mition de 1 n63 Appendix C, pp. sous le Litre' Philosophical Slotra of A.bhinava'
Aucun d'eux n'csL traduit.
'!. Le Swami possdc des copies dr. manuscrits que j'ai pu C11sultcr, clTccluanL sut
son conseil quelques amcndenrnnls aux textes dits par K. C. Pandcy. Sous le norn
de Pandit Lakshman Rain;] il a publi, en y ajoutant des notes personnelles, le
Bhagauadgiliirthasaf!l[Jrulw, c'csl.tHiirc la l3haguvadgita selon la recension Cachenti-
ricnne, :ivcc le commentaire de najanaka Abhinarnguplu, Srinagar, 1933. Aulrcs
uvres : Sri Kramanayupradipik, Srinagar, J n58 ; The $iu(1slotra1wli of Utpalmlev-
rhrrya, avec glose sanscrite de editcd will1 Hindi Commenlury by Rjrwka
C.S.S. Vara1.tasi, 1964.
3. A qui nous devons une cdllion critique des manuscrits du Trika dans la Kasinir
Series of Tcxls and
4. Mon prochain lrailera des voies de la libration qui s'y trouvent exposes.
-2-
inclus dans la prsente tude : la que le
Swami a rejete comme n'tant pas de la main d' Abhinav .. 1gupta
1
et le Kramastotra qui trouvera sa place dans un ouvrage ultricur
2

Par contre il m'a sembl utile de joindre cc recueil ln Bodhn-
opuscule qui n'a pas encore t traduit. Pt.
de la mme inspiration.
Abhinavagupta vivait au Cachemire 1<1 fin du xe sif>d1 d au
dbut du x1e. Sur sa vie nous savons peu de l'exception de
brefs renseignements qu'il nous fournit lui-mme en t;pilo-1w <111
Tantra.Io ka et au Paratrisikavivarana o il men Lion m le nom du
plus clbre de ses anctres, Atrigu.pta qui, invit au
par le roi Lnlityaditya nu milieu du nue sicle, s'y tablit dcf1n1-
tivement.
Abhinavagupta eut de nombreux nrntrcs et instructeur;-; p8rmi
les meilleurs de son temps d'o son extraordinaire culture
tous domaines : grammaire, potique, rhtorique, thorie.
dhvam, Tantra et _i\gama dualistes et non-dualistes, l1 brahmat'ldyu
(avec pour matre Bhutirja), les doctrines des coles l.\ runw. Trik
1
et Pratyabhijna qu'il tudia princip::dement avec L.1


disciple de Utpafodeva. Il dut sortir du Caclwmir<. et Jlnn-
dhara pour y approfondir le systme l(aulikn nuqwl il
semble-t-il, ses prfrences. Il y fut initi par i)ambh 1ma Uw ! le
plus vnr de ses guru, dont il obtint. outre ln et la
des initiations suprieures, ia pnix et la ralisation
ultime. Notons encore qu'il tudia auprs de Jam1 el.
de. Bouddhis_les Vijfianavdin qui curent lui
mfluence, reelle do.nt Il ne se dfend pns. Il reprend sa nwmer1
les problemes poses par eux et baic:rnc donc dans la mme atrno-
Il part:.lge av;c eux plus de points
avec Sankara, en dpit de la similitude du voc.abu laire frnployc
(alman, brahman, may).
De les mtaphysiciens et mystique>:; de l'Inde il Pst
1 un des plus puissants gniPs : iwr son et l'or1gt-
nahte de sa pcrsonnnlit il ruppcllr. un Ynj iiavalkyn : par l
1
1
: K C. Pau dey exprime des doull's i-l ci !>t1jd en rnif'on des
et q11'i1 y relve, p. 74-75, 2e Cl. .
' J
31
en une rtudt' sur l1s (\1111:1.1 /,tif; ci1L hr:ima ;
cet hymne ne prend sa vt!ri1able Sifrnification qu'associ;. tl1s comnw l'nnrien
Kramaslolrai le Paf1cafa1ika d clair par 11 cnmnwnlnir1' tl'..\hhin;wagHpln :111
ch, IV de son Tantrnloka.
3
d. Kasrnir Sanskrit Seril's of Tc:-:ts and Bombny. 1!l18. rnl. X 111
avec_ d'autrt>s courts opuscules. J'aurais volont l'rs ajout lrl P:1ryant 11p:1fH:,;ikft
par le Dr. V. Raghavan en 1951 si K. c. P;.mdey nr l'avait pour :1in!"i dire
traduite dans la seconde d. de son Alihinovo.gnpta, ch. Ill, p. 7:3-93.
-3-
profondeur et la subtilit de son esprit, il s'apparente Maitre
Eckhart, Ruysbroeck, saint Jean de la Croix. Simple et direct
comme eux, il jouit en plus d'une totale libert ; il peut exprimer
ses certitudes et mme ses expriences jusqu' la limite des possi-
bilits de la parole sans avoir redouter la condamnation d'une
glise. Il attira l'admiration unanime de ses contemporains, forant
mme celle de ritualistes troits qui faisaient autorit au Cachemire
et que visent maintes allusions de ses uvres.
Il suffit de lire attentivement ses ouvrages pour s'assurer qu'il
avait atteint les cimes de la vie mystiquei : il a l'ampleur de v_ue
et le regard limpide de qui a pntr la valeur des choses. Toujours
il s'attache la Ralit spontane, inne, la fois Consciene
vivante et plnitude indivise, ce qui n'implique aucun mrite de
sa part, puisqu
1
il y baigne. Jusque dans ses uvres les plus sp-
culatives comme sa glose aux Isvarapratyabhijiiasiitra de Utpala-
deva, il est au cur de la Vie parce que tout en lui est exprience
immdiate, celle de la Vie mystique intgre de faon parfaite la
vie quotidienne ; et cette vie il l'aimait en ses aspects les plus v:.ris
parce qu'elle se dployait au cur de la Vie divine. En tout et pour
tout un quilibre achev, la samala accomplie, les problmes
rsolus ; de l vient dans ces pomes une certaine insouciance,
la lgret d
1
un jeu plein d
1
humour qui ne manque pas pour autant
de profondeur.
On aimerait, po:;sdcr quelques .renseignements sur son mode
d'existence ; il est probable, mais non certain, qu'il demeura
clibataire, brahmacarinz, ce qui ne l'empchait pas d'initier ses
disciples au culte secret des Tantra selon les rites krama ou kaula.
De mme, sans tre un moine renonant (saqrnyasill), il initiait
des sarrinyiisin. Lui, l'adversaire du rituel, n'ignorait nullement les
rites tantriques qu'il exposa en dtail dans son volumineux
ka. Il n'a rien d'un pal)gil l'rudition thorique et
nanmoins il abonde en connaissances. Rompu la d1scuss10n, il
est bien plus qu'un dialecticien. On ne peut le compter parmi les
bhakla, ivres d'amour divin comme le fut Utpaladeva
3
; est-ce
dire qu'il ne possdait pas d'amour? Il n'est qu'amour, inais un
amour sobre et contenu, qui surplombe l'amour avec
son exaltatation et sa ferveur. En un mot, il dborde toutes les
l. Ne l'avoue-t-il pas lui-mme dans la Poramiirlhadvdasik, 10, l'l dans
l'Anubhavanivedana, sl. 3.
2. Telle est l'impr('ssion du swnmi Lak!,>mnn Joo qui a tant compuls ses uvrcs.
On peut imaginer ce que fut Abhivanagupla en vivant auprs de ce Swami.
3. Il ne cite presque jamais la Sivastotriivali de ce maitre qu'il admirait tant.
S'il prie Siva, c'est avec pudeur et humour; d'ailleurs ks hymnes ici traduits donnent
le ton de sa bhakti.
-4-
classifications et s'en divertit la manire de Siva revtant tous
les rles sans s'identifier aucun.
On peut se faire une ide de la qu'on lui attribuait dj
de son vivant par le portrait qu'en trace un de ses disciples,
Madhurja yogin, natif de Madhura dans le sud de l'Inde, et
saqrnyiisin errant qui passa quelques annes auprs de lui. Dans sa
louange en l'honneur du ' guru ', le Gurunathapariimarsa, il
commence par saluer les grands fondateurs d'coles et autres
mattres du Sivasme cachemirien, puis il s'incline devant Abhina-
vagupta et son disciple qu'il situe dans le cadre admi-
rable de la valle du Cachemire, parmi les vignes (si. 2-3), entours
de yogin et de siddha; aux pieds du matre, des disciples au cur
recueilli prennent par crit ses paroles ( 4). Ses yeux oscillent sous
l'effet de la batitude ; au milieu du front parat le signe lilaka
clairement marqu de cndres ; sa chevelure est luxriantc, sa
barbe longue et il est assis dans la posture yogique dnomme
vra (5). Sa main droite portant le repose sur sa jambe dans
l'attitude (mudr} de la Connaissance du suprme Siva. De la
main gauche il joue de la vl)ii (6). Lors d'une grande assemble
(melana)
1
il fut reconnu comme le matre incontest des coles
sivates : Siddhanta, Vma, Bhairava, Ymala, Kaula, Trika et
Ekavra; les guides spirituels et les yogin (18-19) le traitaient
avec tendresse. Madhuraja Yogin le proclame le meilleur des guru,
Je Dieu avalara de SrkaJ)tha (Siva) venu au Cache-
mire comme son protecteur, pouss par sa trs grande compassion.
II nous informe aussi que durant le sjour qu'il fit auprs de lui,
Abhinavagupta exposa la de Somananda, texte parti-
culirement ardu
1

Comme le Dr K. C. Pandey a consacr une tude approfondie
Abhinavagupta et que, de mon ct, je me suis tendue dans mon
Introduction la Maharthamafijar
2
sur les coles Kula, Krama
et Pratyabhij na dont cet esprit universel a glos les traits, ces
ouvrages je renvoie le lecteur afin d'viter d
1
inutiles redites.
A quelle priode de la vie d' Abhinavagupta appartienp.ent ces
l. SI. 37. Le Sri Guruniilhaparmarsa fut dit en sept. 1960 par
P. N. Pushp avec pour Appendice : Addilional Verses to M S. C (as edited by
Or Raghavan). Kashmir Research bi-annual, vol. I, no 1. J'tudierai de prs cet
hymne dans un ouvrage en prparation sur la kur:uf,alini.
2. La 1Wnhriliamafijari de Mahe8uarnanda. Traduction et Introduction par
Lifrn Silburn. Paris, J 968. Pour ceux qui ne pourraient se procurer l'ouvrage de
K. C. Pandey, cf. mon Introduction au Paramiirlhasiira d'Abhinavagupta, Paris, 1957.
galement la thse d'Andr Padoux : Rtchtrches .mr fa Symbolique et l' nergie d;,
la Parole dans certflins lexies lanlriques. Paris, 1963. Voir encore R. Gnoli : Essenza
dei Tantra, Torino, 1960.
-5-
hymnes e.t opuscules ? Il est difficile, sinon impossible, de le dire
avec certitude ; nanmoins ils me semblent prsenter des points
de ressemblance pour le fond avec ses deux commentaires la
ParatriSik que je considre comme ses derniers ouvrages
1
: le
Vivaral).a et la Laghuvrlti, c'est donc l que je puiserai surtout
les clairer. En crivant l' il avait prsent
1 esprit le texte de la ParatrSika. un de ses lanlra favoris.
Ces hymnes renferment l'esse'nce de son enseignement ; il y
exprime comme en se jouant mais avec une matrise extraordi-
naire sa Yaste exprience mystique. Le langage y est dense et sobre,
d'une grande beaut, avec un jeu d'allitrations que fait ressortir
la rcitation des paf)</il. En dpit de leur simplicit, ils sont d'un
abord difficile pour qui cherche pntrer leur vie profonde : ils
contiennent en outre de nombreuses allusions des doctrines
exposes par lui en d'autres uvres. Ils s'adressent en fait de trs
rnres disciples pleins <l'exprience et dont l'esprit subtil saisit ce
qui leur est transmis demi-mots et souvent de faon tacitc
2

La beaut de ces hymnes tient la libert dont jouit Abhinavagupta.
On l'y sent dgag des tches prcises qu'il s'tait assignes :
exploration des voies de la dlivrance dans le Tantraloka et les
commentaires au Malinvijayatantra, expos de ses positions
physiques dans la glose l' lsvarapratyabhijiikarika, enfin expli-
cations sur l'insurpassable et le manlra du germe du cur dans
les gloses au Paratrsikatanlra. Quant ses autres uvres, le
Tantrasara et la Tantravatadhanika, simples rsums du Tantralo-
elles ne prsentent qu'un intrt mineur. En dpit de leur
brivet, les hymnes ici traduits ont une valeur propre, d'o? le
choix que j'en ai fait. ..
Cinq d'entre eux sont des slolra la lounnge de Siva : la Para-
mrthacarc, le i\fahopadesavirpsatika, le Dehasthadevatacakra-
stotra, le Bhairavastava ou ostotra
3
D'aprs une lgende encore
vivante au Cachemire, c'est en rcitant ce dernier pome que
Abhinavagupta suivi d'un grand nombre de disciples _Pntra dans
la grotte Bhairava (l'actuelle Bhruva) pour y mourir.
L
1
Anubhavanivedana, offrande de sa propre exprience, peut
trc considr comme un hymne crit par lui puisqu'il faisait partie
1. Contre l'opinion de K. c. Pnney, op. cil., p. 30-31, mais en accord avec le
Swftmi Notons ce sujet que la Partrisik avec le vivarar:w. d'Abhinavagupla
P.SI. nppclc anuliarriprakriyi.
'2. cr. lntro<luclion ici p. 19 et p. 26.
3. D'aprcs K. C. Pandcy, Sobhkaragupla crivit une glose ce slolra en l'inter-
prtant la lumire du (p. 263). C'est une des uvres dates d'Abhina,.a-
gupta : 466 scion l're saplar!}i; Je Krnmaslotra fut. crit deux nns aprs, et l'une des
dernires, ln en 401JO, ans plus taret. Cf. op. cil., p. 9.
-6-
d'un cahier de slolra d' Abhinavagupta en la possession du pa.Q.fjit
Hara Bhatt,a Shastrin; pour le swami aucun doute ne
pJane ce sujet.
Les trois traits sont de courts opuscules qui clbrent la
Conscience absolue sous les noms d'anutlara, de paramiirtha,
Ralit ultime : la Bodhapacasika 1, la Paramarthadvadasika,
(appele aussi Advayadvadasika) et que je consi-
dre comme tardive. AbhinaYagupta s'adresse ici, non plus Siva,
mnis nu lecteur et la fin de la seconde il parle mme au nom
dr ;;iva.
Dans toutes ses uvres, nous le verrons, Abhinava se place
d'emble au foyer de l'exprience mystique et en ce qu'elle a
d'essentiel, sans pourtant rien sacrifier de son immense richesse, car
il la survole, l'clairant d'une lumire globale o chaque chose se
situe dans sa perspective relle.
L' ABSOLC ET LA NON-VOIE
L'absolu tant indiffrenci dfie toute description, d'o le double
sens cl' anullara, terme-clef des hymnes, inexprimable et inacessible
toute dmarche
2
; rien en efTet ne peut rvler l'absolu ou conduire
lui puisque, toujours prsent, il est l'vidence mme . .Mais par
contraste avec la ralit que forge l'homme ordinaire, Ahhinava-
gupta le dfinit comme la Ralit inne, spontane (sahaja), la
grce au perptuel jaillissement3, insistant ainsi sur la gratuit du
don, sa libre spontanit. Il en fait un domaine total ( dhman ), sans
fissure, sorte de rceptacle universel que n'affecte pas ce qu'il
J. uYrc ancienne, de l'poque srmlJle-t.-ll du Pnramarlhasra. Dans son Mlinivi-
jay<n-firtiJrn, Abhinavagupla ln cite comme son uvre propre et donne ln stance 8
rn entier 371372).
en celte seconde signification la non-voie (anupaya ). Sur l'amzltara,
voir p. '21.
3. Ht1ysbrocck <lcrit de faon analogue comment se renouvelle sans interruption
la noissance ternelle de Dieu l'occasion de l'avnement du Christ : c C'est une
gnrnlion nouvelle, une illuminaton nouvelle qui s'accomplit sans cesse. En effet
le fond d'oiJ jaillit la clarL et qui est celle clart mme, est plein de vie et de fcondit.
Aussi la rvla lion de la lumire ternelle se rcnouvclle-t-elle sans cesse dans le secret
de l'esprit ... Et l'avnement de !'poux est si prompt qu' vrai dire II est toujours
l, demeurant avec ses richesses infinies, cl qu'll est toujours en train de venir,
personnellement, sans cesse ni relche, d'une venue nom.elle parmi d'aussi nouvelles
clarl!S, Lout comme s'il n'tait jamais venu auparavant. Car son avnement lient,
hors du temps, dans un instant ternel qu'on saisit toujours avec un nouveau plaisir
et de nouvelles joies. Noces spiriluelles. Ruysbroeck. uures choisies. Traduites par
J .-A. Bizet. Aubier, p. 355.
-7-
du firmament (vyoman), immensit vide et
mfimment lgre parce que sans poids ni contrainte, et
heat1tude apaise d'une incomprhensible simplicit .
. S'agit-il du brahman neutre tel que l'entendent certains Vedan-
Je ne le pense pas : bien qu'immuable, la Ralit pour le
Tr1ka n'a rien de passif ; c'est une force vibrante qui se renouvelle
relche, la fois fraiche et fconde, car cc domaine est celui
de Siva dou d'nergie, fokli, partout rpandue. On le dsigne par
le mot spanda, Vie cosmique qui nous traverse sans cesse, flue dans
tous nos tn ts, veille, rve, inconscicncc
1
; ou plutt nous vivons
l'intrieur d'une fulguration de vibrations instantanes, mais si
,ives et rapproches qu'incapables de discerner un spanda du
!'Uivant, nous ne percevons qu'immobilit l o il y a une extrme
\jvacit de mouvement. Par contre nous apprhendons les mouve-
ments grossiers l'chelle de notre pense et de nos sens.
Ainsi la Rnlit doue d'une puissance illimite se rvle, pour
qui la reconnat, source d'une force inpuisable ; sa vibration
chnppc qui ne peut ln dceler.
Cette premire diffrence entre Sankara et Abhinavagupta porte
donc sur l'autonomie de la Conscience : Siva est pour tous deux
lumineux pnr soi (svapralriifo) et, de surcrot, pour le second,
L libre prise de conscience de soi' (vimarfo): Siva, suprme
lumire de Ja Totalit. est unique et conscience de soi indivise
2
,
Abhinavagupta dans la Paramarthncarca.
De l vient une autre diffrence non moins importante et qui
mnccrne l' advaya. Chez Smi.kara, partisnn de l' advaita, sous sa
forme la 1iJus riaourcusc, !'Un-sans-second, seul rel, pure indff-
t:) l"
(nirvikalpa) exdut toute tendance la dualit, au ieu
que I'advaya du Trika, prsentant comme le Tout unique dont
iien n'est exclu, englobe advaila et dvaila; et si le difTrenci
( vikalpa) se dploie, c'est toujours l'intrieur mme de l'inditT-
rrnci ( niruikalpa ). Tel est le thme sous-jacent ces
parec qu 'i) eonstitue rexprience la plus haute laquelle ALhma-
Yagupl:1 <iit nccd ; il donne parfaite satisfaction l'esprit et
restitue it l'expression jvanmukli son sens profond de 'libert
,cue en pleine multiplicit '. On le retrouve oans ln Bodhapuiica-
dnsikfi qui, <ls les mots, clbre le Tout. : Cet Un dont
l'esscnre esl l'inimuHLlc Lumire de toutes les et <le toutes
1.-s et en qui lnhres et clarts rsident, P-st le Dieu
souyer:.1in mme, na tut(! inne de tous les tres (1 ). Cette essence
1onLienL le lien et ln liLrution ( 14) ainsi que les trois nergies :
1. cr. S11:111d;1:--tra, :1 l'l sn1 Ir- s1>nnda, acte p11r cl \"ibranl.
'!. Si11s<tr!Wirl;1hn11.: qrii 1".q11i\ a11l il. uimar.),1, :i.
-8-
volont, connaissance et activit dont elle est la source indiff-
rencie (15). Sous r angle de la flicit, le Bhairavast:w expose
au verset 6 une ide similaire. enseigne que, mme
di"frencie, l'illusion n'est autre que la Conscience-sans-second (3);
et plus loin el.le insiste: tout ici-bas, ternel et transitoire, ce qui est
pollu par l
1
illusion et ce qui est pur dans le Soi apparat glorieux
dans le miroir de la Conscience ds que ]'on a reconnu le Soi (8).
La Paramarthadvadasika
1
prcise que la Conscience renferme le
conscient comme l1inconscient, Siva tant le suprme firmament,
rceptacle de l'alternative : dualisme et non-dualisme, et vide
lumineux qui claire les distinctions d'existence et d'inexistence.
Du point de vue de l'adoration, le Mahopadesaviq1satika ne dit
pas autre chose : qui Tu es toi et moi je suis moi
1
en qui Toi
seul es, et moi je ne suis pas, et en qui il n'y a ni Toi ni moi,
Celui-l je rends hommage (2). Du point de vue de l'activit on
Y trouve encore : Tu te rvles Ton gr comme un acteur assu-
mant les rles qui lui sont propres : veille, rve, Rommcil profond,
mais en ralit Tu ne joues aucun rle (10).
Pour iJlustrer ce thme fondamcnt::il, Abhinavngupta revient
dans la plupart de ses uvres )a mtaphore du miroir
2
: voque
la quatrime stro.phe de la Paramarthlcarca, elle est dveloppe
son Paramarthasara (12-13) : De mme que des villes et
:'.aris. se dans le disque d'un miroir commr, non
difierenc1es, bien qu'ils se rvlent distincts les uns des autres
du miroir galement, ainsi procd;rnt de la
immaculee du suprme Bhairava cet univers tout en tant lU1
indiffrenci semble spar (de 1;i et fait de
parties mutuellement distinctes.
Pour. ces partisans de l'aduaya _ s:ins second - tels Sankara
et se pose le problme de la du::ilit et de ln diff-
renciation ; considrant le et l'indiffrenci comme
Sankara fait appel une
1
indfinissable ' nescicnce
pour Ahhin.avagupta par contre, diffrenci indifT-
renc1e peuvent se manifester du fait que la Conscience qU1 les ren-
ferme tous deux possde une tot.alc libcrt
1
son gr l'un
pour dvoiler l'autre et vice versa. A Sakara qui soulient que la
Conscience en tant que brahman revt des formes varies sans
qu'il faille postuler un pouvoir libre et souvPram (.foaralii},
. l. la slancP IO. Cf. Paryanlapai1casik:, :51. '.!-I s11r Bhnirava.
Eckh<1rl disait. nussi :
/1
l' Essrnce uni Ile cl enferme tout ('n soi ... Dans celle treint H
Toul se c>n To11l, car, l, Toul t.irnl Tout enferm r.n soi. :\fais c>n soi-
rr_iemc reste quclquP chose de non form pour sni. JI <E1wres de .H11rlre Hckharl.
1radttcl1011 P8ul Pclil. Paris, l!J-t-2, p. 77.
'2. \"oir cc st1jcl. l'explic:il1on p. 3-t :=;qq.
-9-
Abhinavagupta objecte : Si l'essence consciente est une et que 1n
dualit a la nescience pour cause, qui appartient cette nescience ?
Au brahman? Impossible, lui dont la nature unique est connaissance
(vidyii); et il n'y a certes rien d'autre, aucune me individuelle,
? qui. elle puisse appartenir. Si vous allguez sa nature indfinissable,
a qm paraitra-t-clle sous cet aspect ? .. Vous affirmez que le brah-
man - tre (sal) - brille- de faon indiffrencie en son unit et
que la diffrenciation est due l'[llternative
1
; mais alors de qui
relve l'activit (source) du uikalpa? Est-ce du brahman? En ce cas,
associ ln nescience (il n'est pas omniscient) ; et quel autre
pourrait-on rattribuer ? Si vous prtendez que la connaissance
indtermine ou indiffrencie (nirvikalpa) est relle tandis que fa
connnissnnce dtermine (vikalpa) est irrelle, d'o vient une telle
distinction ? Toutes deux ne sont-elles pas galement manifestes ?
Et si vous dclarez irrel le diffrenci bien qu'il se manifeste, je
rpondrai que l'indifTrenci semble irrel aussi ds que se montre
le diffrenci, car prendre conscience dP. lR fausset d'une chose est
la consquence d'une prise de conscience oppose. Et Abhinava-
gupta de conclure : mme si nous sommes d,accord avec vous pour
admettre la ralit d'une conscience unique (sans-second), nous ne
Yoyons pns comment pourrait exister une activit revtant
formes multiples - ce qui marque la prsence de l'agent2; mais
tout cela devient possible si l'on accepte initiative et libert en
tant que dsir d:action. Ainsi le Seigneur de par sa suprme libert
ne se rvle pas totalement libre : il manifeste le sujet limit,
dpendant, et . travers lui l'objet peru. Tel est le pouvoir de
l'illusion {mayasakli) du Seigneur3 qui s'amuse se mystifier. lui-
mmc en sorte que la Conscience du Je parfait, omniprsent, libre,
Herne], identique Siva, n'est plus vcue.
Il n'y a donc rien expliquer, puisque le jeu de cache-cache
entre Siva et son nergie relve de la libert divine. un
hyrnne
4
Abhinavagupta montre Bhairava et Bhairav, identiques
par essence, reprsents comme ardhanaresuar, mi-homme, mi-
femme, qui se plaisent se distinguer a fin de se connatre et. e
jouir l'un de l'autre ; mais ce jeu diamour dans la flicit devient
par le libre vouloir de Bhairava alternatiYe asservissante au stade
de l'individu qui a sa gloire native.
De maya, illusion, Abhin:..1vagupta utilise clans ses
hymnes Je terme moha que je traduir: nuLant que possible par
1. 1 kalpa, pe11s(e q11i rruc1"dc pnr choi:-.: dial1rl CJllf'.
'2. Pour k Trikri.
3. Je suis ici <l1 pri's l.P.,., ,ol. Il, Jl. 128 n11 li.Ill.li.
,1. Ici p. 87.
-10-
confusion ; en efTet
1
par son trouble d la non-intuition de notre
vritable nature, elle engendre l'erreur en brouillant l'intuition
lucide ou conscience de la plnitude de soi. Partout on dcouvre
son empreinte ; qu'il s'agisse du dsir : elle fait pencher un des
plateaux de la balance grce aux faux poids de la valeur, et l'galit
d'esprit se perd ; la vie selon l'horizontale s'tirant douloureuse-
ment dans le temps el dans l'espace, remplace la pure verticale.
De mme quant au souffie qui, tiraill droite et gauche, perd
l'lan vers le haut, et quant la_ volont, o rgnent incertitude et
hsitation. De son ct la pense ne peut trancher les doutes qui
l'assaillent ; que l'esprit soit concentr, fix sur une seule chose
aux dpens de tout le reste, son quilibre est compromis, il fait
pencher lourdement l'un des plateaux de la balance; qu'il soit
distrait, allant sans rpit d'une chose il hmtre, dchir entre deux
possibilits et alors la balance oscille, d'o alternative et dualit
inceRsantes qui le rendent incnpable de juger parce qu'il voit le
monde et lui-mme dans le trouble et la confusion.
Plutt qu'une ignorance, moha est une connaissance limite de
l'essence totale, et donc savoir (vidya}, mais non trs pur savoir
(fo<:'dhavidy)1. Abhinarngupla le dclare dans ln Bodhapaiica-
das1ka : L'imparfaite connaissance de cc (Bh<tira\"a), c'est elle
q.ue l7on considre comme Sa libert, Pile. en \'rit, la transmigra-
tion, terreur des tres horns ( 11).
, La confusion en trois t:lpes : d'abord perception de
l essence comme hm1te lorsqu'on s'imagine tre soi-mme dpour-
vu de ; puis ,-ision de la diffrenciation qui fait dsirer
co?1L?e les formes qui en sont prives ; enfin son appro-
prwt10n quand interviennent les tendances inconscientes bonnes
et mauvaises. J>t
, soumise l'illusion, ne peut apprhender l'essence
ver1table a laquelle elle surimpose 11 alternative du bien et du
mal.' une chose qu'en l'opposant une autre.
l?d1fTerenc1ee, la Reaht globale est si simple qu'elle nous chappe.
Nous ne devons donc pas la chercher dans le prolongement d'une
de nos activits : on ne peut la saisir ni par l'motion,
m par la pense, ni par l'art, ni par une conduite vertueuse, ni au
d'une recherche intrieure. Religion, thologie, sagesse philo-
sophique, activit artistique, ascse en un mot tout ce factice
(krlrima) ne peut conduire l' Inn. Comment en effet le difTrcnci
e.t le limit aideraient-ils atteindre le non-difrcnei el le sans-
limite ?
1. Sur l'illusion. cr id p. 61 Sfl<{. tI p. 67, i 1.
'!. P.T.v., p. I.
- 11 -
alors de quelle manire accder l'anullara? Est-ce par
l'abandon de tout ce qui n'est pas transcendant ou autrement '!
Le trouve-t-on dans la dlivrance ou dans ce que l'on prend tort
pour la servitude ?
1
t. Par la grce, et par elle seule, rpond Abhina-
vagupta, fidle aux Tantra et aux mattres du Trika. Si avant le don
misricordieux de Siva on ne dcouvre nulle part l'insurpassable
plnitude ( anultara), ds que l'nergie divine- survient avec abon-
dance, on la dcouvre partout.
La grce est pure gratuit, libert totale de Bhairava dont on
jouit sans savoir comment, un jour par aventure
2
, sam; effort ni
mrite propres, absorption et contemplation n'tant, elles aussi,
qu'un efTet de la grce ; et le mattre. Jui-mme agit sous son incita-
tion, se contentant d'carter les obstacles a fin de permettre la
Ralit de resplendir. Pourtant ds qu'on baigne miraculeusement
dans l'indiffrenci, on peut reprendre pied dans cet univers qui,
sans perdre ses caractres distinctifs, trouve sa vritable place
l'intrieur du Tout indiffrenci. Le corps et ses organes diviniss
tant imprgns de la tranquillit de la Ralit sans fissure, alors
art, posie, philosophie, conduite vertueuse, prennent un
sens parce qu'ils se dtachent sur le fond indtermin qm leur
donne vie et relief.
Si d'une part la Ralit demeure ternellement prsente el si,
d'autre part, calme et flicit constituent la nature inne de
l1homme, l'impuret lui tant originellement trangre, quoi
peuvent servir les moyens de libration ? Pourquoi s'efforcer de
polir le miroir de la Conscience que rien ne peut ternir ?
Ahhinavagupta accueille la fois mystique du
mystique de l'instantanit et mystique de l'intemporel qu'il a
exposes de faon exhaustive, les distinguant avec clart dans
les nombreux volumes du Tantraloka
3
et dans d'autres de ses
uvres et commentaires.
Ces distinctions dpendent uniquement de la puret des individus
et de la grce reue par eux. Les voies graduelles visant la
cation de l'esprit et des sens, s'adressent des tres plus ou moms
parfaits, soumis de multiples limitations et jouissant d'une grce
faible ou moyenne .. La voie de l'immdiat et du simultan (yugapal)
1. Le toul entier consiste Pn une n\ponse ce 1.-atham, comment,
pos par ln Desse a Siva, P.T.v., p. 32.
2. h'c1ll1aiicit, en quelque sorte, I.P.V. I.l.1. Cf. 'Por lodn la hermosura ',
de saint Jr1.1n dr la Croix, o la volonl gote la divi1w 'eu un je ne sais quoi
riue l'on :1lteint d'annture. \Gustala en un no s qu
que se halla por
3. Ch. 1, IV d \"pour 11:; voies de la purification. Voie de Siva, ch. Ill. Anupya,
ch. r 1.
-12-
ou voie de Siva s'offre au yogin dj purifi ou qui ne requiert
aucune purification : sous l'effet d'une grce intense, il se ramasse
en un lan de tout son tre qui le soulve instantanment par del
ses limites. Mais du point de vue absolu, celui d'une mystique de
l'ternel et de l'intemporel, les voies sont parfaitement inutiles
(anupya).
Il n'y a donc pas d'opposition fondamentale entre ces mystiques
pour la raison qu'en Paramasiva, Lumire contenant toutes les
clarts et toutes les tnbres
1
, se concilient la marche la dli-
vrance et l'Un en qui n'existent ni lien ni libration. En tant que
Libert absolue et totale, le suprme Siva enveloppe les voies pro-
gressives, l'accs subit et spontan, et !'Inn - cet anuUara l
o point n'est besoin ni de suivre un chemin ni de passer outre ,
selon une des dfinitions qu'en donne Abhinavagupta
2

Faisant allusion aux diverses voies, Abhinava montre comment
elles s'quivalent dans le Seigneur: C'est la dualit, c'est la diff-
renciation, et aussi le Sans-second ... de la sorte Paramesvara se
manifeste dans sa lumineuse Essence mme
3
Et d'une manire
plus prcise, l'objection : Comment atteindre Siva l'aide d'une
activit intellectuelle dpendant de la pense, du moi limit, etc.,
eux-mmes d'un tat objectif ? Il rpond : ces
1i;itellectuelle.s infrieures ne sont en effet que les modalits de Siva ;
si, par elles, il drobe son essence, par elles aussi il dvoile sa propre
Sple:deur. l'!'est-.il pas dit dans le Matangda que Siva remplit
les mveaux mfr1eurs comme les plus levs ? La lumire de la
Conscience brille donc dans ces tats4. En d'autres termes les
vikalp? se pur:fient peu peu sur un fond indiffrenci (nirvikalpa);
sans 11 n'y aurait pas de devenir ( sarrzsiira) et il serait inutile
de se ; sans. on ne le pourrait pas. De.
que S1:va se be, qu il se libre par tapes ou soudam, qu 11
de s.a hbert ce sont l les rles qu'il revt simulta-
nement, le Jeu prestigieux auquel il se plat.
Les rapports entre voies progressives et absence de toute voie
s'inscrivent dans la mtaphysique gnrale du Trika5, entirement
axe sur la des trois nergies divines : volont, ?onnais-
sance et activit. En leur essence indiffrencie de batitude et
sous forme de l'unique triang}ee, elles ne sont que Parama-
l. sl. 1.
2. Ici p. 59 et P.T.v., p. 25.
3. 'yal(L bheda idam advaita ity api 1
prakasauapur evayal(L bhasate paramesvarah Il T.A., 11. l H.
4. T.A., 1. 222-224. .
5. Systme des 'triades', cf. ici le tableau p.
6. Trisiila, sur ce triangle du cur, cf. La Blzrtl;ti, pp. 34-35 el ici p. "26.
-13-
ultime par-del l'extase {luryiilia) atteinte
sans ( anupya). Ds que l'une d'elles prdomine,
elles se d1stmguent et engendrent les trois moments de la difren-
ciati?n .; alors l'univers se manifeste; quand il retourne l'indiff-
renc1at10n, elles forment les trois voies principales du Trika.
J'examinerai donc ces voies sous I1angle des trois instants durant
lesquels surgissent en une rapide succession les trois nergies qui
couvrent, ce faisant, le domaine entier de l'exprience humaine :
Rien n'apparat qui ne repose dans la triple nergie consciente
s'exprimant par je veux, je sais, je fais 1>1; on ne peut les sparer,
car ce qu'un homme en icchiisakli, il le sait en jnna.Sakii
et l'accomplit en kriyasalcii. .
Le premier instant, celui du pur sujet in.difirenci (nirvikalpa),
au-del du temps et de l'espace, est le moment naissant de toutes
les_ activits, celui d'une sensation immdiate, globale et vidente,
qm se manifeste essentiellement comme ' Je ', avant qu'appa-
raissent connaissnce notionnelle et objet connu. L'intensit de la
volont sous forme de dsir de voir ou d'agir etc., prdomine dans
ce vide thr d'o seul merge un regard de pure


En ce premier instant o la vie sourd, la multiplicit est en
germe puisque tout rside dans le vyoman du cur. Cette vibration
initiale du cur se produit avec une singulire intensit chez un
mystique tir brusquement du nirvikalpasamdhi, c'est--dire
d'une absorption profonde sans pense. Parmi les aspects :raris. de
cette vibration notons l'intention-choc qui s'bauche, mtent10n
de parler, d'agir, de se remmorer ou de percevoir une chose avec
incapacit fugitive de le faire, d'o un rythme vibrant qui contient
dj ce que l'on apprhendera avec clart _rinstant suivant, et
qui a lieu l'intrieur mme de la conscience.
Particulirement sensible au mystique, cette exprience ne lui
est pas exclusive ; en tout tre le Je conscient vibre, s.ans cela ni
connaissance, ni activit ne seraient possibles ; mais l'homme
ordinaire ne le peroit pas parce qu'il ne peut s'immerger dans la
srnit de sa conscience.
La inlaphysique et la mystique du systme Spanda s'inscrivent
dans l'exprience du premier instant, celui du Je encore indiffren-
ci : de cette phase suprme dcoulera la phase subtile de la connais-
sance, et de celle-ci la phase plus grossire de l'activit, le suprieur
l. Tacca icchii ua kriycl v<i j11{inam v1 sarvarrz vastu icc!imi karomi jnmi
va ity evaf!lbhlaiimarsafoktivisriinlya vin na jlucid avabhti, P.T., Laghuvrlti,
p. 17, l. 3.
2. Sarrwinmlradrgullsa, P.T.v., p. 39, 1. 13 ou prthamik<ilocana. Sur ces lrois
moments, cf. M.M., pp. 36-37.
-14-
contenant toujours, selon le Trika, l'tat infrieur en une cascade
d'efficience dcroissante (P.T.v., p. 80 et S.n., p. 4, l. 15).
Le second instant o prvaut l'nergie cognitive (jfunafokli)
donne lieu la perception diffrencie au niveau des alternatives
et des notions (vikalpa) ; cherchant connatre, on se saisit des
caractres distinctifs et, ce faisant, on quitte la plnitude indiff-
rencie du Je et le repos en soi-mme. Le tu remplace le Je.
Le troisime instant progresse davantage vers l'objectivit
diffrencie : l'objet en relation, construit dans l'espace et dans le
temps, projet hors du sujet et de sa connaissance, sert des fins
pratiques. Tel est l'objet connu de la sphre de l'activit (kriya5akii)
' il ' face au ' tu ' et au ' Je '.
A ces trois moments s'apparente une triple vision de l'univers :
l. Intriorit ( anlaralva) de la sphre du sujet connaissant ; le Je
y brille en sa puret le monde indiffrenci existe comme la
vibration consciente du suprme Sujet.
2. ( grhyalva) de la sphre de la connaissance ;
l'univers manifest dans la seule pense est peru intrieurement
en tant qu'impressions de plaisir et de douleur; et nous savons
que de nous il procde puisqu'il dpend de notre manire d'appr-
hender les choses. Il diffre donc pour chaque individu.
3. (bahyalva) de la. sphre de l'objet connu ; le monde
qu.1 apparat comme extrieur est pour tous identique et relve
prmcipalement de notre activit!.
D'aprs le Samuccayatantra : Cet univers se trouve intgrale-
ment Siva, en ttnergie et dans l'individu (nara), qu'il s'agisse
des activits des insectes ou de celles des omniscients
2
Ainsi le
rside tantt dans le pur sujet ( pramatr ), tantt dans la
connaissance (pramr:za) et tantt dans le connaissable (prameya);
jamais il ne disparat, qu'il soit latent l'intrieur du sujet cons-
cient ou qu'il soit projet l'extrieur, de multiples faons.
Quant aux voies libratrices rpondant ces instants et
mettant respectivement en uvre les trois nergies, une brve
explication suffira puisque les hymnes prconisent le seul
se . contentant de faire allusion aux voies suprieures. Ces t:ois
vmes ont pour but d'tendre la Conscience, de la rendre plus lucide,
chacune en son domaine particulier3.
1. T.A. IX, p. 10, comm. sl. 7. Sur tes trois personnes P.T., p. 79 80.
2. NarafaktiSiuve.Si uiSvam etat sadii slhitam 1 uyauahcire krami1)f!l ca sarvajiianaf!l
ca sarvasal;l Il Cit par Abhinavagupla dans le vivaral)a la P.T., p. 80.
3. T.A., I 156. Abhinavagupta dfinit comme auarpa prathana, expansion
de sa propre essence identique la conscience. cr. l'article du Swami Lak!?man paru
dans la revue indienne _Vitasta en aot 1966, p. 81. Sur les trois voies, cr. M.M., p. 42 sqq.
- 15 -
1. voie de ou <lu sujet conscient, s'exerce
par-dela la pense ( n irvikalpa); elle aiguise et largit la conscience
?e la vol?nt propre au premier instant de l'acte ou de la sensation,
mstant hbre encore immerg dans le Je. Pour s'tablir dfinitive-
da!1s l'indiffrenciation exempte de pense s'offrent rint-
r1eur meme de cette voie trois itinntires dbouchant sur la
Conscience universelle : A. Pariimarfo. Reoit le sceau de Siva
( sambhavamudra) celui qui voit en lui-mme et sans vikalpa tous
les pponmes du premier A au dernier JI, fusionnant en un point, Je
bindu, aql, libert dans l'acte de connaissance, d'o le mantra aham,
Je
1
II prend conscience que phrases, mots et phonmes sont iden-
tiques l'anulfara: la phrase d'abord brise en mots, ces mots
en sons, <.:es derniers se perdent dans le Son ultime
depourvu de toute sonorit. Il sait alors qu'il cre l'univers intgra-
lement en lui-mme sous forme de sons. B. Pralibimba, sous forme
de reflet. Le yogin demeure attentif ses activits cognitives et
sensorielles comme se refltant dans Je miroir de sa propre cons-
cience2 ; si sa vigilance ne flchit pas un seul instant, il pntrera
dans l'uniYerselle Conscience. Il devient alors matre et protecteur
de l'univers reflt en lui-mme. C. Prnahanl, a fin d'atteindre
le Je en sa plnitude, ou affermir et la conscience
du Je, le yogin prend de fermes assises dans l'lan du Je au prenner
instant de tous les mouvements de la connaissance et de l'activit.
Il voit l'univers entier se fondre dans le Soi plein de la flamme de
la grande illumination perptuellement surgissante

Tel est
bhairava apais, suprieur aux deux phases prcdentes de cration
et de sustentation.
2. Saklopya, voie de l'nergie, dveloppe la conscience _dans le
champ de la connaissance (pramal)a) et se situe au second
Elle purifie les penses (vikalpa) en vue de mettre un terme a la
constante alternative et d'atteindre l'unit sous-jacente. Afin de
restituer la conscience sa nature universelle, son dynamisme et
son acuit originelle, le yogin s'absorbe en une seule ide : ' je suis
la conscience universelle ' ; sa vigilance doit tre telle qu'aucune
autre pense ne vienne briser la chane de sa conscience. Mais une
absorption analogue peut se produire spontanment lors d'motions
violentes, colre, amour, terreur, etc.; quand, sous l'effet d'une
extrme excitations, tout bouge, tout frmit, les structures habi-
tuelles se dissocient tandis que s'effondrent notions et bavardages,
1. Cf. ici p. 45 et citation du T.A., 111.'26.
2. Cf. ici p. 41.
3. SariodilamahbodhajriciljaJilaliilmani J visuarri drauati mayyetacl i1i pasyan
prasumyati, T.A., Ill. sl.285.
4. T.A., IV., si. 3 7.
5. Cf. M. M . , p. 31, 41.
-16-
impressions du pass, projets d'avenir, cette crote superficielle
de l'tre formant un insurmontable cran. Accul au rel, en une
exprience immdiate, sans possibilit de choix, bloqu sur le
moment prsent vcu en toute son intensit, la personne entire
du yogin vibre l'unisson, et le miracle peut se produire : l'excita-
tion naturelle redevenant nergie divine.
Ou encore, en prsence de deux ides, un yogin fixe sa pense
dans l'intervalle et s'il effectue une perce leur jonction, quittant
soudain la dualit, il parvient l'unicit de la Conscience
1
$aklo-
piya est la voie des attitudes mystiques (mudr<i) et des formules
(manira) dont l'efficience se ramne celle d'une intuition unique,
fulgurante, confinant l'illumination du pur Sujet conscient ; en
d'autres termes, le mouvement de la pense discursive, lche et
fluctuant recouvre tout coup sa nnture d'acte libre et vibrant.
3. T).avopya ou voie de l'individu appartient au troisime
instant, celui du connu ( prameya) et de la totale diffrenciation ;
elle insiste sur l'effort, car elle cherche claircir et largir la
conscience de l'activit, grce de multiples pratiques : karar:za
quant aux organes de la perception et de l'action, uccara quant
aux souilles dans l'inspiration et l'expiration, contemplation
(dhyana) pour la pense fixe l'intrieur du cur, mditation
sur les aspects de la divinit
2
, etc.
l'hymne intitul ' Offrande de sa propre exprience ',
Abhmavagupta voque implicitement les phases marquantes de
ces voies ; P.ourtant le yogin ne s>lve pas du niveau infrie.ur
mveau suprieur comme on s'y attendrait ; bien au contraire
de la rvlation de r alman pour revenir vers les plans
de les intgrer au Soi3. Au premier moment ( prva-
ko/i j, le yogm, en sa propre essence, y entrevoit le
Il un premier coup d'il autour de ; il
JOUit d une exper1ence immdiate mme le Je et sans notions
(niruikalpa). Au second moment n' cherche percevoir et, accdant
la sphre de la connaissance, il apprhende les choses de faon
distincte. A l'ordinaire, si l'on cherche s'emparer de quelque chose
afin de connatre, on se prive ncessairement de !'Essence indiff-
au cas prsent le yogin conserve la conscience du
S01 qu il fait pntrer dans la connaissance de son propre corps et
dans celle des choses. Au troisime moment il l'intgre son acti-
vit. au niveau de l'objet connu, dans le but d'_utiliscr
cclm-ci a des fins pratiques. Il efface ainsi les ultimes vestiges de
1. Cr. V.13. si. 61-62 et sl. 56, p. 163 sqq.
2. Cf. le Dehaslhadcvatcakraslolra, ici p. 87.
3. C'est 1:1 l'ucccira du Soi conscient mentionn dirns Je Tantrilloka V. 62.
-17-
l'igi:iorance et de la projection errone vers l'extrieur en imprgnant
touJours plus de sa propre conscience et son corps et le monde
1
,
d'o sa libert tous gards. Quand le tour complet est achev,
l'univers parvenu au diapason du Soi baigne en anupiiya, les voies
s'annulant d'elles-mmes, et la non-voie se confond avec la libre
spontanit de Siva. En cet ineffable anupiya, douleur, plaisir,
lien et libration ne font qu'un; tout y est sans forme, soustrait
au temps. Les trois nergies s'unifient dans la flicit ( ananda) et
s'y dissolvcnt2.
Alors, ayant retrouv ses assises en son ternelle essence, le
yogin dcouvre avec merveillement que jamais il n'a quitt le
domaine de la batitude : Par del la voie de Siva ... il y a la
suprme Connaissance qui vince tous les moyens, c'est l'anullara,
repos sans gal dans l'nergie pleine de flicit
3

Abhinavagupta consacre le second chapitre du Tantraloka
l 'anupya, en vue, dit-il, de discriminer le domaine de 1' Insur-
passable ( anultaradhman) (sl. 50). La Ralit mme de la
Conscience resplendissante de son propre clat n'a pas tre rvle
par des Yoies ou des procds. Quel qu soit le moyen - interne ou
externe - il ne peut tre que l'essence inne de Siva, sa pure et
simple nature lumineuse ( 15 ). Si le moyen invoqu est inconscient,
il n'a pas de vritable existence et ne peut servir d'intermdiaire ;
et s'il est conscient, il n'a rien d'un moyen, c'est I'anupiiya, Ralit
immdiate (9-10).
En ce cas, Siva tant pure lumire, vidence mme, conscient de
soi et par soi, ne brille-t-il pas comme sujet percevant dans. le
cur de tous les tres ? Oui, rpond Abhinavagupta, mais bien
qu'il y brille, il n'est pas vritablement apprhend, assimil de
faon intime par le cur et ce qui n'est pas assimil par le. cur,
mme existant, c'est comme s'il n'existait pas, ainsi les feuilles et
l'herbe (du chemin pour quelqu,un) qui passe sur un char. ' Il n'y
1. Loka ('I. mme vifoa dsignent en premier lieu le monde des humains el en second
lieu la nalurt-\ et les choses. Il s'agit donc ici d'un yogin en contact avec les autres
hommes, de la manire dont il les peroit ou ragit leur gard, ainsi que des vne-
ments qui le louchent.
i. Ruysbroeck dil de mme : R Dans cette simplicit toute pure de l'essence divine
il n'cxislc ni connaissance, ni dsir, ni activit; car c'est l un abime sans mode o
n'atteint jamriis aucune comprhension active. Le Royaume des Amanls, ch. IV. Trad.
J .-A. Bizet, p. 147. C'est la nudit et le sans-voie o l'on accde la plus haute des
h1'-:=.tlilucs. Dans le Liure de la 'Vrit (ch. X}, il s'tend sur l'ternelle flicit
divine donl dpendent ciel et terre, vie et tre, d'o juillissenl la grce cl la gloire.
3. T.A., 1., sl. 242, p. 255. J'alo 'pi paramaf]1 jnnam upiiydi1Jivarjilam 1 iinanda-
.foktiuintam anuttaram ihocyale Il La pure flicit qui rsulte de cette
fusion est cc qui caractrise l'anupiiya.
4. 1"nni1 [/rlihakarfipm!I sarVtZsya l1rdrz!Je sphura/i.. 1 salya17i sphurilam api na
lattvalo hrdayafzgamr bhlaf!l 1 lrrdaya;1gam bhtvena 1..tin bhlflm apy nbhiitam eva
rulhyigamnne tmapanpdivat 1 Laghuvrtti, p. 3, 1. 1.
18-
a donc pas de comprhension profonde, pas d
1
assouvissement,
aucun pouvoir surnaturel, ni de relle libert.
Tout est toujours l sitt l'identit reconnue ; obstacles sur la
voie et moyens utiliss s'vanouissent comme s'ils n'avaient
jamais exist ; mais ne fallait-il pas qu'ils existassent pour que cela
ft possible ? De mme si l'on ne fait rien, la Ralit demeure
perptuellement prsente sans que l'on puisse nanmoins en jouir,
comme un trsor oubli1, depuis toujours vident et source pour-
tant d'une incroyable stupeur lorsqu'on s'en avise. Tel est le para-
doxe de la mystique; de l procdent les apparentes contradictions
d'Abhinavagupta que ron peut rduire en distinguant sa suite
deux acceptions du terme anupya: pris au sens strict ou au sens
de moyen trs rduit. Dans le premier cas il se confond avec la
Ralit elle-mme, l' anultara, et relve, non de la pratique, mais
d'une pure thorie, d'une sorte de logique spirituelle. L' Anutta-
abonde en ce sens : coute ceci, ne prends ni ne laisse, tel
que tu es, jouis heureusement de tout ( l ), demeure bien tabli en
toi-mme (2) . Tout est essence trs pure prouve par soi-
mme. Ainsi ne te fais pas de soucis inutiles (3) &.
En effet, l'on n'acquiert pas une chose nouvelle, au contraire
l'i!lusoire surajout au Rel se dissipe comme par enchantement et
laisse l' lnefTable ( anullara) dcouvert. Alors que dire davantage
sur l'anupiiya en tant qu'absence totale de voie ? Si l'on veut en
parler, il faut descendre d'un chelon et lui donner le sens de
moyen _extrmement rduitz. Abhinavagupta examine d'abord
les avec lesquelles il ne faut pas le confondre : est-ce la
concentration (avadhana)? Sur quoi se concentrera-t-on ? sur la
plnitude ? inutile car il faudrait tre la plnitude pour en tirer
profit ; sur son absence ? en ce cas la concentration sera strile,
ne pouvant mener la plnitude (si. 12). Est-ce le yoga ou une autre
forme d'activit? Le mouvement des organes auquel il est associ
ne peut avoir lieu dans la plnitude ; n'existant que par l'anupiiya,
le yoga ne peut servir d'intermdiaire conduisant lui. Si l'on
soutient qu'il a pour fin de rvler l'anupaya, comment serait-ce
possible, puisque pour apprhender ce qui brille par soi-mme, le
moyen de cette apprhension n'est autre que cet clat mme (9) 1
Abhinavagupta vise ici de son ironie les niais qui essaient de
distinguer !'Essence l'aide d'un moyen direct comme si l'on utili-
1. cr. ici p. 57.
2. Alpopyalua Il, p. 3, l. 4 comm. au sl. 2. Abhinavagupta le comprend ainsi dans
l'l.P.v. comme une reconnaissance de soi en tant qu'omnipotcnl, omniscient cl iden-
tique au Seigneur; et dans le P.T.v. comme une prise de conscience du manlru S.4 U U
ou germe du Cur.
-19-
sait un insecte phosphorescent pour voir le soleil ( 14). En fait,
celui qui reoit avec abondance la grce intense du Seigneur sans
qu'aucun effort personnel ne joue, ralise spontanment la terre
de Paramasiva ou domaine du Cur. Et l'eflort, simple manifesta-
tion de l'illusion ohscurcissante, ne peut tre le moyen de connaitre
la pure Lumire par-del l'illusion ...
1

Puisque ni connaissance discriminatrice, ni contemplation, ni
yoga, ni raisonnement n'offrent aucun secours non plus que vertu
ou mrite, ce moyen se ramne une transmission de la grce de
maitre disciple : le martre est immerg dans ]a Conscience bhai-
ravienne - donc en anupaya - et le disciple, trs pur, libr de
tout vikalpa, bnficie d'une grce des plus intenses'. Sa seule
discrimination consiste repousser toute discrimination, ne pas
chercher discerner bien et ma1, libration et servitude, etc. Il a
pris conscience qu'aucun chemin ne conduit Siva, ni connaissance
ni adoration, et qu'il n'y a rien faire pour l'atteindre, Lui le trop
Proche, pas mme s'lancer vers lui, vu qu'en lui tous les chemins
s'achvent. Ainsi convaincu de sa propre impuissance, il compte
uniquement sur la grce divine qui le conduira au maitre en
anupiiya et celui-ci, sans eflort, lui permettra de pntrer la
Conscience plnire. Il rend hommage de la sorte sa Conscience
bhairavienne comme la plnitude qui se passe de m.oyens
d'approche
3
, se gardant soigneusement de faire d'elle un obJet ou
de connaissance ou d'adoration. Et lorsqu'il rencontre ce matre,
a la certitude que celui-ci baigne dans la Ralit et peut sa.ns
mtermdiaire lui accorder le suprme ' darsana ', une telle convic-
tion intuitive tant ici indispensable'.
La compntration du matre en anupaya et du disciple qui en
est digne se produit de faon immdiate ; ce n'est pas une exp-
rience rpte (II. si. 2) ; une seule parole du matre suffit .souvent
pour que le disciple jouisse de cette ternelle compntrat1on
5
. Ou
l. Yady apy oyiiladff!hesuarasakliptasya suayam eveyam iyal paramasiuabhrmir
abhyeti hrdayagocararrt na tv aira svrtmiyal]. ko 'pi nirvahali 1 .. l.P.v.
1.1.l, p. 7.
2. Tvrativrasaklipla, comm. p. 7, l. 9. Il s'agit, notons-le, d'une chute de la grce,
tandis que dans l'anupya pris au sens strict, on repose toujours dans la grcc ou, plus
exactement, dans la gloire de Siva.
3. Trnitanl de ces tres immaculs, Abhinavagupta prcise : Taira ye nirmallmiinn
bhairaviyf!l suasamvidam 1 nirupyiim upasins taduiddhil]. prat;?igadyale 11 Il. .
4. Pour ce type de transmission, si l'on peul la nommer telle. Il sait que la connais-
sance mystique possde par le matre n'a de valeur que par l'anupya, Il, p. 10.
Sur le maitre el sa transmission cf. dans Herms n<>4, 1967, mon article: La transmission
myMtique dam le Shivasme du Cachemire, p. 158-175, en particulier p. 165 sur la commu-
nion immdiate.
5. Tanlrasara, ch. II, dbut. Cf. T.A. IV, 203, p. i34. CL l.P.v. I.I.l fln du comm.
-20-
encore le disciple contemple son matre en anupaya et s'identifie
lui (1 comme on allume une lampe une autre lampe
1
; il brille
ensuite du mme clat que lui. Cette compntration se traduit en
pure batitude.. .
Lt anupaya concerne aussi les tres qui, purifis par la flicit de
la Consciencet ont eu accs au chemin de l'Insurpassahle ( anullara)
et ne dpendent plus d
1
aucun moyen (II.sl. 34). Demeurant dans
une parfaite batitude, ils gotent partout une mme saveur2.
L'ensemble des choses se manifeste intgralement eux comme
(toujours) gal et, bien que visible, absorb dans le feu de la
Conscience bhairavienne
3
Pour eux, dclare Abhinavagupta,
bonheur, douleur, angoisses, doutes, penses dualisantes se perdent
totalement dans la parfaite absorption (sl. 36).
C'est parce qu'ils sont plongs dans la Ralit immdiate
atteinte sans intermdiaire que les choses quoique prsentes se
consument dans la fournaise de l'unit divine ; purifies, transfi-
gures et rendues subtiles par le feu de la Conscience, elles rayonnent
d'une vie nouvelle. Car cet immense feu embrase et dvore sans
distinction, ramenant tout au sein de l'indiffrenciation : l'homme,
ses tendances, sa pense, ses organes, ainsi que le monde par lui
1. ... Di.pdd dipam ivoditam cit. du comm. T.A. II, p. 34, I. 10, 40.
2. T.A. II. corn. p. 28-29. Dans La Pierre brillanle, ch. IX {et dans tous ses autres
ouvrages} Ruysbroeck crit des pages admirables sur la rencontre essenli.elle avec
Dieu sans interruption et. sans moyen, dans la nudit de notre nature . C'est le sans
voie abysmal waylessness , o brille perptuellement le simple rayon de la Splendeur
de Dieu, o nous avons nos assises et qui nous lire hors de nous-mmes jusque dans la
sur-essence ... l'Esprit divin en nous consumant nous anantit en son ipsit. Et dans
le. got de la vie ternelle nous sommes engloutis par-del la raison et sans raison
dans la quitude profonde de la divinit ; et ceci doit tre prouv par soimme et
de nulle autre faon. Comment, o, pourquoi ? ni raison ni pratique n'arrivent le
savoir, car nous ne pouvons ni apprhender ni comprendre le Bien abyssal que nous
gotons ni entrer en lui par nous-mmes ou au moyen de nos exercices. c C'est donc
sans voie et sans manire, dit-il, que Dieu se donne dans l'union sans intermdiaire.
Il crit encore la fin des Noces Spirituelles que ce mode consiste s'lever au-dessus
de toutes choses une entire disponibilit el dtourne l'homme de toute preoccupa-
tion l'gard des choses, l'levant audessus de toute activit et de toute vertu. Une
telle union est pour Ruysbroeck comme pour Abhinavagupla c insondable balitudc,
batitude tellement unique et sans voie que toute distinction s'vanouit Liuu de la
suprtme Vrite, ch. XII. N'est-ce pas cela qu'aspirait aussi Al-J:lallj quand il chan-
tait : Unifie-moi, o mon Unique (en Toi) en me faisant vraiment confesser que Dieu
est un, par un acte ou aucun chemin ne serve de route ! , op. cil., Diwan, P 76.
3. idaqi samabhli saruato bhuamar:if!alam 1
eua saqiuillibhairavgnivil<ipilam 11 II .35.
4. Telle est la perception du multiple dans le niruikalpa. Ruysbroeck dit au sujet
des contemplatifs transforms au point de ne plus faire qu'un avec la divine clart :
Ils contemplent Dieu et toutes choses, sans distinction, d'un simple regard dans la
divine clart. C'est ici la forme de contemplation la plus noble et la plus utile laquelle
on puisse parvenir en cette vie. Fin des Noces, J .-A. BizeL, op. cil., p. 360.
- 21-
peru. Pourtant si les choses se consument au fur et mesure de
leur apparition, surgissant du Je et y retournant, elles ne dispa-
raissent pas ; au contraire, l'tre purifi a la vision d'un monde
immacul, vibrant et glorieux comme lui puisqu'il en est la source.
Tel est le sens profond d'anullara: la diversit toute entire
resplendissant en sa nature relle en tant qu'inexprimable absolu
qui chappe aussi bien l'immanence qu' la transcendance, toute
dualit vanouie, dans l'identit parfaite de Siva et de l'nergie
1

Les simples conseils donns par Abhinavagupta prennent leur
valeur la lumire de ce brasier unique : en chose perue,
dit-il, il faut rester veill sa vritable nature, la Conscicnce
2
;
de faon plus explicite, percevoir la non-diffrence dans les
divers aspects d'un objet donn, et l'on constatera qu'il n'y a pas
d'incompatibilit entre vie pratique et absorption dnns l'essence
du suprme Seigneur. a
Puisque le donn est identique l'anuUara, Insurpassable\ c'est
de lui qu'il faut partir et ne jamais le repousser. En tout ce qui
s'coule, ne voir que la Conscience, sans rien capter son pro fit,
sans devenir la proie de l'motion. Dans l'motion la plus intense,
rester attentif la vibration propre au seul Je et apte le rvler.
Mieux encore, dans l'illusion mme, ne voir qu'un
de Siva. Ceci, nanmoins, n'est possible qu'en l'absence de soucis,
d'agitation, en laissant tomber l'attachement au moi, ses biens
matriels et ses biens spirituels, tel le dsir du samdhi et les
proccupations qui l'accompagnent. Il fat savoir aussi de
manire s'effectue le passage de l'indiffrenci au
comment partir de l'Unit on forge chaque instant une multi-
plicit.
On peut, ces conditions remplies, se tenir apais leur point de
jonction, au Centre universel, dans l'lan de la bhairavmudrtf>,
prompt faire surgir, son gr et en connaissance de le
diffrenci hors de l'indiffrenci puis l'y replonger. Tout
se rvle comme la libre expression du Je absolu.
Tel est le thme que dveloppent h)mnes et opuscules d' Abhina-
vagupta.
l. P.T.v., p.
2. si. 5.
3. eva ca 11p!iy11ry
na tu vyavah<iro 'py ayaf11 ili
pratipditam 1 I.P.v Il.JIT.13, vol. 11
1
p. 117.
4. P.T.v., p.
5. cr. ici p. 46.
PARAMASIVA
prt;riihanla . .... . jagadananda . ........................ anupaya
Je absolu flicit cosmique non-voie
MANJFESTATJON
siva ....... Je .... l er instant .... pramatr ...... ... icch.fokli .. .......... anlaralva .. .... .. Mmbhavopya
sujet connnis- v o o n t ~ intriorit voie de Siva
sa nt
nirvikalpa
fokli ..... .. tu .... 2e instant .... pramiit;1a .... ... . jlitinafokli ..... ....... grahyalva .... ... . Mktopaya
nr.rgie connaisRnncr. nergie cognitivr. pr.rceptibilit voie de l'nergie
vikalpa
nara ..... .. il. .... 3e instant .... prameya . ....... kry<ifokti .. .......... bahyalva . ...... l)avopaya
homme objet connu nergic-nctivit extriorit voie de l'individu
~
-23-
BODHAPANCADASIK
1. Anastamitabhrpas tejasrp tamasam api 1
ya eko 'ntar yad antas ca tejarpsi ca tamarpsi ca Il
2. Sa eva sarvabhtanarp svabhaval) paramesvaraQ 1
hhavajatarp hi tasyaiva saktir g,aratamay 11
3. saktis ca saktimadrpd vyatirekarp na vancchati 1
tdtmyam annyor nityarp vahnidhikayor iva Il
4. Sa eva bhairavo devo 1
svatrnadarse samagraJTl hi yacchaktya prntibimb'1tam Il
para devi svarpmarsanotsuka 1
prQ.atxarp yasya nalpurp na cadhikarn Il
d 1
u cYo 'nay dc,ya nityar11 kri{arasotsukaJ:i
vicitran vidhatte yugapad vibhul) 11
7. atidurghatnkaritvam asyanuttamam eva yat J
etad eva svatanlratvam aisvaryarp bodharpata 11
8. paricchinnaprakasatva1p jagasya kila 1
ja<Jad bodho yato na parimiyate Il
evam asya svatantrasya nijasaktyupabhedinal). 1
svarupatvena sarsthitati Il
10. \.:aicitryam atyantam rdhvadhas tiryag eva yat l
bhuvanani tadamsas ca sukhaduhkhamatir bhavaQ. Il
. .
11. yad etasyaparijnanarp. tatsvatantryarp hi varr:iitam 1
sa eva khalu sarp.saro jaQ.anarp yo Il
12. tatprasadarasad eva gurvagamata eva va 1
sstrad va paramesasya yasmat kasmad upagatam 11
13. yat tattvasya parijnanarp sa paramesata 1
lat prr:iatvarp prabuddhanarp jvanmuktis ca sa smrta Il
-24-
14. Etau handhavimok!?au ca paramesasvarpatal_l 1
na bhidyete na bhedo hi tattvatal) paramesvare 11
15. ittham icchakalajiianasaktislambujasrital} J
bhairaval) sarvabhavanal!l svabhval} parislyate 11
16. sukumaramati s ~ y n prabodhayit1=1m afijasa 1
me 'bhnavaguptena sloka:Q. pancadasodtal:t 11
- 25 -
QUINZE STANCES SUR LA CONSCIENCE
1-2. Cet Un dont l'essence est l'immuable
1
Lumire de toutes les
clarts et de toutes les tnbres, en qui clarts et tnbres rsident,
c'est le Souverain mme, nature inne de tous les tres; la multitude
des choses
2
n'est rien d'autre que son nergie souveraine.
3. Et l'nergie ne se pose
3
pas comme spare de l'essence de
<'clui qui la possde. Il y a ternellement identit des deux comme
du feu et de son pouvoir de brler.
4. Lui, le Dieu Bhairava, a pour caractristique de maintenir
l 'univer.s tout entier reflt, grce cette nergie, dans le miroir
de son propre Soi.
, 5. Elle, la suprme Desse, s'adonne la prise de consci_ence. de
l essence de celui mme dont la plnitude en tout ce qm existe
n'augmente ni ne diminue.
6. Ce Dieu s'adonne ternellement au plaisir de jouer avec cette
Desse ; omniscient, il suscite de faon simultane les diverses
missions et rsorptions.
7. Telle est son incomparable activit, minemment difficile
accomplir ; telles, sa libert sa souverainet, son Essence cons-
. '
c1ente de soi.
8. Certes une lumire consciente limite caractrise l'inconscience;
par contre la Conscience n'a pas pour caractristique l'inconscience
parce qu'elle n'a pas de limite
5

9. Ainsi les missions el rsorptions se manifestent cause de
leur propre essences l'intrieur du Soi, elles dont la diffrenciation
l. Textuellement 'qui jamais ne se couche'.
2. L'objecti\'it toute t>ntire.
3. Vanch- a.spirer, Afllrmer, ou sens habituel de dsirer, ne peut. tre ainsi traduit, car
ce stade lev6 il n'y a pas de dsir; l'nergie se sait insparable de Siva, elle ne peut
lre spare de lui et ne le sera pas. Plus ~ s seulement., en icchii, il y aura volont,
intention.
I. Cl. V.B., 51. 19.
5. Ce verset est frq11emment cit par Abhinavagupta lui-mme dans son Mlini-
vijayavarlika I.371-372 {avec variante mita 1 pariccl1inna, il y nomme ces strophes
Prabodhapaiicadasik) aussi I.P.vivrtivirnarsin, vol. II, p. 7 et vol. 111, p. 25.
G. On pourrait aussi comprendre qu'elles se manifestent comme la propre Essence
de Siva - cc qui revient d'ailleurs au mme - elles n'ont d'autre essence i,rritable
que l'tre libre.
3
26 -
dpend des nergies spcifiques de Celui qui est (essentiellement)
libre.
10. Leur extrme diversit, ces mondes en haut, en bas, inter-
mdiaires et ce qui les constitue, voil l'existence
1
doue de plaisir
et de douleur.
11. L'imparfaite connaissance de cc (Bhairava)
2
, c'est elle que
l'on considre comme Sa libert, elle, en vrit, la transmigration,
terreur des tres borns
3

12-13. Inclination de Sa grce, tradition du matre ou traits
religieux, que par l'une ou l'autre de ces approches s'veille la
Connaissance parfaite de la Ralit - le Seigneur suprme -
voil la dlivrance, la plus haute souverainet, la plnitude des
tres illumins, voil encore cc que l'on nomme libration en cette
\"e.
14. En ralit aucune diffrenciation n'existant en Paramesvara,
ces deux, lien et librntion, ne sont nullement spars de !'Essence
du Seigneur suprme.
15. Ainsi entrc-t-on en contact de faon rpte avec Bhairava,
nature inne de toute chose, qui repose sur le lotus du trident form
par les nergies : connaissance, activit subtile' et volont .
. Abhinavagupta a compos ces quinze versets afin d'clairer
mstantanment les disciples l'esprit dli
5

1. Bhava de 8rir12stlra, le monde du <.icvcnir qui relient prisonniers les
ignorants.
2. Sur lequel reposent missions el rsorptions des mondes .
. 3 . . Jatj.a, au 8 ga1emcnt, lourd, inerte, insensible et stupide, d'o conscience borne.
4. Kalii dsigne ici l'aclivil subtile avant Loute dirrrenciation grossire; clic
deviendra ensuite activit ordinaire (kriyci).
5. Sukumiira, leur pense est fine, dlicate, vive et subtile; ils ralisent de faon
instantane ce que leur leur indique demi-mols ou d'un clin d'il. Que celui-ci
:firme : ' tu n'es pas assr.rvi' et ils peroivent aussitt leur libre nature. Mais on
peut encurc comprendre: 'ceux dont Ja pense n'est pas arrive maturit', anjasa
prendrait alors le sens de.: 'correctement.
-27-
COMMENTAIRE
Abhinavagupta commence par poser la non-dualit telle que
l'entend le systme Trika : savoir Paramasiva-le-Tout, Lumire
immuable, source des clarts et des tnbres de ce monde, image
laquelle il accorde une valeur mtaphorique puisqu'on la retrouve
dans la stance d'introduction de sa Laghuvrtti; il y salue la Splen-
deur sans pareille, clart de (toutes) les clarts et tnbre de
(toutes) les tnbres, contenant au plus haut degr et clarts et

Il ne chante donc pas une lumire sans ombre, sans vie.


Si Paramasiva n'tait pas la lumire clairant d'une manire
ineffable les tnbres de l'ignorance, comment prendrait-on
conscience de ces tnbres ? Ainsi tout sujet conscient, en quelque
tat qu'il se trouve, matre ou disciple, ou bien engag dans les
affaires temporelles, toujours et en tout ce qu'il fait, participe .
ces activits l'intrieur2 de cette suprme Conscience; mais
comme il n'en a pas une apprhension distincte, il l'ignore. Ne
constate-t-on pas une chose analogue lorsqu'on a pleur durant le
sommeil ou l'ivresse sans en garder le souvenir au rveil ? Avec
surprise on se rend compte de cet tat si une autre personne vous
l'apprend ou si subsistent dans le corps certains symptmes, tels
des sanglots. A noter pourtant une diffrence : dans le sommeil .on
:ie voit pas d'objets distincts parce que l'on repose en
inconscience ( moha) tandis que dans le quatrime tat o
la conscience, on ne les peroit pas en raison de l'identit du sujet
connaissant et de l'objet connu
3

Il reste alors expliquer de quelle manire clarts et obscur1tes
se jouent dans la lumire unique. L'nergie (fokli) qui les engendre
n'est pas spare de son possesseur, Siva, de mme que le. pouvoir
de brler ne se distingue pas du feu. En Lui - miroir lummeux -
elle reflte l'univers diffrenci. S'y dployant en ombres mou-
vantes, le monde cache la splendeur du miroir sans en ternir compl-
tement l'clat, car c'est la lumire divine qui rend les ombres
visibles. Ainsi l'nergie de la Conscience donne vie aux diverses
expriences psychiques et, s'il est vrai que ces expriences obscur-
1. Yalra /1!jasi tejrr1si tamcirJ1Si ca tamasy alam 1
tejf!1si ca lamiif(lsy etad vandejyolir anullaram 11
'2 . trxt. apr{s tre entr, 'de l'intrieur ' est prfrahle puisqu'on ne
sort. jamais de la Conscience.
3. P.T.v., rsume de la p. IO.
- 28-
cissent la lumire indivise
1
, elles en attestent aussi la manifestation.
A l'occasion d'autres hymnes j'approfondirai cette mtaphore si
riche du miroir, frquente dans les uvres d' Abhinavagupta : le
trs pur miroir, Siva, rflchit l'univers en sa totalit et de faon
globale, mais il le maintient en lui-mme seulement comme un
reflet. Malgr cette attnuation, le terme ' maintenir ' voque
aussitt la dualit de soutenant et de soutenu
1
ce que le langage
et la pense discursive ne peuvent absolument pas viter. Il s'agit
en ralit d>un jeu entre Siva - Conscience indiffrencie - et
son nergie qui s'amuse troubler le clair miroir. Comment le fait-
elle? par la prise de conscience de soi (vimarfa), la fokli se dis-
tingue en quelque sorte de Siva a fin de le mieux dcouvrir et de
l'aimer sans jamais pour autant se reconnatre spare de lui
2

Cette prise de conscience va mettre l'univers en branle. Celui-ci,
glorieux d'abord s'il se mire n Mahesvara, le meilleur des miroirs
o il se voit en son essentielle beaut, apparat fragment et confus
quand l'nergie en ternit la surface.
Devr, desse, selon l'tymologie de div-
3
, signifie d'aprs Abhina-
vagupta' jouer'. La Desse dborde de flicit lorsqu'elle considre
l'univers manifest graduellement par elle comme sa propre nature.
C'est l son jeu. Quant lui, Bhairava, il prend part ce jeu avec
ardeur. Un tel jeu se rduit une incomprhensible activit, car
simultanment il met et rsorbe des mondes varis. Comme il
transcende le temps et l'espace, ses missions et rsorptions
demeurent ncessairement simultanes. Ceci s'explique si l'nergie,
limitant sa prise de conscience, agit la manire d'un cran qui va
et vient sur le Soi indiffrenci : ds qu'elle voile une portion, elle
en dvoile une autre.
L'nergie met toute sa ferveur dcouvrir Siva et lui s'amuse
avec elle cache-cache. Si elle se montre il se dissimule et vice versa.
Mahesvarananda illustre ce jeu par hmage du taureau et de
l'lphant dessins de telle sorte qu'au moment o l'on peroit
run, l'autre disparat; l'angle de vision changeant brusquement,
et non de faon progressive, permet de voir l'un l'exclusion de
l. Voir ce sujet Introd., p. 7- 8 et la Paramrthacarca, p. 32. Comparer aussi la
parole du Prophte (de l'Islam): Dieu se cache par soixante-dix mille voiles de lumire
et de tnbres. S'il les enlevait, les fulgurations de Sa Face consumeraient quiconque
Le regarde. Ci_L par Titus Burckhardt, La Sagesse des Prophtes, p. 32, n. 1. De mme
selon le Trika, l'homme qui reoit la plus haute des grces meurt bientt, son corps
ne pouvant le supporter. T.A. XCII, si. 210.
2. Sur la grce, et afin d'clairer ce passage, P.T.v., p. 3, l 11-1'.2. Bhairavastava,
si. z.
3. P .T.v., p. 6-7, l'auteur discerne encore plusieurs sens diu- dsirer, agir, briller,
tre lou et se mouvoir.
-29-
l'autre
1
Ainsi se prsente le jeu ternel de Bhairava et de Bhairav:
en manifestant, il rsorbe ; en rsorbant, il manifeste ; pourtant
rien n'est dtruit rien n'est cr2, tout est l jamais ; seule la
perspective difTre
3

ralit rien ne surgit, rien ne disparat, il n'y a que l'illustre
nergie vibrante qui, bien que libre de succession temporelle, se
rvle en diverses apparences. Dire qu'elle surgit et disparait est
pure mtaphore.'.
Ce jeu prodigieux entre Siva et l'nergie n'a nul besoin d'expli-
cation, il relve de la libert souveraine, celle de la conscience de soi
associe sa puissance autonome, uvre des plus ardues accom-
plir ( alidurghata) : Qu 'y a-t-il en effet de plus difficile que de
faire apparaitre en Lui, lumire par nature, la ngation de la
lumire au moment mme o sa nature essentielle de lumire
consciente brille sans interruption ? Une telle uvre de sa libre
nergie semble impossible aux tres limits que nous sommes.
5

En soi illimite et indiffrencie, la Conscience omniprsente et
omnisciente ne comporte aucune inconscience, et pourtant on
constate l'inconscience en ce monde, c'est--dire l'ignorance
l'gard de la Ralit absolue. Le terme jaef,a, ce qui n'est pas
conscient par soi-mme parce que dnu de la parfaite conscience
de soi, implique nanmoins une conscience relative et fragmente.
Ce qui signifie que pour apprhender !'Essence en son intgralit,
l'esprit doit tre vide de toute impression objective, dou d'une
et infiniment souple, sinon on le qualifie de /a<J,a,
rnsens1ble, mouss, inerte, sclros. L'ignorant se borne a des
aspects particuliers et un temps dtermin, il croit au plaisir et
la douleur, se sent attir par l'un et a de la rpulsion pour l'autre ;
l'univers qu'il apprhende devient pour lui un leurre douloureux,
1. M . .M., si. 28, p. 114 el dessin de la p. 113.
2. Spandanirr,rnya comm. au stra 1, p. 4-5.
3. Selon la Geslalllheorie, en ce qui concerne la vision de la figure et du dans
des modles ambigus o les rles s'inlerverlissent, plus la figure est complique, ses
couleurs vives, intenses et varies, mieux elle se dtache sur le rond peine peru en
tant que continuit amorphe, indfinie, sans couleur propre et qui semble s'tendre,
invisible, sous la figure. En ceci consiste la vision multiple et complexe de l'individu
qui, fascin par les figures , oublie Je trsor du Soi {ici p. 57). Mais que soudain il
peroive le fond inditlrenci les formes revtiront un tout autre sens el perront leur
relief. '
4. Vaslutas tu na kirr1cid udeli vyayale vii kevalalfl spandasaklir euu bhagavaty al,ra-
miipi lafhlhaftibhlisarcpalay sphuranly udeliva vyayalaiua ca. de
p. 5, l. 21 (Srinagar, 1925, K.S., n 42).
5. lias ca kim yalprakiistmani eva
prakafomane 1 tasmiil paramefoarasyedat?1
lat paralfl suitantryaf!z yut talhuabllsanalfl paurpatuabhiisarrnrrL nc"ima
samutthiipanam. l.P.v. li.Ill, 1. 17, vol. Il, p. 1'28.
-30-
il court aprs des ombres et la peur ne le quitte gure. Son ignorance
n'a pourtant rien de positif, elle se ramne une connaissance
imparfaite, une lumire consciente limite (81. Il). Mais qu'il ait
l'intuition fulgurante de la Ralit par choix divin - la grce -,
l'incitatiqn d'un mattre ou la lecture de textes rvls, aussitt
ses liens se dnouent, toute crainte s'vanouit, sa science limite
fait place un pur savoir (suddhauidyii) identique au triangle
sacr (lrikova ou lrisla), les trois nergies en parfaite harmonie
constituant i>essence unique ou libre nergie. Les Tantra montrent
Bhairava tendu sur le trident de la triple nergie consciente : dsir,
connaissance et activit {sl. 15).
Qui a la connaissance intgrale considre ce qui surgit et disparat
comme l'panouissement de l'nergie et n
1
y voit que la libert du
Seigneur. Se tenant la source de l'nergie, en Siva, il jouit de
Bhairava et aussi du monde sous sa forme d'nergie divine.
La vritable libration (jfvanmukti) de ce que l'on prenait tort
pour des liens n'est pas connaissance seule mais pouvoir, autrement
dit 'souverainet'. Il n'y a de vraie souverainet que lorsqu
1
a
disparu l'opposition entre souverain et ce qu'il gouverne
1
Il s'ensuit
que le Soi absolu tant omniprsent rside dans la servitude comme
dans la dlivrance et celles-ci font au mme titre partie du Jeu de
Siva qui s'amuse se lier puis se librer. Il ne reste donc qu'
s'absorber pour toujours en Bhairava, Essence inne de tous les
tres et trident des nergies. Ainsi se dissipera l'illusion qui voile
la grandeur de son indiffrenciation en le faisant surgir sous l'appa-
rence d'un univers diflrenci
2

1. P.T., p. 17.
2. Id. p. 1 9, ~ l 15 .
-31-
PARAMRTHACARC-;\
1. arkendudipadyavabhsabhinnaqi
[nabhaty ativyaptataya tatas ca 1
prakasarparp tadiyat prakasya-
[prakasatakhya vyavahrairn 11 1
2. jfinad vibhinno na hi kascid rthas
[ta ltatkrta}.t sarpvidi nsti bhcdal) 1
svayn1prakascch.1tamaikadhamni
napi vibhedita syt Il 2
3. ittharp svasnpvidghana eka eva
lsival) sa visvasya parati. prakasal) 1
latrapi bhaty vicitrasaktau
grahyagrhitrpravihhga hhedal) 11 :3
4. bhedal) sa cyarp na tato vibhinnaf:i
[ tanrnik:idhamn::l}) l
prasadahastyasvapayodasindhugiryadi
[yadvan mal)idarpal).adcl:i 11 4
a. adarsamadhyc pratibimhakri sahim-
[ bakarp syd yadi manasi<ldham 1
svacchandasamvinmukurantarale bh-
[ h.etv antaram nsti nanyal 11 3
6. s::nrividghanas Lena paras tvam eva
[ lvayycva visvani cakasati drak 1
sphurnnti ca tvnnmahasal) prabhYat
[lvam cni:?arp pnrame5a knrta Il 6
7. ittham svasamvedlnam adisiddham
( asadhyam tmanam anSam 1
svasaktisarpprr.wm ndcsakalarp ni-
[ tyaq1 vibhu 1p b hairnvanathmn Je l I 7
8. sadvrttasa ptakam iclu q1 ga litanynei
smaranti hrd:.lyc par:rn1rthnkanH.1 1
te bhairaviyaparndharna muhur Yisanti
r jannnti ca trijagatparamarthacarcarn 11 s
- 32-
DE LA ULTIME
1. Parce qu'il pntre
1
toute chose au plus haut degr, Lui dont
l'essence est lumire consciente, il ne brille pas spar des lumires
du soleil, de la lune, d'une lampe, etc.
2
C
1
cst pourquoi les expres-
sions ' illumination
1
et ' illumin ' ne valent que de faon relative.
2. En vrit rien n'est spar de la connaissance ; et la difTrcn-
ciation ne de la varit
3
n'existe pas dans la Conscience. On ne
trouve pas non plus de distinction spcifique dans le domaine
unique et trs pur, par soi-mme lumineux.
3. Ainsi Siva, Lumire suprme de runivers, n'est qu'unicit,
Conscience indivise de soi ; et l seulement, dans l'nergie diver.si-
fie, apparat la diffrenciation scinde en prenant et preneur.
4. En consquence, c'est. lui le diffrenci non distinct du posses-
seur de ce domaine unique, trs pur et autonome, tout comme
maisons, lphants, chevaux, nuages, fleuves, montagnes etc., ne
sont pas spars du miroir ou du cristal de roche (dans lequel ils se
refltent).
5. Si le reflet dans le miroir et l'objet rflchi sont dmontrs
rels raide de critres logiques, pour les choses perues l'intrieur
du miroir de la Conscience autonome, il n'y a pas (l) d'autre cause.
6. C'est pourquoi Tu n'es que Conscience indivise ; en Toi brillent
instantanment les mondes. Ils fulgurent par la Splendeur de Ton
clat. Toi seul est leur auteur, Souverain !
7. Je chante ainsi la louange du Seigneur Bhairava intuitivement
senti
4
, source de toute certitude et qui chappe aux preuves, Soi,
Souverain qui n'a pas de souverain, plnitude d'nergies
5
, sans
espace ni temps, ternel, omniprsent.
l. Vyiip- les termes pntrer, remplir n'chappent pas une grossire dualit.
2. En raison des deux sens de iibhii- apparatre, ressembler, briller, on peut aussi
comprendre comme le swmi Lak$man: il ne ressemble pas aux lumires du ditrenci.
La lumire de la Conscience n'a rien de commun avec l'image entache de dualit
que l'ignorant se forge d'elle: lumire du soleil, d'une lampe possdant un foyer d'irra-
diation et o subsiste toujours un sujet clairant face un objet clair.
3. Text. ceci, cela.
4. vident par soi car prouv par soi-mme de faon aussi immdiate que la faim
et la soir.
5. Text. 'plein de ses nergies propres', 'propres', non pour les opposer celles
d'un antre mais pour signifier qu'il n'y a rien d'autre qu'elles.
- 33
Ceux qui, aspirant la Ralit ultime, portent1 en leur cur
comme il convient - l'exclusion de toute autre pense - ces sept
stances parfaites, s'absorbent constamment dans le domaine absolu
de Bhairava et mnent bien2 la qute
3
de l'ultime Ralit des trois
mondes".
1. SJ?lf-, voquer, contempler sans cesse.
2. jnanti, connaissent, s'assurent de l'lucidation.
3. Carc, r.citation du Veda, d'o rpter en pense, enqute, lucidation.
4. Abhinav::igupta n'est pas l'auteur de cette dernire strophe, car jamais il ne
clbre sa propre louange. D.'ailleurs daprs son auteur anonyme - un admirateur
flrvent d'Abhinava - cet hyrime consiste en sept stances. Ceux qui l'ont enchss
leur cur connaissent la totale activit des trois mondes en tant qe suprme
prise de conscience.
-34-
COMMENTAIRE
Ces sept stances insistent sur la Ralit, Siva, Lumire cons-
ciente (prakiiSa) qui brille de son propre clat et forme un Tout
indivis et sans faille, ce domaine unique auquel rien ne fait obstruc-
tion. C'est pourlant en lui et en lui seul, possesseur d'nergies
varies, que se manifeste Ja diflrenciation. A l'aide de l'exemple
du miroir, Abhinavagupta cherche montrer la possibilit d'une
conscience lumineuse dont la libre nergie suscite une multiplicit,
sans porter atteinte son unicit foncire
1
La mtaphore prsente
certains avantages mais prte confusion : elle n'a de porte que
si le lecteur fait un effort pour lcher ln dualit. Il ne s'agit pas
d'abord d'un miroir plan deux dimensions, mais d'un domaine
infini. En putre, les reflets qui s'y manifestent n'ont aucun objet
correspondant. En langage d'cole, il n'y a pas de bimba - chose
externe objective rflchie dans un miroir et dont on peut prouver
l'existence indpendamment du reflet qu'elle y occasionne - il n>y
a que pralibimba, apparition, phnomne au sens grec, cc qui vient
l'tre ou reflet sans objet. On ne .l'appelle ' reflet ' qu'en fonction
de la comparaison de la conscience un miroir. L'exemple du
rveur et de ses rves ne serait pas aussi inexact ce point de vue,
mais moins riche et moins suggestif.
Ces prcautions prises, si ron considre donc seulement le miroir
et ce qui se rflchit en lui, on constatera que, contrAirement, cc
qui se passe dans l'observation courante, les objets perus dans son
orbe ne sont pas spars les uns des autres et spars du miroir.
Ils constituent un tout.indissociahle
2
Le mystique voit le rel de
la mme manire, l'intrieur de la Conscience, ne faisant qutun
avec elle et n'ayant d'autre cause qu'elle. Que les reflets s'y d-
1. Si la Conscience possde pouvoir d'agir (kriyiisakti) et tout.e-puisBance, c'est
parce qu'elle est apte s'associer le multiple difTrcnci, sans perdre son indif-
frenciation originelle l.P.v. II, p. 173, fin du t;omm. au si. 19. Sur Ir miroir,
cf. M.M., pp. 141, 143, 169-170. galement la P:uumarthacarcii, sl. 4-5 et p. 6_.
note 1. Dj les Bouddhistes Vijflnavdin ulilisaient ln mtaphore du miroir; sur
l'layauijnna ou vritable cur, le Tsong King dit: il peut renfermer en elle tous les
domaines tant absolus que rclatHs. C'est comme un miroir clair qui ne se combine pas
avec l'image, mais qui contient l'image. Celle thorie est noncP du point de vue qu'il
Y a combinaison du pur et du souill. a Malriau2 pour /'tude du Vijiiaplimiitrn,
par Sylvain Lvi, Paris, 193'2, p. l 72.
2. c Dans le bien ternel de la nature divine ainsi que dans un miroir mo.9ique,
l'essence de toute crature est unit, d'aprs Eckhart (Pr. 324,28) et cit
par R. Otto, Mystique d'Orient et Mystique d'Occident, Paris, 195 l, p. 55.
-35-
ploient ou s'vanouissent, le miroir de la Conscience indiffrencie
reste identique lui-mme, les reflets n'affectant en rien sa puret
native.
De faon analogue le temps et l'espace n'ont aucune prise sur
le Seigneur ; les mondes brillent en lui et par lui jamais instan-
tans et sans succession. Ainsi coexistent le miroir indiffrenci et
les reflets multiples.
Ahhinavagupta dveloppe longuement ce thme dans sa glose
l'Isvarapratyabhijiiakarika.1 : la grandeur de la Conscience due
sa puret lui permet, dit-il, d'assumer une infinit de reflets
( abhiisa) tout en demeurant une : L
1
exprience nous apprend
qu'un clair miroir reoit des milliers de formes comme des mon-
des lphants, etc. sans que sa nature propre s'en trouve
br1see, et ces formes ne cachent pas le miroir comme l'apparence
errone de l'argent cache la nacre, ou la vision de deux lunes, la
lune unique
2
Car mme si le miroir prend l'aspect de ces formes
diverses on se dit : ce miroir est pur et excellent &. On ne perd donc
pas de vue l'existence du miroir quand on contemple les reflets
qui y dferlent. Les derniers mots d' Abhinavagupta soulvent un
des problmes les plus ardus de la spculation sur la vie mystique.
Peut-on voir simultanment le miroir et l'image reflte, la Cons-
cience divine et I1univers diffrenci ou son propre moi ?
En fait, il existe plusieurs manires d'apprhender miroir et
reflets selon le degr atteint. L'ignorant ne s'intresse qu'aux
reflets
3
bien qu'ils n'aient d'existence que dans le miroir de sa
propre conscience : il les projette hors de lui et court en vain
eux. Celui qui a reconnu le Soi n'oublie plus le miroir, domame
bhairavien et fond immuable sans lequel il n'y aurait pas de
Il sait que lumire et certitude appartiennent uniquement au z:rnroir
et que Bhairava, vident par soi-mme et source de toute
chappe aux preuves qui prtendent tablir son existence pmsque
tout est peru en lui et par lui4. Deux cas principaux se
chez les mystiques : certains s'adonnent la seule contemplation
du miroir sans pouvoir s'y tablir; tantt durant l'extase
d'une dure limite, dans l'oubli de tout ce qui n'est pas le Soi, ils
l. ll.IV.19, vol. II, pp. li7-I78.
'2. Allusion la thorie bien connue du vcdntin S:rnkara.
3. Cf. )luhyi-D-Din Ibn 'Araui, au sujet du monde qui ne porticipc pns l'aulono-
mie c l'f:trc essentiel, il ccril : ! Il est lui-mme son propre voile en sorte qu'il ne
puut pas voir Dieu du fait mme qu'il se voit. La Sagesse des Prophtes. Trnd.
Tilus Burckhardt, p. 32.
-1. Al-l;lallaj disait aussi de Dieu : c La preuve est Lui, de Lui, vers Lui, en Lui, le
Tcmoin mme du Hcl, dans une rvlation se formulant (4) '- Le Dwrz d'A.l-!Jallcij.
Trn<l. L. )fassignon, p. '29, Journal Asiatique l9:ll.
-36-
voient le miroir limpide ( nirvikalpasamidhi) et leur conscience
demeure sans reflet1 ; tantt les reflets varis rapparaissent et
leur cachent le miroir. Ainsi pour eux, apprhender l'un, c'est
rinstant mme perdre l'autre de vue, selon l'exemple du taureau
et de l'lphant
2
Quelques-uns atteignent la plus haute perfection
qui consiste voir simultanment le miroir et ses reflets mais avec
prdominance de l'un ou de l'autre, le mystique pouvant son gr
jouir d'un monde surabondant d'nergie divine se dployant en
Siva sans jamais tre dupe des reflets et sans garder trace des
choses, tel le miroir qui ne fixe rien ; ou encore prendre son repos
en Siva contenant l'nergie l'tat latent. C'est l luryfla,
domaine unique (par-del le quatrime tat - l'extase -) o les
notions et impressions diffrencies baignent dans l'indifrenci
el l'indiffrenci rside dans le difTrenci
3
Perus dans leur
vritable essence, les reflets deviennent enchanteurs. Paramasiva,
le Tout (nikhila), contient les abhiisa de l'univers; le monde, en sa
totalit, est embrass par lui dans sa prsence concrte et vivante.
1. Citpral..<isa est s::rns reflet tandis que cailanya dsigne la Conscience ultime doue
c.lc tous les reflcls (iibhasa) ou Param3sivll, le Tout.
'l. Sur celle image suggesti\"l!, cr. ici p. 28 et M.M., si. '28, p. l 14. ltm'ArabI expose
une conception voisine dans un climat religieux diffrent. La page qui suit, longue et
asse2 obscure, me parait esquisser _les deux possibilits qu' Abhinavagupta dgage
clairt"mcnt dans son Tuntrloka (111, sl. 3 sqq., 48, 56): c le sujet recevant la rv-
lation essentielle ne verra que sa propre 'forme dans le miroir de Dieu; il ne verra
pas Di(u - il est impossible qu'il Le voie - tout en sachant qu'il ne voit sa propre
'forme' qu'en vertu de ce miroir divin. Ceci est tout rait analogue ce qui a lieu dans
un miroir corporel : en y contemplant des formes, tu ne vois pas le miroir, tout en
sachant que lu ne vois ces formes ... qu'en vertu du miroir. Ce phnomne, Dieu l'a
manifest comme symbole particulirement appropri Sa rvlation essentielle, pour
que Ct'lui qui 11 Se rvle sache qu'il ne Le voit pas; il n'existe pas de symbole plus
direct et plus conforme la contemplation et la rvlation dont il s'agit. Tche donc
toi-mme de voir le corps du miroir tout en regardant la forme qui s'y reflte; lu ne le
verras jamais en mme temps. Cela est si vrai que certains ... ont prtendu que la forme
rflchie s'interpose entre la vue du contemplant et le miroir mme; c'est l ce qu'ils
ont saisi de plus haut dans Je domaine de la connaissance spirituelle ; mais en ralit
Ia chose est telle que nous venons de le dire ( savoir que Ja forme ne cache
pas essentiellement le miroir, mais que celui-ci la manifeste) ... Si tu savoures cela,
tu sa,oures l'extrme limite que la crature comme telle puisse atteindre (dans sa
connaissance' objective' ... ). La Sagesse des Prophtes, p. 44-45.
3. Vikalpa en nirvikalpa cl nirvikalpa en uikalpa, selon la formule chre l'Inde.
n .. mme les Bouddhistes chinois du Mahyna reconnaissent que le Tathagata est
capal>le de distinguer toutes choses grce une connaissance sans distinclion. Recevoir
tous les contacts la faon dun miroir, c'est prouver la sapience roncire. L'absence
de pense, c'est l'omniscience. Entretiens du Maitre de Dhyana Chen-Jlouei d[z To-tso (
760) par J. Gernet, p. 32 note 4, P.E.F.E.O. vol. XXXT, Hano, 1949.
-37-
ANUBHAVANIVEDANA
1. antarlak!?yavilnacittapavano yogi yada vartate
[niscalataray bahir asau pasyann apasyann api 1
mudreyarp. khalu sambhav bhavati sa guro s-
nysnyavivarjitaf!l bhavatl yat tattvarp padar sambhavam 11
2. ardhodgha titalocanal;t sthiramana candrar-
. [kav api linatam upagatau trispandabhavntare 1
Jyotrpam ase!?abahyarahitarp caikarp pumarpsarp paralfl tat-
[tvar tatpadam eti vastu paramarp vacyarp. kim atradhikam Il
3. sabdal_t kascana yo mukhad udayate mantral) sa lokottaral:i
sarpsthanarp yat kapi mudraiva sa 1
praIJasya svarasena yatpravahaDa111 yogal). sa evadbhutal_i
saktar dhama paraip. mamanubhavataQ kinnma na bhrajate 11
4. mantra]). sa pratibhati varQaracana yasmin na
[mudra sa samudeti yatra galita krtsna knya kay1k1 1
yogal_i sa prathate yatal). pravahai:iarp praI).asya tvad-
sudhiyarri kirp kirp na namdbhutam 1l
-38-
OFFRANDE DE L'EXPRIENCE INTIME
1. Lorsqu'un yogin, souffie et esprit dissouts dans (l'objet) peru
intrieurement, regarde fixement, la pupille immobile et, bien que
voyant le (monde) extrieur, ne le voit pas, tel est en vrit le sceau
de Siva produit par votre grce, Mattre ! Ce domaine libre de vide
et de non-vide, voil la Ralit sivate.
2. Yeux entr'ouverts, pense immobile, regard fix sur la pointe
du nez, soleil et lune
1
parvenus se fondre dans l'intime sponta-
nit du triple mouvement, il atteint la Ralit, ce domaine essen-
tiellement lumineux, dpourvu de toute extriorit, unique,
minent, Essence suprme ; que dire ici de plus ?
2
3. (Alors) toute parole sortie de sa bouche est formule surna-
turelle.
L'existence du corps dont procdent plaisir et douleur, voil
l'attitude indicible.
Le flux spontan du souffie, voil le prodigieux yoga.
Ayant prouv l'absolue Splendeur de l'nergie divine, en vrit,
qu'est-ce qui pour moi ne resplendirait pas ?
4. La formule qui s'impose l'esprit est celle o l'on ne distingue
plus l'agencement des phonmes.
L'attitude (mudra) surgit (spontanment), toute activit corpo-
relle ayant cess.
Le yoga se rvle lorsque le flot du souffie s'arrte.
Dans les ftes clatantes qui mnent Ta Splendeur, en vrit,
qu'y a-t-il pour les tres aviss qui ne soit prodige l
1. So11me et expire mais nussi la dualit en son
2. Ces deux premires slrophes sont cites dans la Hathayogapradipik de Svl-
mr:1ma Svijmin (vl'rs 37 et 4lJ sans qu'il donne leur source. Voir K. C. Pandey, op.
cil., p. 73.
- 39-
COMMENT AIRE
Ces quatre strophes d'Abhinavagupta crites en un langage
simple et succinct puisqu'il s'agit de l'exprience d'un grand maitre
qui domine les niveaux de la vie mystique, clbrent la bhairav-
mudra, attitude au regard fixe, yeux mi-clos, d'un homme mer-
veill par la dcouverte de Soi. Ce regard fig trahit une absorption
profonde dont l'hymne dgage des degrs varis.
Avant de donner une explication dtaille de ces strophes avec
l'aide du Tantraloka sans lequel il resterait lettre il nous
faut montrer l'enchainement des stances par rapport aux voies
mnent l'harmonie totale ; mais au lieu de s'lever de l'inf-
rieur au suprieur comme on s'y attendrait, le yogin partant des
cimes de l'illumination la diffuse de voie en voie jusqu'au plan de
l'activit pratique, en remplissant les tats ordinaires (veille et
sommeil) de conscience et de puissance.
La stance I qui traite du premier coup d'il jet sm le monde
environnant, relve de la voie la plus haute, siimbhavopiiya
1
La
seconde, .propre la voie de l'nergie parvenue son
une reprise de l'attitude antrieure mais associe une d1scnm1-
plus stable du monde et de son propre corps ; elle conduit
le yogin l'quilibre parfait. des deux ples et
mterne
21
qui vont permettre sa connaissance et son act1v1t de
se dployer sans qu'il ait quitter la pure intriorit. A_vec la
troisime strophe, la bhairavmudrii, cessant d'tre une pratique et
un moyen en vue d
1
une fin, devient spontane. Ayant reconnu
l'unicit de la Conscience, le yogin comprend qu'il n'y a I?as d'ex-
pansion et de contraction vritables ; la vibration consciente ne
sort ni ne rentre mais se manifeste comme telle par sa propre libert .
. Jouissant alors de cette libert, il peut utiliser les choses qu'il peroit
dans une totale conscience de soi. La quatrime stance dcrit donc
le parfoit apaisement atteint dans la voie de I1individu. Comme
cette voie fonctionne toujours mme les activits quotidiennes,
elle s'achve naturellement par la non-voie ( anupaya) dans
laquelle, partout et sans interruption, la suprme Conscience
demeure prsente.
La bhairavmudr spontane ne doit pas tre confondue avec
1, Sur les trois voies, cr. ici Inlrod. p. 15. galement ucc<ira du Soi conscient, p. 16.
':!. Il s'agit de la kramamudr. CC. M .. M., p. 57, 63, 144, 158 sqq.
-40-
celle que dcrit la premire strophe ni avec la pratique de la
seconde, dont elle est le fruit. Les yeux grands ouverts, le yogin
voit tout, sait tout et agit librement sans quitter le Cur de l'uni-
vers. D'ailleurs o irait-il puisqu'il n'y a rien d'extrieur la
Conscience et que tout brille en elle ? Pourtant subsiste
1
nous le
verrons, un libre lan de jeu dont il peut son gr prendre pleine
conscience s'il dsire s'adonner au flux et au reflux de la vie divine.
Stance 1
Laissant dans l'ombre les tals prliminaires l'illumination,
Abhinavagupta prend son exprience au moment de la dcouverte
du Sujet apais - le Soi (atman) - lorsque, en extase (iurya), sa
pense suspendue, ses sens replis sur eux-mmes, l'nergie intrio-
rise, il demeure absorb dans sa propre flicit, dans l'oubli de
tout le cr.
Sa tche s'achve-t-elle l'tape iurya quand il a l'intuition de
sa propre nature durant le seul samadhi? Non, elle ne fait que
commencer : il lui reste la percevoir durant les tats ordinaires
(vyullhna), et c'est la bhairau"imudrii qui lui permet justement
d'atteindre une conscience homogne en saisissant d'abord l'univers
l'intrieur de soi puis, grce l'attitude kramamudr, d'apprhen-
der sa propre nature en samdhi et en vyullhana, l'un aprs l'autre,
sans brisure; il pourra alors vaquer ses occupations mondaines
et garder la plnitude du Je recouvr.
Le pome traite donc de l'panouissement des nergies qui
succde leur retrait. Prenant spontanment l'attitude dite de
Siva
1
, le yogin accde au Je plnier
2
et s'abme dans le Cur
cosmique, domaine de l'efficience et de la plus haute Ralit o
Soi et univers ne font qu'un.
Un verset clbre dfinit ainsi l'attitude de blzairava: (Le
visible) externe doit tre peru l'intrieur, le regard (fixe) sans
ciller. Telle est l'attitude bhairavienne que tous les traits gardent
secrte.
3
Comment en effet pourrait-on en parler sans la trahir?
Essayons pourtant. Le yogin voit tout coup l'intrieur de son
propre soi un objet quelconque ou le monde environnant qu'il
apprhendait auparavant comme extrieur lui et il le voit en
outre en son essence indiffrencie (nirvikalpa). En d'autres termes,
sa propre nature commence lui apparaitre sous l'aspect d'un
l. Siimbhaumudrii ou bhairavimudrri.
i. Pr(Hihanta, Je cosmique par-del le Je (alwrilii) prcdemment rvl.
3. Anlarlakyabahirdr#ir Cit I.P.v. IV.1.11, vol. 11, p. "266.
On pourrait traduire ce vers de bien des manires. Cc sens nous a paru le meilleur.
-41-
substrat actif universel ( gouvernant le monde entier
dont elle forme la ralit sous-jacente
1
K!?emaraja essaie d'expli-
quer une telle attitude dans sa glose ce sira: Au bout d'un
millier de renaissances, ayant reconnu sa propre essence extraordi-
naire et pleine d'une minente flicit
1
il arrive que soudain le fil de
toutes ses activits se brise, et le roi des yogin atteint la bhairav'i-
mudr; les yeux fixes
2
, il contemple mrveill la masse des tres
qui jaillit de l'ther de sa conscience et s'y rsorbe
1
la manire
d'une multitude de reflets apparaissant et disparaissant la surface
d'un miroir.
Mais la premire strophe ne mentionne encore qu'un premier
regard au moment o une chose ' scelle' (mudrii) au Soi d'une
manire indicible est apprhende en une sensation pure ( nirvi-
kalpa), exemple de pense dualisante qui diffrencierait l'objet du
sujet.
En ce premier instant de la vision incorpor au Je et participant
sa plnitude, le yogin ne fait que voir
1
il ne construit pas la chose
3
;
en ce sens on peut dire qu'il ne la voit pas ; alors souille et pense
tant dissouts dans l'objet, celui-ci s'impose brusquement son
essence indiffrencie, non plus comme extrieur la
mais comme intgr elle. Il n'y a plus un moi face l'objet mms
fusion du moi et de l'objet dans le Soi.
Stance 2
Dans l'ivresse de son merveillement, le yogin saisit le monde
sensible en lui-mme de faon globale, fugitive et sans distinguer
les choses avec clart puisque sa pense ne jout: pas. A fin de les
discerner et d'tre capable d'agir sur elles, c'est--dire de .gouverner
l'nergie lors de la connaissance et de l'activit ordinaires - en
continuant percevoir le monde ambiant dans le Soi - le
reproduit dessein la bhairavfmudrii. Avec la seconde strophe, 11
va prendre conscience de cette attitude et s'y exercer en repro-
duisant une mme respiration, une mme immobilit de I_a pense
tout en se servant de son nergie pour parvenir au domame bhai-
ravien atteint auparavant sans qu
1
il sache comment et de m:mi.rc
spontane. C'est donc dans la voie de I7nergie de la connais-
sance discriminatrice - qu'il s'adonne rattitude de Siva qui va
le mener la kramamudra o se succderont sans interruption
1. Spandusfltra, 11, p. 25.
2. Fixe, car il n'y a plus diriger le rel7ard ici el l, 'ot1 de la surprise
tout est donn dans. un lL'i'ncl
0
'
3. cr. lntrod. p. 13.
-42-
largesses et reprises : il s'enfonce dans les profondeurs du Soi et
automatiquement ses yeux se ferment puis il se tourne
vers l'extrieur et voit le monde qu'il reprend l'intrieur de sa
conscience pour le ressortir nouveau, trs vite, en sorte que le
monde s'imprgne toujours davantage de la Conscience de soi.
Au dbut cette perception intriorise ne s'attache rien de parti-
culier; Abhinavagupta donne l'exemple de lH vision d'une ville
et des milliers de choses qu'elle contient, apprhendes en un seul
coup d'il du pic d'une montagne : le multiple y est vu dans
l'unit, de faon simultane et comme un tout1. Une telle vision
globale tend raliser le nirvikalpa
2
dans les activits de
Notons des diffrences entre la bhairaii"imudr, ici PL celle
de la premire strophe : deux mouvements apparaissent mainLenant
en relation tandis qu'il n'y en avait pas; si le parcour:s est
la bhairaulmudrii porte dsormais_ non plus sur un objet, spontan-
ment intrioris mais sur le corps. Le yogin imprgne dextase
corps auque] il a cess de s'identifier, jusqu' cc que la
sparant intrieur et extrieur s'vanouisse. II s'agit moins <l'un
panouissement de en lui-mme et en esprit, que de ln
ralisation de son tre intgral et libre aYcc rcbondisscmcnL :;tu- 1.-
eorps; exploration d'un nouveau champ de vie crntrice pour qui
a l'exprience de la Ralit intrieure.
Si le premier hmistiche de ln t'Lancc la
pratique de la bhairavfmudrii au moment o les yeux. ferment
demi, le second traite fruits de cette praliquc : spontanit el
suprme actualisation. Le yogin vide de toute pense, bien affermi
dans I.e Soi, baigne dans l'iniITrcnciation primordiulc. Les
souffies inspir et expir convergent d'eux-mmcs vers le centre
et viennent se dissoudre au point de jonction, en pleine vibration
subtile (spanda), d'o procde le triple mouvement : inspiration
1
expiration et souille ascendant3. Alors bien unifi, il atteint l'unique,
l'tre efficient dou de son nergie, et devient apte connatre le
monde sensible avec clart et prcision. Possdant la du
jaillissement universel et comme rien en lui ne fait plus obstacle au
flux de la Vie une et dynamique, il jouit d'une extraordinaire
spontanit que la stance suivante dcrit en montrant la rsonance
de cette ralisation intrieure sur 80n comportement.
1. l.P.v. II...t.19, p. 178, 1. 10 el P.T.,., p.
2. Absence de pense double ple.
3. Udnn, ,oir cc suj<'l p . .to sqif., 146 cl
- 4.3 -
Stance 3
. Parole, geste ou attitude, et respiration, ces trois formes d'expres-
s101! d.e l'tre humain, ayant perdu leur caractre arbitraire et
artificiel, vont dsormais porter tmoignage de l'lre essentiel et
profond du yogin. On les nommera de ce fait mantra, mudrii et
yoga parce que, au sommet de la voie de l'nergie, ils se rpandent
de faon spontane en manifestant la vie cosmique, nergie cra-
trice en flux constant.
Les act.iYits du yogin, mme les plus humbles, se rvlent
exceptionnelles du fait qu'elles le r::imnent sans cesse leur source,
l'Acte de la conscience.
Abhintnngupta dans sa Laghuvrtti (p. 10, l. 1) dfinit le sens
rel des manlra et nwdri: Il suffit, dit-il, d'metlre le germe
du cur
1
en dans l'nergie vitale pour que les mantra
et mudr, forms respectivement des nergies cognitive et active,
deviennent l'instant mme propices. De quelle manire (cela se
produit-il) ? En s'absorbant dans son propre corps. En effet le corps
que pntre l'nergie vitale du mantra (du cur) ayant assimil
le cur o surabondent connaissance et activit parfaites, est alors
pntr pur les mantra et mudr, c'est--dire connnissnnce et
activit. plonges dans l'essence de ce cur De l procdent des
:'urnaturels.
Nianlra. Par l'absorption dans cognitive, les moindres
mots du yogin se transforment en formules mystiques doues de
puissance puisqu'elles jaillissent de la source de toute efficience, le
Je ; en d'autres termes, sa parole est vraie, elle correspond la
ralit et se ralise comme telle.
Mudrii, inexprimable activit, consiste en l1existence
du corps. Le terme saqzslhiina signifie existence bien
achvement, belle forme, totalit ; il dsigne donc l1tre re.ahs?
dou d'existence vritable et qui a trouv son centre de gravit
la jonction des souffies, savoir dans la Vie cosmique, le 801,
position immuable o chaque chose trouve sa juste place. Ses
gestes, son m<lintien mme expriment son tre englobant
indiffremment corporel et spirituel. Quelles que soient les exp-
riences d'un tel yogin, qu
1
il ressente du plaisir ou de la douleur,
vive ou meure, son attitude trahit la mme plnitude, celle de Siva
dont elle a reu l'empreinte indlbile ( mudrti). Demeurant
l. Le /Jja SA c.; U grcc lu monte du soumc udiina dans le canal mdian, c'esl-
-dire ucccira du so11me. Voir ici p. 16 et .sur le marzlra du cur, A. Padoux, op. cit.,
p. 350 sqq.
-44-
' stable ', ses activits devenues des mudr le fixent dans l'ternel,
il jouit d'une existence sans faille, bien quilibre o tout se tient
(saTfl.slhana); gestes, paroles, etc., surgissent des profondeurs de
l'tre total et expriment sans cesse cette pa1"faite unit. Dsormais
l'nergie cratrice, la divine fokli, flue pareille elle-mme dans les
diverses situations de la vie journalire. En d'autres termes, la Vie
coule en lui, il ne coule plus dans la vie.
Yoga. En raison de Pimportance de la force vitale ( prr;w), le
flux et le reflux de la vie cosmique constituent l'unique yoga de ce
yogin. Il s'agit semble-t-il du retrait et de l'expansion spontans
du souffle : quand il expire, le yogin tourn vers l'extrieur est
attentif au connu et le Soi se rpand ; puis le souffie se repose
l'intrieur durant le retour vers soi et la diffrenciation s'vanouit.
Ceci se reproduit au gr du yogin et dans la plnitude, de sorte
qu'aucun dsir ne subsiste en lui1. Son tre profond demeurant en
harmonie avec la Vie, ses se dploient sans effort comme
son rayonnement, l'intrieur mme de l'nergie consciente divi-
nise, dans la majest de Siva qui transmet toute chose son clat.
La voie de l'nergie ayant pour acm le plus grand des apaise-
ments rejoint la voie de Siva dont elle est pntre.
Stance 4
La dernire strophe dcrit un tat supeneur encore aux deux
prcdents : tat ultime et apais de la voie de l'individu ( if)avo-
piiya) o l'nergie divinise parvient au corps et ses organes.
Cette voie qui utilise l'activit corporelle afin d'atteindre la suprme
Ralit prend son dpart dans les actes quotidiens ; elle mne donc
ici de faon naturelle la Ralit par-del toute voie ( anupiya)
ds que le suprme Sujet conscient a rsorb en lui-mme le monde
objectif. Le yogin redevenu semblable l'homme ordinaire -
en apparence au moins - exprimente le Soi en pleine activit cou-
rante et apprhende le monde en ses dtails mais dans le miroir
unique de la Conscience. L'univers, absorb par la grande Cons-
cience de Bhairava, s'y transforme d'une indicible manire.
Lors du retour l'indiffrenciation primordiale, une autre dfi-
nition de la parole, de l'attitude mystique et du souffie va nous
tre donne. Si, au verset 3, rythmes de la respiration, parole et
geste saisis leur source vibrante ( spanda) taient dous
d'efficience, la source indiffrencie et l'nergie qui en fluait sans
effort sous forme de manlra, mudrii et souffle, semblaient encore
1. Cf. T.A. V.24-25, 43-49.
-45-
distincts. Dsormais la Ralit recouvre ces diverses expressions
de la personnnlit, si bien que seule demeure une indicible manire
d'tre. Abhinavagupta montre clairement dans sa Laghuvrtti
(p. 12) les degrs d'efficience du yogin selon la profondeur et la dure
de son absorption en SA Ul;l, germe du cur: d'abord, correspon-
dant aux pouvoirs clbrs par la strophe prcdente, la multitude
des manlra et des mudr devenue manifeste dans le corps, brille
dans la pense ( buddhi) et dans l'activit ; si on lui pose une
question, le yogin fait une rponse immdiate (jhalili); pass,
prsent et avenir, tout se rvle lui conformment la ralit .
Puis en prolongeant son absorption, il devient matre de l'nergie
des formules et attitudes ; (( ensuite, s'il double la dure de cette
absorption, dou d'une ardeur ininterrompue, demeurant dans
l'tat indiffrenci, il ne discerne plus rien de ses possessions, corps,
souilles, etc., il voit uniquement la Conscience indivise et sans
voile.
1
Avec ces derniers mots on rejoint la stance 4.
Le mantra n'est plus que silence : toute parole s'y trouve conte-
nue mais exempte d'agencement; les phonmes auparavant
distincts tels a+h+a'!1 sont pour ainsi dire souds les un.s aux
autres en aham, Je, mantra unique. L'univers infini est plonge
l'nergie (Ha) et celle-ci en anutlara (A), le transcendant, pms a
nouveau le transcendant s'immerge dans l'nergie divine, A et ,..Ha
fusionnent. dans le point, sans dimension bindu, d'o le supreme
mantra Je, aham, englobant tous les. de !'alphabet
emboits en lui-mme c'est la vibration du Cur, l'nergie de la
flicit et l'efficience 'spirituelle la plus haute (manlravrya)B.
Quoi qu'il nonce, le yogin exprime une seule chose, Je, dans un
profond silence intrieur.
M udr. De mme quant son activit corporelle, le yogin ne
bouge plus du Centre et pourtant il agit de faon autono.me et
spontane dlivr des P'estes arbitraires d'un homme revendiquant
t 0 d b
la possession de son corps et de ses biens, la poursuite e uts
dfinis; et si, pour lui, ne compte plus que l'Acte pur l'origine de
tout mouvement, c'est qu'il voit son propre corps la coupe
de l'unique Conscience et dont la diffrenciation a disparu ; trs
puissant, il a pour seul sjour la libre Conscience.


1. P.T., st. 12-16
1
comm. p. 12-13, de la Laghuvrlli.
2. C'est ce que Abhinavagupt.a explique aux si. 201-203 du T.A. ch. III. Doil-on
comprendre au contraire que tes phonmes dissocis s'engloutissent l o il n'y a
plus de son, d'aprs l'explication donne ici lnlrod., p. 15; Le suprme anupya n'est
ni la formule (mantra), ni la divinit pour laquelle on rcite, ni celui qui relle, T.A.
11.26.
3. T.A. IV, 1. 119.
-46-
Yoga: pour lui un seul yoga demeure : l'immobilit du flux du
souffle vital lorsque les deux soufiles inspir et expir s'vanouissent
dans le domaine du milieu (madhyadhiimalayiil). Si le contrle du
souffie (pra'f)ii.yiima) n'a, selon Abhinavagupta, aucune tilit
1
par
cc,ntre au moment o la pense se rsorbe, les deux souilles se
perdent dans la Conscience identique Siva quant ils atteignent,
travers la voie mdiane
1
le dviidasiinla, tape ultime de notre
propre conscience. En cela consiste la vritable libration
1

La diffrence entre les deux dernires strophes tient en une
nuance perceptible au seul mystique : en langage d'cole on dirait
que la kramamudrii domine dans la troisime, et dans la quatrime,
la bhairavmudrii spontane parvenue son summum et succdant
la kramamudra acheve ; ce qui signifie que dans la premire
attitude il y a encore deux mouvements de rtraction et d'expan-
sion aiss et spontans, l'panouissement de l'nergie se produisant
au sein mme de l'unit ; dans la bhairavmudr, ces mouvements
ne font qu'un car le yogin rside dans le seul lan
2
sans tre
conscient de cc double mouvement : l'instant prcis o il en
devient conscient, il se laisse aller vers l'intrieur ou vers l'extrieur
et retombe dans la kramamudr; s'il demeure au contraire dans la
kramamudr sans en tre conscient, il parvient aussitt la
suprme bhairavmudr. On comprend alors qu'en l'absence de
conscience diffrenciatrice, il n'y ait plus pour lui de phonmes
distincts, d'activits personnelles ni de sou fies double ple.
Voici donc le comble du paradoxe : au Centre on est partout ;
miracle plus inou encore : le monde repose apais, immobile, et
pourtant il bouge infiniment. On qualifie de grand prodige .impr-
visible (mahiisahasi) ce fruit de la bhairavmudra; en effet, lorsque
l'nergie prcdemment cache l'intrieur se rpand d'un coup,
les facults des organes intellectuels et sensibles s'veillent toutes
en mme temps pour rejoindre leurs objets respectifs ; mais au lieu
de se diriger vers l'extrieur, l'nergie visuelle vers les couleurs
cpmme on s'y attendrait, elles se rsorbent dans le Soi ; autrement
dit le reflux des nergies vers le Centre s'accompagne d'un pa-
nouissement au plus profond, au plus vaste du Soi, et les choses
sont saisies dans leur substrat, Siva.
Ainsi au jour de liesse le grand mystique, ses fonctions unifies,
au milieu de la foule en dlire - symbole de l'veil cosmique -
1. T.A. l V. 89-90.
2. Au sujet du Dieu vivant de Matre Eckhart qui droule la vaste multiplicit
de ses thophanies , H. Delacroix crit dans son Es.Tai sur le Nlysticisme spculatif en
Allemagne, Paris 1900, p. 182: Le Mystique y sent dj l'veil du monde et l'moi de
la cration en mme temps que l'ivresse de l'anantissement et du retour.
-47-
dans l'oubli total (nirvikalpa), n'a pas mme l'ide de se fixer sur
ce prodige ; il respire sans respirer, il agit sans agir vraiment, il
s'exprime sans articulation de paroles et tout se dploie en lui sans
effort, en pleine efficience. Telle est la batitude cosmique o tout
est ravissement puisque tout est Paramasivn Ralit absolue,
domaine du mantra 8ans houle ainsi descendu en ce monde. it
1
l. Nislnrmigiivatrr:ii sri 11rWr ek i .T.A. V.StJ. Cf. 83-89.
-48-
BRAIRA VAST A V A
1. cin-
[ mayam ekam anantam anadim l
bhairavanatham anathasaral)yaqi
[tvanmayacittataya hrdi vande Il 1
2. tvanmayam etad asef?am idan111
[ bhati marna tvadanugrahasaktya 1
tvam ca rnahesa sadaiva mamatma
. [ svatmamayaqi marna tena samastam l l 2
3. svtmani visvagaye tvayi nathe
[tena na sa111srtibhtikathasti 1
satsv api d urdharad ul).khavimoha-
11 3
4. antaka mar:p prati ma drsam
[ enaip krodhakaralatamarp. vinidhehi 1
sankarasevanacintanadhiro
[bhairavasaktimayo ,smi 11 4
5. ittham upolhabhavanmayasarp.-
[ vidddhitidaritabhritamisral) 1
mrtyuyamantakakarmapisacair natha
[namo,stu na jatu bibhemi Il 5
6. proditasa tya vibodhamarciprefil?i la-
[ visvapadarthasatattval). 1
bhavaparamrtanirbharaprl)e tvayy
[ aharn atmani nirvrtim cmi 11 6
7. mnasagocaram eti yadaiva
[klesadasa 'tanutapavidhatr11
nat.ha tadaiva marna tvadabheda-
[ stot.rapnram:rtavr;;tir udeti 11 7
1. Variante lanutm avidhaya.
-49-
8. sailkara satyam idarp. vratadana-
[ snanatapo bhavatapavidari 1
tavakasastraparamrtacinta syan-
[ dati cetasi nirvrtidharam Il 8
9. nrtyati gayati sarp.-
[ vid iyaip. marna bhairavanatha [
tva111 priyam apya sudarsanam ekaf!l dur-
[labham anyajanailf samayajiiam Il 9
krgiadasamyam abhinava-
[guptal) st.avam imam akarot 1
yena vibhur bhavamarusantaparp.
[ samayati janasya jhatiti dayalul.t 11
samaptarp stavam idam abhina-
[ vakhyarp padyanavakam l
-50-
HYMNE A LA GLOIRE DE L'ABSOLU
1. D'une pense identique Toi, en mon cur je rends hommage
1
au Seigneur Bhairava, refuge de qui n'a pas de Seigneur. Fait de
Conscience, unique, infini, sans origine, il imprgne la diversit
1
des tres mobiles et immobiles.
2. 0 grand Souverain ! Par l'nergie de Ta grce, cet univers
entier m'apparat dsormais comme identique Toi. Tu es ter-
nellement mon propre Soi; ainsi la totalit des choses est pour moi
identique au Soi
3

3. En Toi, Seigneur, mon propre Soi, qui pntres tout, la peur
de la transmigration n'a plus de raison d'tre quand mme subsis-
terait rellement une multitude d'activits forgeant terreurs,
garements et intolrables douleurs !
4. 0 Exterminateur, ne pose pas sur moi ce regard charg d'un
pouvantable courroux, sur moi auquel adoration et contemplation
du Seigneur confrent une immuable fermet, sur moi qui suis
identique l'nergie de Bhairava-l'effroyable [
5. Ainsi les paisses tnbres sont disperses par les rayons de
Ta Conscience
4
quand Tu t'approches, Seigneur l Plus jamais je ne
craindrai les agissements dmoniaques de l1 exterminateur, de
Yama
5
, ni de la mort, hommage Toi !
6. (Moi) Ralit mme de l'ensemble des objets contempls en
tant que rayons de la vraie Conscience apparue, c'est en Toi que
j'accde l'apaisement, en Toi, le Soi combl profusion par le
suprme nectar de (toutes) les choses.
7. 0 Seigneur, quand l'tat d'impuret dispensateur d'excessifs
tourments entre dans le champ de (ma) pense, l'instant mme
1. Saluer, d'aprs Abhinavagupta, c'est selon le systcme Pratyabhijna, tmoigner
d'humilit ainsi que d'un abandon total (prahval) de corps, parole et pense au Sei-
gneur, en ayant pleine conscience (parmar8a) de la supriorit de celui devant lequel
on s'incline. Cet abandon dpend de l'intuition mystique (svapralibh) qur, l'on a de
la gloire divine el ne peut donc s'accompagner d'indifTrencc. I.P.v. 1.1.l. p. 8.
'.2.. Vise$a, existence difTrencic ou l'objectivit qui sera mcnlionne au si. 6.
3. Sviitma, le Soi universel qui est aussi mon Soi et surtout, dans le prsent contexte,
Toi.
4. Tcxt. identique Toi.
5. Divinit de la mort.
-51-
surgit1 de moi la pluie du suprme nectar qui clbre la louange de
Ton unicit.
8. Si, Siva, ascse, bains, vux, dons, brisent le tourment de
l'existence, l'heureux souci
2
de Ta rvlation rpand dans le cur
un flot de flicit.
9. 0 Seigneur Bhairava, cette Conscience mienne danse1 chante,
se rjouit grandement, car ds qu'elle a pris possession de Toi, le
Bien-aim, l'accomplissement du sacrifice unique, celui de l'galit,
si ardu pour d'autres, lui est ais.
Durant la quinzaine lunaire sombre, le. dixime jour du mois
p a u ~ a
3
en l'anne 68, Abhinavagupta composa cette louange selon
laquelle l'omniprsent par compassion apaise instantanment chez
l'tre humain la douloureuse brlure (inhrente) au dsert du
devenir.
1. Udeli, s'lve parce que dans la voie mdiane il ne peul y avoir que mont<".
Cf. f.-uQialin'l, M.M., p. 49.
2. Cintii au sens de soin mais dont toute proccupation est exclue. l!:galcrnt!nl
discrimination.
3. Qui a lieu quand la lune se trouve dans la constellation u ~ y a dcembre-janvier.
-52-
COMMENT AIRE
Cette louange encore appele padyanavaka, en raison de ses neuf
stances, chante l'unicit divine, Bhairava. Cette dsignation de
Siva revt ici son sens strict d'indiffrenciation absolue, car en
bhairavavaklra il n'existe aucune distinctfon entre Siva et son
nergie tandis qu'en rudravaklra, elle tend s'esquisser et qu'elle
se pose clairement en sivavaklra
1

Se montre digne de saluer le Seigneur celui-l seul qui se recon-
nait comme identique lui. Pour qui possde un Seigneur, du fait
qu'il vit encore dans la dualit; un refuge dans l'unique Bhairava
devient irnpossible
2

Au cours de cet hymne Abhinavagupta affirme plusieurs
reprises son identit Bhairava, l'nergie divine, l'univers, ces
trois ne faisant qu'un. Mais en dpit de ses efforts, asservi des
mols, il ne peut chapper aux piges de la dualit
3
; qu'importe, il
le proclamera plus fort encore.
Parmi la quintuple activit du Seigneur', il ne mentionne ici que
la grce ( anugrahafokli) parce que selon sa glose la Para trsik :
Le Seigneur suprme ou la Grce mme est ternellement impr-
gn5 d'nergie en sa forme minente de grce, et l'nergie n'a pas
conscience d'tre distincte de Siva
6
; elle consiste en la prise de
conscience de la libralit en faveur de l'humanit ... ~

Et plus
loin, il prcise : fi L'nergie de grce veille perptuellement dans
tous les sujets conscients sans jamais se coucher.
Cette grce qui jaillit toujours et partout (sadodilala) le fait
selon une gradation
8
: d'abord indiffrencie, elle devient prise de
1. Sur les trois vaktra ou bouches du systme Trika, voir Jntrod. au V.B., p. 12.
2. Rm ex.primait lui aussi une ide analogue lorsqu'il chantait. : je suis de cette
ville qui est la ville de ceux qui sont sans ville. Ghazal 271, extrait du Diwan trad.
Eva Meyerovilch, .
3. Ce dont il s'excuse dans .;on commentaire 1'1.P.v. I.1.1, p. 33, l. 2. La dualit
perce dans les expressions : refuge en Siva, son adoration et sa contemplation, le
Seigneur remplissant et pntrant l'univers, etc.
4. Siva cre, protge el rsorbe le monde; il cache son essence par l'nergie obscur-
cissanle (tirodhariasakli) et la rvle par sa grce.
5. akriinta, en proie , saisi, charg, pntr de ; en vnin avons-nous essay de
rendre cette ide sans introduire objectivit et dualit.
6. cr. Bodhapaiicadasik, str. 3 et ici p. 25.
7. Comrn. au 81. I, p. 3; p. 12, 1. 5 et p. 13, l. 5.
8. La gradation de la grce consiste en vingt-sept types de faveur divine.
- 53-
conscience d'une simple tendance se diffrencier, et enfin elle
revt la forme diffrencie sous laquelle nous apprhendons le moi
et l'univers
1

C'est elle qui rvle de faon soudaine Siva comme le Soi que
l'on prenait prcdemment pour un je limit, impuissant, et mieux
encore elle dvoile Siva comme identique tout, savoir Bhairava
partout Tpandu, en nous, hors de nous, toujours gal lui-mme,
que ce soit dans les liens ou dans la douleur. D'aprs un verset de
Somananda : ' Moi, suprme Siva, je demeure dans la joie, dans la
douleur, dans l'oubli '. 2.
En ces circonstances, comment craindrait-on la vie en ce monde
alors mme qu'on s'y dpenserait au milieu d'insurmontables
difficults ? Siva ne se manifeste-t-il pas dans les nergies les plus
furieuses, telle la passion coupable qui ne recule pas le
meurtre d'un rival3?
A la strophe 4, Abhinavagupta s'adresse non sans humour
Siva qui, de son troisime il, consma le dieu de l'amour charnel,
Kama, au moment o il s'avanait vers lui pour le percer de ses
flches : puisque je possde, dit-il, l'nergie de Bhairava-le-Terribl?,
mon audace prvaut contre Ton regard terrifiant, moi que remplit
d'un inbranlable courage l'absorption ininterrompue en Toi.
vanouie galement la peur des autres aspects destructeurs de
Siva : anlaka, l'exterminateur qui spare l'me du corps, mrfyu,
la mort et yama, sa divinit dont le. rle est plus tendu puisque,
selon le systme Krama4, Y ama agit sous forme de ' restricteur '
dans les activits de la vie qu'il ronge et mine sans arrt en tant que
doute et alternative. (vikalpa).
Ds que la hantise du sarr1sara ne vous tenaille plus et que la peur
a fui, la flicit intrieure peut s'panouir. Abhinavagupta reprend
la strophe 6, sous l'angle de la batitude cosmique, le thme de la
premire strophe : l'identit reconnue entre le Soi, Siva ou la
Conscience universelle et le inonde form des nergies qui en
manent. Plusieurs ides fondamentales s'y trouvent condenses :
la Conscience dj toute surgie, au sens de perptuellement su!-
gissante5, a pour rayons les choses que je contemple. Mieux
je suis, moi, la Ralit de ces choses. Ma tche sera donc de falfe
pntrer les rayons de la lumire consciente qui les illumine et
1. P.T.v., p. 13, L 5.
2. P.T.v., p. 41 et VII, 1. 105, p. 219.
3. P.T., p. l. 7.
4. Dans son hymne aux douze kiili, le Kramast.otra, si. 18, le terme yama Il le sens
de vikalpa.
5. cr. ici p. 15.
-54-
dont je suis la source, jusque dans le monde que j'apprhendais
comme objectif et extrieur moi. Alors et alors seulement, je
m'identifierai la Conscience et son irradiation, celle-ci tant
moins une connaissance qu'une extension de mes pouvoirs et de
ma flicit. Il s'ensuit d'une part que la Conscience, bien que surgie
de toute ternit, se lve nouveau quand on se sert de ses rayons
pour clairer le monde ; et d'autre part, que le mystique devient
le centre o -confluent et fusionnent toutes les flicits, non seule-
ment celle de la Conscience ( cidananda), intime, apaise, proc-
dant du Si reconnu comme identique Siva, mais aussi le nectar
qui s'coule avec surabondance des choses de cc monde
1
Il jouit
ainsi en Siva mme de la batitude cosmique (jagadananda) ;
plus rien n'tant spar du Tout, la pluie de nectar se dverse sur
lui lorsqu'il s'y attend le moins, au moment o approche
menaante de sa pense. Mais en quoi consiste ici une telle impu-
ret? Doit-on comprendre qu' l'instant o les souffrances
assaillent le yogin, il prouve une grande flicit qui se rpand dans
son corps dans le cas de douleurs physiques ou un calme
qui supprime l'agitation mentale ? D'aprs Abhinavagupta
2
,
klefo dsigne l'ensemble des choses susceptibles d'engendrer un
penchant l'ignorance, de rveiller le sentiment du moi ou le couple
attachement-aversion. Il s'agirait donc d'uRe vritable impuret
intrieure, retour offensif de l'ego ou de quelque autre forme de la
dualit. Pourtant, que celle-ci pntre dans le champ de sa cons-
cience, et le yogin vigilant, aussitt alert, plonge dans les profon-
deurs du Soi d_'o s'lve en une gerbe jaillissante un flot de nectar
dont chaque goutte entonne en retombant la louange de l'unicit
divine ; et lorsque la flicit du Soi devient vi?ible dans l'impuret
elle-mme, cette dernire se dissipe immdiatement pour faire
place au seul Paramasva.
Si les pratiques religieuses et rituelles, dons, vux, bains, etc. ont
un efTet ngatif en dissipant la peur de la prgrination (saf!lsi.ra)
et en apaisant l'inquitude morale, seule la connaissance intuitive
des textes sacrs assure positivement de la flicit, en toutes cir-
consta'nces, d'o la grandeur de la Rvlation
3

L'unique culte ou sacrifice dont on ne puisse se dispenser, celui
de l'galit, se ramne e contempler l'nergie souveraine (la
khecar) toujours identique elle-mme; sans elle, il n'y aurait
pas de sujet conscient (itman), de pense, d'organes de connais-
l Voir l'hymne en l'honnc11r de la Roue des nergies, ici p. 97.
2. Tathihi vwyara.;ivfJs<d CVtisyiividyiismitiiriigadve$ribhiniut5adayal) klt.s<iti 1 1. p .v.
I 11.2.3. vol. Il, p. 220.
3. Cf. M.M., p. 86-87 et. 5.
- 55-
:-ancc internes ou externes, ni de monde sensible diffrencit
puisque les nergies dont procdent les quatre mouvements de la
manifestation, n'tant plus en contact mutuel, ne se rvleraient
pas. C'est elle, khecarl, que l'on dcouvre dans l'asprit du dsir, de
la coln! etc. On jouit de son quilibre ou uniformit (samalii}
quand on la sent partout immuable, savoir dans les quatre mou-
Yements qui couvrent toute l'expansion de l'univers, du fait qu'elle
ri pour essence Bhairava, parfaite plnitude. Mais que fasse dfaut
peu que ce soit, la reconnaissance intgrale de sa propre nature
de complet unullara, et l'on (sera soumis) l'ingalit des fluctua-
lions ce qui prcisment constitue le smpsra.
1
.
Pour qui panient Bhairava, le culte d'une conscience homo-
lb::o.e et sans scission apparat ais, tandis qu'il ne peut tre
<ic:c.ompli par celui qui vit spar du Tout, dans la rocailleuse
dualit. en pleine dissonane. S'panouissant dans l'quilibre,
l'hnrmonie et la douceur, la Conscience lgre et allgre chante,
danse- <'l ;;;p spontanment, aussitt le Bien-aim obtenu.
1 .\"cr /Jy 1il111rm() luhyfinaf!l ca bhedai:i.yaynsya
1!111trrtslhii c11 u11.iucttc abhisar11dhrwdy ayogcl aprakafotul r.11 saiLa khecari li:am_akro-
1ll1diripr1iriyi lnJ ... yyr1Jc tasyt1 samaUi surN1traiva
wr1hhl.1I/ ''fJ!J rmilmlrm1flarnsuarrcptiparijiiJinum eua cittavrttlniirfl
w1ii.rt C<I 1 P.Tx., p. Ill. l. :l. Sur les IJllfltr<.' ffiOll\'ernenls ou flots de l'ncrg
fl.-llec(1ri, t/il.-c1ir, yocarr tl l1h1icm'i), d. )1.:\1., p. lei p. 96 sur khecari et P 7l
"Ill'
- 56-
ANUTTARA$'f IK
1. samkrmo 'tra na bhavana na ca kathayuktir na carca na ca
t dhyana1p va na ca dhara:r:ia na ca japabhysaprayaso na ca 1
tat kirp. nama suniscitarp. vada pararp. satyarp ca tacchryatarp
(na tyag na parigrah bhaja sukharp sarvarp. yathvasthita}:i Il 1
2. sarpsaro 'sti na tattvatas tanubhrtarp. bandhasya vartaiva ka
(bandho yasya na jatu vitatha muktasya muklikriya 1
milhyamohakrd rajjubhujagacchayapisacabhramo ma kiqi-
[cit tyaja ma grhal).a vihara svastho yathavasthita'Q Il 2
3. pjapjakapjyabhedasaral)il). keyarp kathanuttare sarpkramal)
(kila kasya kena vidadhe ko va pravesakramaQ 1
myeyaq:i na cidadvayat parataya bhinnapy aho vartate sarvarri
( svanubhavasvabhavavimalaf!l cintarp. vrtha ma kthal) 11 3
4. anando 'tra na vittamadhyamadavan naivanganasangavat dpar-
(kendukrtaprabhaprakaravan naiva prakasodayal:i 1
sarpbhrtabhedamuktisukhabhr bharavataropamal:i sar-
[ vadvaitapad_asya vsmrtani<lhelf praptil) prakaso<layati 11 4
5. ye bhavaQ.
[pravibhnti visvavapu!?o bhinnasvabhava na te 1
vyakti:qi pasyasi yasya yasya sahasa tattattadekatmatasarp-
[ vidrpam kirp na rama se tadbhavananirbharaQ 11 5
6. prvabhavabhavakriya hi sahasa bhavah sada ,smin bhave
[ madhyakravikarasarp.karavatarp kutal). satyat 1
nil)satye capale prapancanicaye svapnabhrame pesale 5an-
[katailkakalankayuktikalanattal) prabuddho bhava 11 6
7. na samudbhavo 'sti sahajas bhanty am
[ml:isatya api satyatarn anubhavabhrantya bhajanti J
tvatsankalpaja visvamahirna nasty asya janmanyatal:i tas-
[mat tvarp. vibhavena bhasi bhuvane!?v ekopy aneklmakal). 11 7
/
I
8. yatsatyaryi yadasatyam alpabahular!1 nityarp na nityarp ca yat
[yanmaymalina'!l yadatmavimalar ciddarpa_r:ie rajate 1
tatsarvarp svavimarsasarrividudayad rpapraksatmakarp
[jnatva svanubhavadhirQ.harnahima visvesvaratvaf!l bhaja 11 8
- 57-
HUIT STANCES SUR L'INCOMPARABLE
1
1. foi nul besoin d.e progrs spirituel ni de contemplation, ni
d'habilet de discours, ni d'enqutes, (nul besoin) de mditer, ni de
se concentrer, ni de s'exercer aux prires marmonnes. Quelle est,
dis-moi, la Ralit ultime absolument certaine ? coute ceci :
ne prends ni ne laisse, tel que tu es, jouis heureusement de tout.
_2. D_u point de vue de la Ralit absolue, il n'y a pas de trans-
alors est-il question d'entrave pour les tres
v1vants
2
? Puisque l'tre libre n'a jamais eu d'entrave, entreprendre
de le librer est vain. Il n'y a l que l'illusion de l'ombre imaginaire
d'un dmon, corde prise pour un serpent qui produit une c?nfusio!1
sans fondement. Ne laisse rien, ne prends rien, bien tabli en t01-
mme, tel que tu es, passe le temps agrablement
8

3. Dans 1' Inexprimable1, quel discours peut-il y avoir et quelle
voie diffrencierait ador, adorant et adoration ? En vrit pour
et comment un progrs se produirait-il, ou encore qui pntre-
r:11t par tapes (dans le Soi) ? Oh l\forveille l cette illusion, bien que
difTrcncie, n'est autre que la Conscience-snns-second. Ah tout
est essence trs pure prouve par soi-mme. Ainsi ne te fais pas
de soucis inutiles.
4. (Cette) flicit n'est pas comme )'ivresse du vin ou celle des
richesses, ni mme semblable l'union avec la bien-::timc. L'appa-
rition de la Lumire consciente n'est pas comme un faisceau de
lumire que rpand une lampe, le soleil ou la lune. Quand on se
libre des diffrenciations accumules
4
l'tat de bonheur est une
allgresse comparable la mise d'un fardeau:
de la Lumire est l'acquisition d'un trsor oubli : le dommne de
l'universelle non-dunlit.
5. Attirance et rpulsion, plaisir et douleur, lever coucher,
infatuation et etc., tous ces tats participant aux
formes de l'univers se nrnnifcstcnt comme divrrsifis mais en leur
nature ils ne sont pns distincts. que tu saisis la parti-
rularit d'un de ces tats, :=ittcntif nussitt il ln nature de la
1. Anutlara, InsurpnssaLle et Jn<fTriblP. Sur cc trrmr aux sens multiples, r.f. ici p. 5!).
Vers cit par Jayaralhn, T.A. IV, eomm. aux 9'2-9:. p.
3. \'ihr- s':lmuser, nncr.
4. Cultives depuis un lr:-i Iointnin pass1!.
5
- 58-
Conscience comme identique lui, pourquoi, plein de cette contem-
plation1 ne te rjouis-tu pas ?
6. L'efficacit de ce qui existe aduellement n'existait pas
auparavant ; de faon soudaine, en effet, surgissent toujours les
choses en ce monde
1
A quelle ralit peuvent-elles prtendre, ainsi
troubles
2
par la confusion dformante de l'tat intcrmdiaire
3
?
(Quelle ralit) y a-t-il dans l'irrel, l'instable, le falsifi", dans un
amoncellement d'npparences, dans l'erreur d'un rve? Reste par-
del l'imperfection propre aux angoisse:-; du doute et veille-toi.
7. L'inn ne (peut tre sujet) au flot des existences objectives ;
celles-ci ne se manifestent qu'prouves par toi. Bien que prives
par nature de r.alit, en un instant, par la faute d'une erreur de
perception, elles prennent part au rel. Ainsi jaillit de ton imagina-
tion la grandeur de cet univers puisqu'il n'existe pas d'autre cause
son C'est pourquoi, par ta propre gloire, Lu resplendis
dans tous les mondes et, bien qu'uniquc, tu es l'essence du multiple.
8. Lorsque surgit la Conscience en tant que contact immdiat
avec soi-mme
5
(alors) le rel et l'irrel, le peu et l'abondant,
l'ternel et le transitoire, cc qui est pollu par l'illusion et qui est
la puret du Soi apparaissent radieux dans le miroir de la Cons-
cience. Ayant reconnu tout cela la lumire de l'essence, (toi) dont
la grandeur est fon<le
6
sur ton exprience intime, jouis de ton
pouvoir universel.
1. lnopinimcnl. cl ii clnupu; insl alll.
'2. Sm!1l11ra, mlan!-!1\ ce <Jll devient imp11r au Cnlllacl <l'unv impure.
:l. :\ r.1 Yoir l'explic:al.ion ici p. 6:J.
-L Pe.fola, factice>, 11tiflcicl cl rraudul1ux.
fi . .'-1
1
at.'iuwr.fo
1
pris1 111' conscit11ce d1 soi, rc1.:on11:iis!-mn1;e com1ne p:1r
louclwr.
() . . nu sens de forlcmcnL l:l1\1\ it ln ferme possession
de: Stl propre p11isil' da us sou i11t11il ion inHn"dial', t;t'lll' <le Soi, de\e1111t.'
rt':tlil( t:111g-ihh:.
-59-
COMMENTAIRE
Les huit stances de cet hymne ont pour thme essentiel l'insur-
passable Ralit que chante galement la Paratri!!lsika. Aussitt
reconnu, 1' anultara confre la libert en cette vie mme.
Le terme anuilara est si riche que .Abhinavagupta a senti le
besoin, dans sa glose ce d'en expliciter les significations
varies en se jouant de l'tymologie. J'en choisirai certaines qu'il
avait probablement prsentes Pesprit quand il crivait cette
louange :
1. A nullara: incomparable et transcendant, rien n'tant sup-
rieur la Conscience minente et plnire du suprme Bhairava
qui existe ternellement et se rpand de faon spontane, en toute
libert.
2. L o il n'existe ni question du disciple ni rponse
du matre ; le disciple tant le rceptacle ternel de l'illummat10n,
autrement dit une question jaillissant du grand ocan de la
A quoi servirait une rponse du matre puisque la
Reahte lm apparat sans discontinuer.
3. Ui-lr- l o point n'est besoin de traverser (uilarl)a) jusqu'
l'autre rive afin d'atteindre la libration. Celle-ci selon l'image
que s'en font les partisans de la diffrenciation n.'chappe nullement
aux limites car elle comporte des degrs : corps, souJllei int?llect,
vibration, vie, puis vide de toute objectivit, disparition des unpu-
rcts et, la fin de cette ascension atteinte de la cime, l'tat <le
Siva correspondant la dlivrance.' Une semblable progression se
montre superflue puisque, en anullara, il n'y a aucun lien, on peut
s'identifier Siva en ce corps mme. Ou encore si_ ullara
comme une monte travers les centres : nombril, gorge, pahns,
fente du brahman etc., arwllara est ce qui la transcende.
4. Ullara a aussi pour sens' ce dont on sort', savoir l'esclavRge;
<'t la libration sera l'anullara.
5. Si uliara est pris au sens de spcifications verbales distinguant
de toutes les manires 'ceci et cela ', anullara deviendra l
1
incx-
primabie qui ne comporte aucune distinction et ne tranche pas.
Tant que le sujet conscient, sous l'empire de l'illusion, dsire
pntrer dans l'anullara, il est limit, fait de pense dualisante
l. P.T.v, p. 19 25 en libre traducLion.
- 60 --
(vikalpa); mais s'il recouvre l'indiflrenciation (avikalpa) quand
l'artificiel s'vanouit, voil en vrit l'anullara. Alors, comment
l'aide de la contemplation et de la pratique des organes, etc. ( attein-
drait-on) Siva qui a surgi de toute ternit et qui r s ~ e galement
dans les activits courantes ? En vue de montrer que Siva, suprme
Sujet ne devient jamais objet pour un autre et ne tombe donc pas
dans le domaine de l'exprience consciente, mme durant le
samiidhi, Abhinavagupta donne l'exemple d
1
une averse imper-
ceptible sur le fond continu du ciel mais dont on voit les gouttes
distinctement si elles se dtachent sur un fond prcis comme le bord
d'un toit, des arbres, etc
1
La vritable Conscience ne peut tre
qu'humilie lorsque, I1associant au temps, au lieu et autres dter-
minations, on la prend pour l'exprience de Bhairava.
6. Ultara peut signifier une gradation de moyens et. de buts :
ainsi la voie infrieure de l'individu permet d'accder la voie de
l'nergie et celle-ci la voie suprieure de Siva
2
Ou encore la veille
mne au rve, le rve au quatrime tat et ce dernier ce qui le
transcende (luryama); que cette gradation disparaisse et seul
demeurera l' anullara.
7. Anullara dsigne aussi le domaine o infrieur et suprieur
n'ont plus cours.
8. Nud-lara, nud- au sens d'inciter; le matre lors d'initiations
successives pntre dans la conscience du disciple afin de l'inciter
et le disciple obtient la libration (lara)3. Mais comment la cons-
cience de soi, lumineuse par elle-mme, omnipntrante, non
limite par les particularits de lieu, de temps et de forme, se
plierait-elle de semblables parodies ? Qu'il n'y ait plus outrepasse-
ment ni incitation, l'anullara, l'absolu, demeure, le maitre n'a rien
faire puisque Bhairava ne cesse de se rvler.
9. A-nul-lara. Le phonme A connote l'nergie suprme qui rside
au dbut et la fin du Je plnier\ universelle prise de conscience
correspondant l'nergie jaillissante, au ravissement du Soi, ocan
sans houle, qui est pacification de la grande lumire, libre du flux
de l'illusion. Nul dsigne le terme de son expansion ( visarga) et
lara, le flot mme qui vous emporte par-del tout.
Ainsi anullara, Inexprimable, que rien ne surpasse, ch:-ippe aux
moyens. Inutile donc de mditer, de rciter des mantra, de dis-
courir son sujet, d'tre initi par un guru, de rechercher la vrit
1. Cf. La Bhakli, Tntrod. p. 18.
i. cr. ici p. 11, 14.
3. A cc sHjf.'t, T.A. XXlX.237 %0.
4. S1r A = anutlara, cf. V.Bh., p. 68 cl 128, si. 90.
- 61-
ou de tendre la libration, car rien ne permet de 1
1
approcher, Lui
en qui nous rsidons, notre vie, notre conscience ternellement
prsente. Que reste-t-il faire ? Demeurer l o I1on est, dans le Soi,
sans prendre ni repousser puisque la Ralit est solidement tablie.
Sans effort on jouira alors de toute chose. A la source de la doulou-
reuse instabilit constituant le devenir (saT[lsira), que dcle-t-on ?
un dsir qui ne cesse de s'emparer d'une chose et d
1
en rejeter une
autre. Selon les Spandastra (46) le libre Sujet se trouve priv de
sa gloire native ds qu'il perd la saveur du suprme nectar d'immor-
talit ; les ractions de sa conscience chacune de ses impressions -
sous forme de saisie et de rejet - font de lui un objet dpendant de
ces impressions et notions, et l'esclave de ses propres nergies. Le
mystique lui-mme n'chappe pas ces ractions ; il prend et
repousse lui aussi quand il s'affaire en exerant soume, pense et
organes en Yuc de rompre ses entraves. :l\fais ce lien consiste juste-
ment se tenir pour asservi : Tromp par l'illusion (maya), le
sujet se croit li par des actes, limit par le temps et il transmigre:
On nomme ' libr ' celui qui le Soi se rvle en son essence et qui
considre le corps et le monde comme non diffrents de la Conscience;
libre en efTet du lien des renaissances, la mort il ne fera qu'un
avec Siva. Comment peut-on en ce cas parler de libration s'il .n'y
a ni lien ni dlivrance ? C'est par contraste avec son tat
ou par comparaison avec d'autres sujets qu'on le dit mondame-
ment libr (mulcla). 1
En fait, il n'y a ni tyrannie du devenir, ni fuite hors du :
il suffit de prendre pour assises inbranlables le Soi sans se faire de
souc.i, sans s':igiter ni s'vertuer s
1
emparer de ce que l'on possde
ternellement, ni s'acharner briser des attaches qui jamais n'ont
entrav l'tre libre par essence. . .
Si, objecte-t-on, l'illusion existe et doit disparatre,.
gupta soumet l'adversaire au dilemme suivant : ou bien l 1llusion
existe spare de la Conscience et se rduit alors l'ombre d'une
ombre ; ou bien elle se confond avec la Conscience et n:est autre
qu'elle. Il le dclare dans sa alose la PartrSik
2
: .. Le pouvoir
procdant du flux de pntre jusqu' la multiplicit des
choses externes bien o se manifeste la difrenciation.
l\:lais celle-ci ne difTrc pas elle non plus de I1anullara, grande
lumire, le 11ux universel n'tant que conscience intriorise. La
grandeur de I'arwllara consiste panouir le difTrenc.i de par sa
transccndnnce mrne et de par la puissance de la prise de conscience
merveille et 80uver:\inc dont la libert excelle au plus haut point.
1. l.P.v. llI.'2:?-3, vul. li, p.
'!. p. 38.
- 62 -
En effet, la cause qui claire l'panouissement des choses ne (peut)
tre prive de lumire ; mais si elle est lumineuse, elle s'idcnti fie
alors l'illustre Seigneur Bhairava.
En consquence il n'y a rien d'impur, tout est parfait, y compris
l'illusion et la diffrenciation qu'elle engendre. L'illusion a po4r
unique caractristique la perte d'une conscience globale, aut.rcmettt
dit notre impression d'tre privs de plnitude, de libert et d'infi-
nit, lesquelles ne cessent. pourtant jamais de briller en nous.
Si un hom111e a foi en son matre, pour peu qu'il l'entende affirmer
(comme Abhinavagupta le fait ici) que l'illusion se ramne la
Conscience-sans-second, et, immdiatement, il le vit de manire
active, non thorique, il se l'approprie par le cur, et il s'en trouve
aussitt tout entier transform. Mais que l'on n'imngine surtout
pas de faon dualitaire l'inexprimable flicit prouYe ;
n
1
a rien de l'ivresse ni des plaisirs qui combleraient un manque :
possession de biens matriels ou spirituels, ou union de deux
personnes spares compltant un bonheur jusque-l impnrfait.
Non, sa batitude rside uniquement dans le Soi auquel rien ne
peut tre ajout ; bien au contraire une charc-e :lcca blante t.ombc
soudain de lui ; il demeure tel qu'il est en lui-mme, lger. plein
d'allgresse, apte vivre en fin et dployer n'importe quelle
activit. L'illumination ne ressemble pas non plus nu
d'une lumire nouvelle qui procdant d'un second serait dirige
sur un homme terr dans l'obscurit; c'est le retour rL:n dont la
multiplicit factice surajoute fond comme la neige 8u ;
ou la dcouverte du trsor intime - le Soi - toujours et
dont on n
1
avait plus souvenance par la faute d
1
unc monstrueuse
aberration. Rien de nouveau n
1
est accompli, crit Abhimtvngupt.a,
seule s'efface l'ide que l'on se faisait d'un tre lumineux comme ne
brillant pas
1
* Le mendiant couvert de haillons prend brusquement
conscience de sa qualit de fils de roi et rejette en riant ses oripeaux.
On reconnat donc ce que l'on a toujours su : le domaine inn et
spontan (sahaja) subsistant inaltrable la disparition dr: ce qui
le recouvrait.
Si un instant suffit l'Insurpassable ( anullara) pour eonfrcl' la
libert en cette vie
2
, un instant suffit pour asservir. Afin de mieux
comprendre comment on se lie et comment on se dlie, Abhinava-
gupta dmonte sous nos yeux le mcanisme qui suscite les existences
objectives issues de l'alternative et du doute ; mais existence$,
1. Keualam Ui na tu kirrtcid 11p1rvary1 kriyale n</! /allual11
prakiisamina eua yal 'na prah:iisate' ity abh imanana1!l ladapas1irunte 1 [.P. v. 11.1r1. 1 7,
vol. 1 T, fin de la p. l
2. P.T. si. 1, p. 3. Comm. p.
- 63-
ne l
1
oublions pas, ne seraient rien sans le fond de l' Essence unique
et indiffrencie dont elles surgissent et o clfos retombent, ondes
lgres la surface de l'ocan.
Prenons l'exemple classique du Trika : sur l'immuable Soi, paroi
lumineuse et incolore, notre imagination projette ses fantasmes
discontinus et impermanents
1
; les images passes ne sont dj
plus1 les futures ne sont pas encore, seule fimage actuelle, celle de
l'instant prsent se montre relle puisque efficiente. En cet instant
on se lie
1
en cet instant on se libre. II suffit donc de rester conscient
<le l'instant jnilliss:mt pour percer :i jour l'illusion dformatrice :
simple erreur de perception due la confusion propre au dsir qui
se penche vers le pass lors du rcO'ret, qui tend vers l'avenir pour
le susciter, engendrant :linsi sans :lrrt la dure par sa tension
mme. Le refus de SP. tenir rtcrnel prsent forme donc la zone
dite intermdiaire de l'illusion (maya). Cette zone n'a de sens que
par rapport aux trois moments successifs que l'on dcle dans toute
;1ctivit, mouvement ou perception : fo premier instant ou pointe
initiale (pralhamakoJi) rside dam; la conscience du .Je ou repos
::;oi-mme. Il consislP p:1r exemple en dsir de voir
2
Mais aussitt
l'tat le recouYrc en troublant et brouillant <le ses
remous l'instant lucide de 1a conscience de soi. La pense sous
rimpulsion du dsir fuit <lfilcr d'innombrablrs images.
l'instant final (aparakofi) forme le retour dr. eeU.<" au Je
indtern:iin. Mais celui-ci chappe l'ignornnt qui. nt ptiv p:1r
la zone mtermdiairc, ne voit qu'elle.
. Ainsi les choses en leur spcificit ne constit.ue11 : >:t=-' l'
rnne, elles n'ont d'existence que m:rnifestes dans ln
et par elle. Par contre 1' Inn, le Soi, telle la glace pure d'un
reoit les images sans en garder la moindre trace, sans en tre altere.
Apparemment plein de choses, en fait, il ne ronticnt rien.
Dsir et altcrnntiYc nous asservissent en nous l>allottnnt
l'attachement 1a rpulsion de l'exaltation la dpression, et.
nous cachent l'univers rel. Pour leur chapper, il faut s'en tenir
l'essence et, en toute chose spcifique, rester attentif la
Consciente qui constitue son trc vritnble
3
. Alors celui qui
1. Thorie <lt 1'11nhcrsclk imp<mrn1wncr. tl dt lnsl:111L:n1iit emprunte par
Abhina\'ngupta aux ilouddhisLis VijHinuvdin, \:1 dilrencP. f(llC pour lni les
imngt-s et rencts (iibhsa) ont
1111
fondrmcnl stah, 11 lrur vt'.>ritnblr
S11r des Bouddhistes, cf. J11stanl el cause, le discrmlinu dons la pense
philosophique de l'inde, pnr Lilian SillJUrll, Paris '.Vrin) 1%11, p. il -100.
2. Intention 011 pure vigilnm,.r de lu Ccnscicnco. Cf. ta JJhaJ.:fi, p. 3.
3. Dans son Tantriiloka J 11, 8-9, comp:.1n la puriL e l'lre
t':xtrmcment lumint'UX i1 e1'll<' du miroir qui rende lt's clios<'s comme dislinclt's
lui (tant ellls y sonl :1\1c clart) if'n rpt<' C1.'S rilkls ne 1rnissl'nl t'n tre
st'>pnrl'>s.
-64-
sa J01e en une semblable contemplation s'apaise ncessairement,
la conscience de soi se rveille en absorbant la houle de l'imagina-
tion ; rel et irrel, ternel et transitoire
1
impuret, illusion, et ce
qui est pur dans le Soi : l'univers entier qui revtait ces formes
diverses apparat glorieux dans le miroir de la Conscience ds qu'il
se confond avec sa lu:rpire. Cette gloire universelle qui irradie des
nergies infiniment varies se rattache la gloire du Soi car, tant
qu'elle ne s'enracine pas dans la certitude de l'exprience intime,
elle ne donne pas souverainet sur l'univers.
Mais pour que la conscience devienne le clair miroir de l'uni:vers,
il importe qu'elle soit calme, pure, c'est--dire lisse et unie comme
lui et que sa rugosit acquise fasse place l'tal d'quilibre (samala)
afin que, au point de jonction des changements, on demeure aussi
immobile qu'un miroir et comme lui sans attache ni rpulsion.
Quand la Conscience de soi surgit et recouvre sa nature originelle,
le yogin participe l'univers total dans lequel la diversit s'unifie ;
il jouit alors d'omniscience et de souverainet
1
l'instar du Sei-
gneur.
I. l.P.\'. ;J. 15, \'OI. J 1, p. Cl'L dt l'ornniscituce St' trouve aussi dans fa
'connaiss:incl' d.c miroir' (iidursajrna) des \'ijnrrnnvildi11; elle consiste, crit Paul
Dtmivill(', en Cl' que t.oul le connaissnl.Jlc mire pl'rplucllement dans J'nsprit. des
Buddhas, sans limilalion de temps ou d'f.'spucc, sans erreur possible et sans que les
Buddhas en puissent jamais rien oublier, mais aussi Sl:lns que> le connaissable leur soif
prsent par un processus perceptif cl sans 1111'cn soit afTecl.c en rien leur nature proprt!
lcrnellcment pure. C'est dans ce miroir que lous les tres vivants voient apparaitre,
comme des reflets, les objets de leur connaissance, en particulier les objets de na Lure
bonne et salvifiqul' . Le 1\1iroir Spirituel. Sinologica, Bk., vol. 1, 1948, p. l '26-127.
cr. ici p. 74.
- 65-
PARAMARTHADV DASIKA
1. saq1bhaja nityam alpavacanair jalpakramarp sarphara
[tatsarphragamcna kir katham idarp ko 'siti mack}pa}_l 1
bhvabhavavibhagabhasanataya yad bhaty abhagnakramaqi
ta('C'hnyarp si,-adhma vastu paramarp brahmatra ko 'rtha-
[grahal). 11 1
) Yt dy ::t l<1 tL vu pari ha ra pn-.1karp tattvaip tadatattvam eva
[hi 1
yady <:it:".l\am <:1Ll1<1 tuttYam en v LatLvam eva nanu tat tvam
(drsam Il 2
:L \ad yad bhti na bhanalal) prthag idaq1 bhedo'pi bhatti cel
Lbhne so 'pi na kif!l jahi tatas tadbhangibhangagraham 1
pratharp gatavati kriaiva no bhtakrcchas-
hutabhur'mirghatabandhadikam 11 3
4. jnnakriyk<llunHprv:ikam adhyavasyed yad yad bhavan
_ . . . [kathaya ko 'sya JaQad 1
sphurJaJ JHQO 'pi na kim advayabodhadhama m}:lsimamtyamr-
[ avagrahasatyarpam Il 4
;J. bha vanam a vabhasako "si yadi tair mohal). kim atanyate ki111 te
[lad y a di bhanti hanta bhavatas tatrapy akhal).<;iaqi mahal). I
no cen nlisti tad evam apy ubhayath nirvyjaniryantrar:ia-
[ tru ty<uhibhramanityatrptnmahim nityarp prabuddho 'si
[bhott 11 5
6. d rH iip bah il) pra hir:lU syad bhairavnuka-
[ raI).arp va ta vancaneyam l
na bahyam asti nabhyantararp
(niravakasavikasadhamna}:i IJ 6
7. vasanaprasaravihhramodaye yad yad ullasati tat tad
- . [tam l
tatra cet bhasi bhasi tava liyatc jagat JI 7
-66-
8. moho duQ.khavitarkatarkaI)aghano hetuprathanantarapro-
[ dyadvibhramasrnkhalatibahulo gandharvapl}sannibhal) [
dvaitadvaitavikalpanasrayapade cidvyomni nabht.i cet ku-
[trnyatra cakastu kas tu para ma anekatmana 11 8
svapne tavad eva prntha
f naivasyasti taduttare nirupadhau cirlvyomni ko 'sya g-rahaJ:i !
eva dharavad arthanicayal) syac cet kutracit
[jnanentha tadatyaye 'prthag t.ntrapi k li 9
10. yc yc kc 'pi prakasa mayi sati par::imavyomni
(kas hy ete=?U nitye mahimani nrnyi te nirvibhg<-np vibhanti[
so 'hrirp nirvyajanit.ya prl tihataka lcmanantasa ty1svatantradh-
[ vastad Y ait.a 'chayaridn1yn m:ty:1 timira parnbocihapra k5saJ:tl l I 0
11. klal:i sarpktllayan kalayatu srjutv dara<l aj1aya}:l
[parat.antrat.am upagato mathnatu va mannrnthal:i ]
krlalamba mm nm ba ra $rl1yam iv n svollekharPkhk ra ma r!l
nstu m1 kim IJ 11
12. ka9 ko 'tra hhor ynrp kn\'ulkaromi lm}:! ko l1hor ywp
[:;ahas5 nih:mmi 1
ko "tra bhor ya1p p"r<1bodhadhnrn=--ancurvH"9onmattatanul:i
=pivami Il 12
gadasrgalavdravaQ.f!l prabodhi-
[ dhuri dhmatam api yaduddpanam
1
1
:-:.n1clhamigahana ta,vih:1ral)titrpty udgamat kubhedlkari-
[brrrihitarp vyndhit.n ramyadevo hariJ:i 11
1. Varianlc urldipayan.
"2. D'aprs manuscrits jt' corrigl' sudhcima en >tmihm1i.
3. abherJa. <:Pll1 d..rniirp stroph1 SPmld1 c1>rrornpuc.
- 67 -
DOUZE STANCES SUR LA RALIT SUPRgME
l. Gote toujours la paix et abstiens-toi du perptuel bavar-
dage aux vains propos
1
en vitant les (expressions) ' qui es-tu,
pourquoi, comment, qu'est qui encombrent le chemin. Cc qui
se .rvle (alors) comme la lumire (clairant) les distinctions entre
existence et non-existence c'est la m:rnire d'tre sans fissure, le
Vide, le domaine de Siva,
1
la Ralit, le brahman. Quelle
apprhension objective y (dclerait-on) ?
. Une fois cart l'rrel, le rel auquel tu accdes est lui-n:imc
1rreclz. Irrel ou rel, n'est-ce pas cc Rel mme que lu es iden-
tique?
3. Toute manifestation est indpend:rntc et non pas duc la
(de la conscience) , dis-tu, mais si cette
t10n elle-mme se manifeste, ne se manifestc-t-ellc pas, elle aussi,
dans la lumire ? Abandonne donc ta tendance hriser cctLc
bri.sure
3
Si, au cours d'un rve, on sait que l'on rve
1
on n'prouv.e
pomt de peur quand on reoit un coup d'pe, qu'on rst noye,
brl ou emprisonn, car ce n'est l qu'un jeu.
4-5. Quelles que soient les c;hoses que l'on pose sous l'incit.ati?n
d.e la connaissance et de l'activit
4
, dis-moi en quoi se. dls-
tmguent de l'inconscient? Et si l'inconscient vibre lui aussi, ne
(fait-il p:-is partie) du domaine de la Conscience sans
ternel et qui, minemment rel, chappe toute r.rsc
mtellectuellc ? Si c'est toi qui manifestes les eho:;cs, l
se rpandrait-elle par leur intermdinire? et si ccllcs-ci
festent cette (illusion) n'est-ce pas grcr, toi ?

ton clat demeure indivis. Sinon (si tu n'es pns celui qm


manifeste les choses), elles n'ont p::is d'existence. Dans les deux
cns (on ne peut poser d'existence objcclin distincte de la cons-
cience). (Toi) loujour:; satisfail1', que r1
1
'n ne
1. PhraSl'S t:rPus1s tI in!'it..rniflantes.
2. On p<11f Colllpiindrr : Je r<'l'I a11q111I 111

1sl la r(alitl .1. lns11r-


1:iss;.iblc (an11/h1ro) el donc ton Soi.
TU1wigibhr11ir1af1ralw . . i'u <le mols oi1 .\lrlti1m\;q.!llpla inslsk sur le h1is1r.
DoiL-on C1llllfH'Pndr1 lmlmw comme 11nl' acli\"il1' suhlile Pt. l.'riyr comme l':wlhil1"
ordinaire?
;'!, En r.elll olj1c1i,ii.1.
-68-
restreint, qui pulvrise l'erreur, oh ! merveille, tu es perptuelle-
ment illumin t
6. Tourne ton regard vers l'extrieur tout en passant au-del
du sentier du visible (dis-tu) ! Allons donc! Il s
1
agit de cette trom-
perie la ressemblance _la

ci:I. de la Conscier;1ce
libre de dualit n'est m a l exter1eur m a l mter1eur, le domaine
de l'panouissement ne leur laissant pas de place.
7. Tout ce qui se rvle lorsque le flot d'impressions s'panche
avec vhmence
2
, c'est cela mme qu'il te faut observer avec
intensit : si tu y apparais et apparais encore et encore au dbut,
au milieu et la fin, Oh ! l'univers ( difrenci) se dissoudra.
8. La confusion s'paissit quand on se proccupe de doutes rela-
tifs la douleur. Les entraves, dues aux erreurs surgies en mme
temps que leur cause, dterminent son extrme varit. On la
compare la forteresse des gandharva. Si elle ne se manifestait dans
le firmament de la Conscience - rceptacle de ralternative dua-
lisme et non-dualisme - en quel autre lieu brillerait-elle et quel
serait (son) ultime refuge: elle dont l'essence est multiplicit ?
Cc flot (d'impre:;sions), vraiment irrel pendant le rve, dans
l'tat de sommeil profond ne se manifeste pas; comment le saisirait-
on dans le firmament de la Conscience sans limite et par-del ces
(tats)
3
?
Si tu dis que dans la veille mme, rensemble des objets telle la
terre existe, l encore, il arrive que grce la Connaissance, si ce
{flot) prend fin, en un instant et en quelque lieu que ce soit, l'en-
semble n'apparat plus scind (de la Conscience), (ainsi) comment.
(dans la veille, la Conscience) pourrait-elle tre brise '?
10. Quelles que soient les apparences manifestes la f:onscicnce,
on les atteint en moi, suprme firmament ; car ces rayons qui sont
en elles (en leur spcificit)i c'est en moi qu'ils brillent indiffrencis
dans la Splendeur ternelle". Et cette Lumire consciente illimite,
autonome, vritable, infinie, sans imperfection, ternelle, spontane,
qui disperse les tnbres faites de deux ennemis irrconciliables
dualisme et non-dualisme, (cette Lumire) c'est moi!
1. Bhuiruumrulni en tanl. que praLi41H.: prpuratoirc; ou plul L une parodir d1
Cl'l te altitude 'l Cf. ici p. 40.
':!. Impressions tomnw ln l1rrP.ur, la surprise, la colt'.I'C. lei p. lf>, 2l.
3. A sa\oir lurya, q11alrimP L:.ll qui lransccnde les trois aulrcs.
4. On pourrait trnd11in n11lrcrncr1l: car les ruvons Lrillenl. en elles d:rns sple11-
dl'ur f>ternl'llc et, ('n moi, :tn k11r) indivision, c'1;st-iJ-ire indilrC'ncis. Kiifo a aussi
le stns ()1 brin d'htrltl', l dJnc insi::.rniflant cl qui ne nulkmc11l sur la Conscicnc1.
- 69-
11. Que le temps suscite les parcelles temporelles en les accumu-
lant1, que le crateur cre avec ardeur, ou que le dieu de l'amour
secoue intensment {le cur humain) selon les prescriptions (de
Siva) dont il dpend, que ce tintamarre du jeu divin ayant pour
seul asile le ciel
2
constitue les phases successives (menant) la
rvlation du Soi, ou qu'il ait le corps, etc., pour asile, n'est-ce pas
dans la grande illusion du changement universel que je les perois ?
12. Hol, quelqu'un ! que je le dvore ; hol quelqu'un_! j.e
le tue sance tenante ; hol, quelqu'un! que je le boive, mm qui sms
ivre d'avoir mch la vigueur de la suprme Conscience!
Siva-le-lion, Dieu charmant, ayant accd la plus grande des
satisfactions en se promenant dans les forts impntrables de son
propre domaine
3
, a fait barrir l'lphant de cette vile difren-
ciation4. Son apparition fulgure pour les tres sagaces (parvenus)
aux cimes de rveil en mme temps qu'elle met en fuite maux
- ces chacals - et qu'elle dissipe la peur inhrente l'existence.
1. L'allitration sur la racine kal- produit un effet poliquc certain mais inlradnisihlc
en franais.
'2. thr et lger, car le poids du corps et la contrainte du soume ont disparu.
3. Le Soi. K. C. Pandey n choisi la variante sudhiima, de son beau domaine.
4. D'aprs le swami il faudrait comprendre: !iiva a mis en
barrissant de cette vile diffrenciation, sens auquel on s'attend ici. Le swrimi
en mmoire une autre version probablement perdue cl qu'il ne m'a pas soumist'.
Celte dernire strophe n'est sans doute pas de la main d'Abhinavagupta et semble
tardive. Nulle traduction n'est vraiment satisfaisante.
- 70 -
COMMENTAIRE
Ce chant au rythme saccad, haletant, parat premire lecture
manquer de cohrence.
Abhinavagupta cherche dsaronner l'interlocuteur en l'atta-
quant sur tous les fronts la fois
1
d'o les brusques changements
de perspeotive qui exigent quelques explications. Il pose, sous une
forme condense, le problme essentiel de la continuit de la
Conscience et de la ralit laquelle peut prtendre le flot d'impres-
sions discontinues constituant pour chacun de nous l'univers. II
traite d'un thme analogue dans sa glose la Pratyabhijnakarika
1
d'Utpaladeva : Le Seigneur manifeste un monde diversifi mais
dont la ralit consiste en lumire consciente ( prakiifo); le monde
ayant le Soi pour essence est rel par nature (salyar.pa); son
ultime ralit rside dans son identit la Conscience, identit qui
demeure infrangible. })
Essayons de dgager les articulations de l'hymne ; et d:abord
raxiome fondamental du systme Pratyahhiji : l'identit de la
conscience et de l'existence ; existe seul ce qui se manifeste la
conscience, le reste n'est pas. Tout, jusqu' nos reprsentations
inrnginaircs comme la corne de livre et la fleur atmosphrique, se
ramne une impression vivante, une vibration consciente et, en
tant que telle, existc
2
Ainsi la Conscience indiffrencie (nirvilwl-
pa) - existence absolue - claire ce qui se manifeste en clic sous
la forme de remous rels et irrels
3
, savoir les notions dualisantes
(vikalpa) composant le monde objectif et son agitation, ou sa!f1S<ra
qualifi de jaf/,a. Ce terme signifie conscience mousse et fragmente
parce que le voile qui la recouvre ne laisse passer que de ples
reflets de la Lumire divine. Sont considrs comme ja<J.a-i ln
conscience de l'tat de veille aussi bien que l'insensibilit d
sommeil profond. Mais ces aspects d'une conscience imparfaite ne
subsistent qu' l'intrieur de la Conscience ultime et indiffrencie.
On compare donc cette Conscience au firmament vide qui contient
nanmoins une multiplicit infinie de choses sans tre marqu par
elles. Le Vide a pour nergie vyomavamcfom, ' souveraine du
firmament', au niveau de la suprme et indivise ( paravk),
1. II.IV.20 vol. Il, p.
2. cr . p. 117 sqq.
3. Autre expression de la lumire cnveloppanl U1brcs cl clarts. Ici p. '2.
4. Cf. Bodhapai\cadasik, sl. I.
-71
source du signifiant et du signifi. Lorsque cette nergie descend
dans la sphre de la pense et de l'ego que caractrise la parole
forme de bavardage1, allant de notion en notion, de mot en
mot, la vibrante nergie devenue gocar2 se mesure qu'elle
se diffrenic et se sclrose. Si ces nergies de la parole ( gocar)
toujours dissimuler l'essence vritable, c'est en
rnison du bavardage ininterrompu, car le tlot des notions ne
pns en l'absence des mots auxquels i,Lse trouve nces-
sairement


Pour vibrer au contact du spandaoi, la conseicncc ralentie (cilla)
doit recOU\Ter son dynamisrne
1
rester l'coute, rceptive, et
cP.Ltc fin il lui fau L se vider et se librer des connaissanccs-cn-
rclation et. du discours intrieur ou extrieur qui, sans rpit, les
<1ec:ompag1w. Alors souple, vivc
1
alerte, au diapason du seul prsent!
.=-;ans choix ni alternative - et donc dans la paix - la conscience
pourra ipondrc instantanment la grce qui est pure gratu.it.
Le spanda sera peru en son unit originelle et non dans le multiple
comme il l'est l'ordinnirc sous l'influence des notions (uikalpa).
Ainsi, ]P, tumulte des ides et des sons s'tend le calme
parfait pour qui accepte l'apaisement radicnl du Vide; d'o le
conseil de retrancher les vains propos qui s'obstinent meubler
ce vide.
. Les phruscs supprimes, toujours vigilant l'gard du
llux insl;ablc, la vibration saisie l'intrieur de la plnitude, on
apprhendera la Conscience comme le domaine immense et vide
qui fait tout resplendir parce que indiffrenci. Ce domninc !1
1
?frc
,.n cfTet aucune prise ni une signification quelconque, m .a un
1. S1u11jfllpt.
:l. Gr111 au sens Lk Spnnduniri.iaya 20. .
3. Id., 't qui reproduit la U1r:'sc du grammniricn Rarlrhari. Ceci l'.voqllG r1_uoli-
di111nel innulhL11Liquc I'lrc en ehute qui s'3b:lndonne

ct.alce. et
publique <lu ' on', dcrite par M. Heidegger pour 11ui Je 'll dit' d1' la
q11otidiennc St' confond anc la non-vrit et coupe k contact avec le recl, l>risanl
toute relai ion 1ntrc cc qui esl dil el la chose dont on p:.Hk. On ne ch11clte pns l;rnl
comprendre la chose rprn cc l'on dil au sujet de la chose. Le mol tlt:\"eHl la
Pt>rdunL co11Lnct .lV<'C l'lre, l'homme se hornc assimiler des f.1t l 1' sc1ssLon
inil ialc la et de son objet constit11c le uavn1ctngc
LPs rav::iges du discuu1s s'tcnent. Loule fa vie, dans la lolnlil Lie ses manilL'slaLlons.
l.;i c111iosiLL: - 1tvi111.!llc rien ni:sl cach __ Je ftlil sa11lc1 d'lllll'
cl'o l'quivoque qui, avec le l>tl\:uoage et la cul'iosil, conslit11ent l\!Lrn Lll\chn de
lui-mmt', ttlLit'.rcmcnl absurli pnr le on'. Mar/in el le temps,
traduction H. Boehm et A. th.' Gallim:ird, 1\)6-1, pp. sm le' on',
p. sur le uava1dage dissimulateur; p. :2.t sur la curiosil6 cl 8011 agil..!lion
p. sur l'quivuqttl' (cf. molia) qui s'ensuit. Souci 1.!L proccup:it ion
juu1nl Ull rl8 fonamcnlal pour rp. '22.Z-23-1) et pour
-1. Acte primordial qui est ,il.JraLion de haut1! Ici p. l3, '.l;L
-72-
objet signifi ; car tant qu'il y a prise il ne peut y avoir de \ritable
vide. Le seul Sens vritable par-del les particularits rPlP.v<' donc
du domaine infini de Siva jamais apais (strophe 1 ).
Le couple existence-inexistence ne concerne que l'objet ;
existe vraiment le sujet qui les peroit, savoir la Conscience (st. 2).
A celui qui croit en l'existence des choses indpendamment de ln
conscience qu'on en a et qui s'efforce de mettre un terme leur
difirenciation, Abhinavagupta objecte que cette difTrenciation ne
se montre que dans la conscience indiffrencie et par elle. En cc:-;
conditions s,obstiner ' briser la brisure ', n'est-ce pas cor-tinuer
engendrer le diflrenci en y ajoutant une brisure de plus "? L'essP.n-
tiel consiste reconnatre l,cla.t indivis de la Conscience P.t.f'rncllP-
ment sous-jacente et que rien n'affecte ; en consquPncP-, trn
conscient du difirenci
1
, c'est tre quand mme conscient.
l'prouve-t-on pas dans le rve ? il suffit d'avoir conscience de rver
et l'on ne souffre plus des vnements du qui apparissnt. pour
ce qu'ils sont, un jeu de l'imagination du rveur (strophe :3).
Quand on examine les tats objectifs relevant de la conn:.1
et de l'activit ordinaires, on se rend compte qu'il n'y a l
que jacJ,a, ignorance et manque de lucidit; faisant
abstraction de la connaissance et de ractiYit, on ;:,ipprofondit
l'ignorance, on s'aperoit qu'elle relve du domaine de Siva puis-
qu'elle fait vibrer la conscience. Si l'on s'enfonce davanta-c d
par-del l'ignorance, on parvienne au sujet <.'onsriP.nt de ln
lumire, on se saisit soi-mme comme le Soi. Qmmd <'n fin on
considre l'ignorance, elle aussi, comme identique au on ritteint.
la ralit du Soi cosmique, et c'est l l'illumination, hl gloire, la
libert (4-5). Ainsi l'adepte du Trika ne repousse jamais noms d,
formes la manire d'un Sail ka ra, il les en lu i-mmc.
Abhinavngupta prcise ce sujet : On g'assure OP. la
partout vidente de I1tre conscient (cela na) du fait que le conscient
identifie soi les choses inconscientes (il les par la
qu'il en a) ; l'inconscient par contre n'H pas ln capacit de mani-
fester autre chose.
Si l'on est spontanment illumin, quoi bon procds et atti-
tudes mystiques? Le yogin lors de l'attitude dite de Siva pose son
regard sur le monde extrieur sans but dfinii sans s'intresser au
visible, ceci implique pourtant un reste d'opposition entre interne et
externe
3
, alors que le ciel de la Conscience n'a que foire de la dualit.
l. Jarja, partiellement inconscient en lanl f{Ue privt' de ln parfoilc cnnsciPncc de soi.
2. J.P.v. JJ.IV.9 vol. If, p. 150, !. 4.
3. Ou deux contraires (dvandCJa). Sur ln bhairrwamwlrc, cf. An11bhavnni,cdnna,
ici p. 38-42, 46
- 73-
Plutt que d'ouvrir les yeux avec timidit sans oser franchement
regarder, mieux vaut scruter sa propre raction durant les mouve-
ments instinctifs de la conscience
1
, explosions de colre, de terreur,
de dsir, en vue de constater si, mme l, du dbut la fin du
paroxysme motif, la prise de conscience de soi demeure ininterrom-
pue sans subir aucune variation, car selon Bartrhari est rel ce
qui existe au commencement, la fin et au milieu, et ce qui ne se
manifeste pas ainsi (mais seulement un moment donn) n'a certes
d'existence relle que dans cette mesure mme z.
Abhinavagupta exprime ailleurs
3
une ide analogue : <i Il faut
de toutes les manires possibles prouver par le cur Isvara comme
ragent ; si je me reconnais identique Lui, d'agent limit je rede-
viens ce que je suis essentiellement: Agent universel.>) En tombant,
les objets entranent dans leur chute leurs limitations et seul le
sujet illimit demeure
4
(6-7). Alors, se demandc-t-on, d>o vient la
confusion si elle ne se rattache pas directement aux motions?
Elle prend corps, rpond Abhinavagupta, par la faute des proccu-
pations et conjectures qui portent sur la douleur. Sa trs grande
Yarit dpend des nombreuses entraves que provoquent les
erreurs, elles-mmes causes par l'illusion. Mais celle-ci n'a
plus de consistance qu'une forteresse de musiciens clestes surgis
Jes nuages. Sous son apparence multiple et diffrencie, elle a pour
rceptacle la conscience et se confond avec elle (8). .
Abhinavagupta montre ensuiLe que les tats de veille, sommeil
et extase ne peuvent briser la continuit de ln Conscience : le flo_t
des impressions ordinaires ne se manifeste pas dans le sommeil
profond ; reconnu comme irrel dans le rve, on ne l'apprhende
pas dans le quatrime tat (iurya), ce firmRment vide de. la
Conscience par-del veille et sommeil. Pourtnnt, durant la ve.ille,
la Conscience n'est-elle pas soumise de constantes
et fragmente par des choses relles doues d'une
propre ? A celte objection Abhinava rpond que, l encore, 1.l
que la Connaissance jaillisse pour que le flot prenne. fin et, a. l ins-
tant mme, plus rien n'apparat spar de la Conscience. est
donc le monde pris dans sa substance-Bhairava ; mensongre, par
contre, la vision de la dunlit qu'on lui
comme spar du Tout (Bhaimva ou de S01) et exterieur a lm (9).
1. MmP conseil donn nu si. '.W d
11
l'i. a11 t) e L\nulla

2. A ce momenl-ltL Yaddarz ca yadanle ca yanmadhye tasya satyatii 1
na yadabhsate tasya safyatuaq1 tvad eva hi l I Spandanirt.1aya, sl. 5, p. 18.
3. I.P.v. Il.IV. si. 9 vol. li, p. 149. fin.
-1. I.P.v. Il.IV. si. <J, vol. JJ, p. 149.
6
-74.-
Dans son Vivaral)a
1
Abhinavagupta <.lclure cc sujet: L'inexis-
tence ne peut devenir quelque chose. Ainsi l'univers existe relle-
ment en tant qu'nergie divine, la fois une en sa libert et multiple
en la yarit infinie de son jeu. Bien qu'unique, le monde apparat
rlifrenci dans le miroir du Soi dont il ne peut tre scind :
<i L'homme libr saisit les choses comme ses propres constituants,
son propre corps. Parce qu'il leur transmet la Ralit -- son
essence - les Traits Le nomment berger et souverain (pali). Mais
s'il les voit spares de lui, telles que l'nergie d'illusion les diff-
rencie, alors, li par elles, il fait partie du troupeau asservi (pafo/
2

Tout prend place dans le Je et l seulement. Sans ces explications,
on ne comprendrait pas l'obscur verset 10, en apparence contra-
dictoire, puisque les choses se manifestent indivisibles et inspa-
rables de la Conscience et pourtant avec leurs caractres spci-
fiques, la montagne sous forme de montagne, l'<.1rbre sous forme
d'arbre, comme des reflets se dploynnt dans l'orbe du miroir
3

cs choses, mme perues distinct.es et changcrlntes, c'est dans
l'Hlomognit (samalii} qu'elles se montrent ainsi\ savoir
l'galit d?unc eonscience et pure pnrcc que sousLraitc
tous les contrastes.
Le Je ralis en sa <li,init comme la lu mirc conscicnlc dnue
du factice, infinie et libre, disperse par sa splendeur l'obscurit des
spculat.ion::; centres autour de la dualit et de la non-dualit, ces
deux opposs tant ainsi exclus de la Vic par Abhinavagupta.
Dans ces conditions, qu'importent les trois facteurs prpon<l.:.
rants du monde : Brahman, le dieu crateur, Kama, le dieu de
l'amour ch3rncl et mahtkiila, le temps qui sans rpit amasse ses
atomes en ajoutant instant instant. Que le je divin dont dpen-
dent le temps, Brahman ou Kama consiste en une progression vers
des tats mystiques suprieurs ou se rapporte au domaine infrieur
du corps, il n'y a l qu'musion de Ghangement (si. 3). Plus encore,
du point de vue ultime et par-del l'veil, raliser la Ralit est
une illusion, ne pas la raliser en est une autre (sl. 11 ).
S'inspirant du drame, Abhinavagupta change tout coup de ton
mais non de thme : mon corps ayant mastiqu lui aussi la nourri-
ture substantielle et puissante du Soi - la Conscience -, ivre de
son unicit, ne voyant en tout et partout que moi-mme, me voici
devenu le thtre o, unique nctcur, je me joue la comdie : quel
autre que moi puis-je en effet dvorer, quel autre qnc moi puis-je
1. P.Ts. sl. '24-25, p. 258. Et ici p. 70, cilaLion c l'i.Px. vol. li, p. 181.
'2. I.P.v. III.11.3, vol. JI, p. 220.
3. A cc sujel, cf. ici p. 8 cl p. 3;J .
.i. cr. P.Tx., p. 18, 41 a H.
- 75-
nssuillir et quel autre puis-je boire ? Ainsi suis-je le dvo-
rant et le dvor, le meurtrier et la victime
1
Ceci rappelle l'atti-
tude de ohairava
2
: tout ce qui surgit soudain sur le thtre de
l'univers identique au Soi, est absorb aussitt par le yogin et,
quoique <lemcur\nt visible, fait sans rpit retour l'indiffrenci.
Et AbhinaYagupta conclut : que le jour se lve et aussitt les
sombres angoisses de la nuit se diss.ipent comrrie les chacals
s'enfuient au rugissement du lion, Siva, errant dans les profonds
fourrs
3
son propre Soi. L'lplrnnt qui barrit de terreur sym-
bolil'e un monde lourd et bruyant.
l. 111l s"ngit ici <J'ncles ronamentaux tels la rnort, l'assouvissement de lu
f:iim l'i d1 1: 1 sc1ir_. non plus d'ides l'l de sentences creuses rdativcs au HPl. Cf. ici
p. 6.
Cf. l'l la blwiravimudr, ici p. 41, 46.
3. lm1il11il lgnor:rnl '!
-76-
MAHOPADESA TIKA
1. prapancottrl)arpaya namas te visvamrtaye 1
sadanandaprakasaya svtmane 'nantasaktaye l I 1
2. tvarp tvarp evaham evahaip. tvam evas1 na csmy aham 1
aharri tvam ity ubhau na sto yatra tasmai namo namaQ. Il 2
3. antardehe maya nityarp tvam atm ca J
na dr!?tas tvarp. na caivatma yac ca drtarp. tvam eva tat Il 3
4. bhavadbhaktasya sarpjatabhavadrpasya me 'dhun J
tvam tmaruparp. tubhyarp mahya1p. namonama}:l 11
5. ctadvacananaipu.Q.ya111 yatkartavyeti mlaya 1
bhavanmaytmanas tasya kena kasmin kuto layai) 11 5
6. aharp. tvaip lvarp. aharp ceti bhinnata nvayolf kvacit 1
samadhigrahar.iecchaya bhedasyavasthitir hy asau 11 6
7. tvam ahaf!1 so'yam ity adi nnai tani sada tvayi J
na labhante cavakasar vacanani kuto jagat li 7
8. alarp. bhednukathaya 1
sarvam ekam idam santam iti vakturp ca lajjate Il 8
9. lvatsvarpe jrmbhamai:ie tvarp caharp. cakhilarp jagat 1
jte tasya tirodhane na tvarp nham na vai jagat li 9
10. dharayarps ca nijal) kalal) l
svecchay bhasi na tavan 'si ca tattvatal) 11 10
11. tvatprabodhat prabodho 'sya tvannidrato 'sya yat 1
atas tvadatmakarp. sarvarp visvarp sadasadatmakam JI 11
12. jihva sranta bhavan narnni manaQ srantar11 bhavatsmrtau 1
arpasya kuto dhyanarp nirgm:iasya ca nama kim ll 12
13. prQasyavahanarp kutra sarvadharasya casanam 1
svacchasya padyam arghyaii. ca suddhasyacamanarp kutal) Il 13
- 77-
14. nirmalasya kutal). snanaip vastrarp visvodarasya ca 1
nirlepasya kulo gandho ramyasyabharal}arp. kutal). 1114
15. nirlambasyopavitarri nirvij.sanasya ca 1
apral)asya kuto dhpas hinasya dipakal) IJ 15
16. nityatrptasya naivedyarp. tamblal!l ca kuto vibhol_i 1
anantasya 'dvitiyasya kuto natil). 1116
17. svaya111 prakasamanasya kuto nirajanarp. vibho{l J
vedavacam avedyasya kutal) stotrarp vidhyate 1117
18. antarbahis ca prl)asya katham udvasanarp bhavet 1
bhedahnasya visvatra katharp. ca havanaJ!l bhavet 11 18
19. dak!?il)a kutra nityatrptasya tarpaQam 1
visarjana111 1119
20. evameva para puja sarvavasthasu sarvada l
aikyabuddhya tu sarvese mano deve niyojayet li 20
- 78-
LA VINGTAINE RELATIVE AU GRAND
1. Hommage Toi, mon propre Soi aux nergies infinies, lumire
consciente et flicit ternelles; (hommage Toi) sous ta forme
concrte d'univers dont l'essence transcende le dploiement des
phnomnes.
2. En qui
1
Tu es Toi, et moi je suis moi, en qui Toi seul es et moi
je ne suis pas, et en qui il n'y a ni Toi ili moi, Celui-l je rends
hommage l
3. Toujours j'ai ardemment cherch et Toi et Soi
2
fintrieur
du corps. Lorsque ni Toi ni Soi n'y _sommes perus, Toi seules peru.
4. T'ayant contempl sous la forme de Soi, maintenant que je
suis devenu identique Toi, de moi, Ton adorateur: va le salut
Toi, moi.
5. : ' il faut faire ceci ' n'est que tournure de style, car pour
qui est identique Toi, d'o viendrait l'absorption! en qui et de
quelle manire (serait-elle possible)
3
?
6. Dire : ' je suis Toi et Tu es moi', jamais, nulle part
4
n'existe
une telle distinction entre nous deux. Un semblable tat de diff-
renciation trahit en vrit le dsir de s'emparer du samiidhi
5

7. Dire:' Toi, moi, c'est lui, etc.', ces expressions certes toujours
en Toi ne trouvent jamais place en Toi
6
; plus forte raison un
univers (distinct de Toi).
8. Ds qu'on a got la saveur de Ton Amour, plus besoin
d discourir au sujet du diffrenci. On devrait rivoir honte
de dire : ce tout est un et apais.
1. Textuellement yatra, l o, ce qui le dhfiman rceptacle neutre de rnJJ-
solu indifTrenci. cr. ici p. 6 et p. 3'2.
2. Dirn ' le' Soi pour traduire alman c'est l'objccli\er, le projeter hors de soi.
3. Celte strophe est corrompue, la construction grammaticale, impossiblr,. ,\l lay,
' par principe ' ou : si l'on approfondit ccLte expression ' il faut faire ceci ', s'absorber
en Sivai en allant jusqu' sa racine ? Nous lisons aussi bhavanmayalnwnr1.-; et non mriyd ...
4. Selon les deux sens de na . lwacil.
o. Extase oll fond loute dualil.
6. En tant qu'exislcnce spare. Cf. P.T.v. o Les limitations de forml', de causalit,
de temps el d'espace, ceci, ainsi, ici, mriinlenrmt, clc., ne peuvent exister t!TI cc suprme
anullara. p. 5. Voir ici p. G.
- 79-
9. A l'panouissement de Ton essence (surgissent) Toi, moi et
l'univers entier. A son retrait\ il n'y a plus ni Toi, ni moi, ni univers.
10. Tu te rvles Ton gr comme un acteur assumant les rles
2
qui \ui sont propres : veille, rve, sommeil profond, etc. ; mais en
ralit Tu ne joues aucun rle
2

11. L'uqivers s'veille quand Tu T'\eilles et il s couche quand
Tu T'assoupis. Ainsi donc ce tout, existant et inexistant, est iden-
tique Toi3..
12. La langue s'puise (en vain) rciter Ton nom ; la pense
s
1
puise T'voquer. Comment donc contempler le sans-forme et
comment nommer le sans-attribut ?
13. A quoi bon l'invitation rituelle' pour le Parfait et un pidestal
pour le support universel ? Pourquoi eau lustrale et ablution pour
le limpide et rinage de bouche
5
pour le trs pur ?
14. A quoi bon le bain rituel pour rimmacul, un vtement pour
qui renferme l'univers en son corps !
6
A quoi bon l'huile odorante
pour qui ne peut tre oint et une parure pour le Charmant l
15. A quoi bon un cordon sacr pour qui ne dpend de

>
une fleur pour qui n'a nul besoin de parfum, l'encens pour qm n a
ptis de souffie
8
, une lampe pour qui n'a pas d'yeux?
16. A quoi bon une offrande de nourriture pour !'ternellement
rassasi ou le btel pour !'Omniprsent ? A quoi bon faire le tour'
de l' In fini et saluer le Sans-Second ?
17. A quoi bon l'offrande de lumires !'Omniprsent qui res-
plendit de son propre clat ? A quoi bon, pour l'Inconnaissable,
composer un hymne de louange fait des paroles du Veda ?
1. Tirodhna, se dissimuler, se cachrr et disparatre.
2. fonction subtile s'oppose ni#wla, indivis, sans partie, n'ayant.
aucune fonction. Comme la fonction d'un acteur, dans la perspective de son acti't'tl(',
e'C'sl un rle, je lradt!is ici kalti par rle.
3. Cr. pour le sens la I.
4. On reprend ici le thme du rite et. de ses diverses pnrties.
5. Acamana, rite prlimimiire, obligalnirc : on hoit pur rois de l'eau d:ins Il'
creux de la main en rcitnnl des formules. cr. H, Brunmr-Lachaux, p. 8, 4'l sqq.
Voir note 'Z p. 84.
fi. Il ne peut tre envelopp d'un vlement, lui qui c?nlicnl tout en son 'giron'.
7. On porte le cordon sacr en guise de protection et Sivn n'f'n a <tHC fnire, il n'r:st
rien, lui le protecteur qui chnppe toute protection.
8. L'encens n pour but de purifier le soutlle.
'd. Rite de la circumnmbulalion.
-80-
18. Comment y aurait-il fintrieur et l'extrieur libration
1
pour le Parfait 'l Et comment ferait-on une oblation pour qui
rside partout indiffrenci ?
19. D'o viendrait un salaire sacrificiel pour qui possde tout,
une libation pour satisfaire l'ternellement satisfait
1
ou le cong
2
pour l'Omnipntrant, le rite expiatoire pour l' Imperceptible ?
20. D'une pense bien unifie, qu'on fixe l'esprit sur Dieu,
mattre universel. De cette manire seulement (s'accomplit) en tous
temps et en toutes circonstances la suprme adoration.
1. Udvsana, on libre le dieu rest prsent. dans son support, stat.uette ou image,
durnnt la crmonie. Expulsion.
2. Visarjana, rite final de renvoi.
- 81-
COMMENTAIRE
Abhinavagupta se situe au vif de l'anupaya, par del toute voie,
en Paramasiva, pour transmettre son plus haut message : ds que
l'on a reconnu son identit Siva, il n'y a plus rien faire, pas
mme s'absorber en lui.
1. Siva est le Soi de l'homme et de l'univers, la fois immanent
au dploiement phnomnal et le transcendant.
2. Abhinavagupta examine toutes les relations possibles entre
et l'homme du point de vue de la philosophie et de la ?votion
rehg1euse
1
: la dualit du Toi et du moi que peroivent
ou encore le dvot la recherche de Dieu ; la non-dualit ou umc1te
: Siva seul et je suis,moi.)perdu en lui
2
; leur
dualisme et momsme tant renvoys dos dos en tant qu idees
l'gard du Rel ; enfin leur double acceptation, car si ce:
pomts de vue sur la Ralit sont errons quand on s'attache a
l'un d'eux, ils ont place en l'indicible Tout qui les contient simulta-
nment, Paramasiva n'excluant rien. En lui le Toi et le moi existent
en lui le Toi rgne souverainement, en lui encore il a
m Toi DI moi. En consquence, pour le partisan du Trika, adora.t10n
et hommage peuvent s'intgrer de faon naturelle la vie myst1.que
sous forme de jeux d'amour entre le Toi et le moi mais l'intrieur
de l'absolu.
Ces divers aspects vont traverser vertigineusement le
d' Abhinavagupta au cours des stances suivantes, tantt ?ccueilhs,
tantt repousss selon les subtilits de l'exprience mystique.
l. Les mysliques de Lous temps et de tous lieux se rejoignent dans l'exprience
mais selon le moment ils mettent l'accent sur la sparation d'avec Dieu et la subissent
comme une douleur, ou font d'elle le tremplin d'un immense lan d'amour. Ils
d'autres moments sur la transcendance divine, d'autres sur l'inexprimable mrus1on
d'amour par-del tout aspect i mais toujours, ils le savent, soient
d'nrnour et les cris de la cette Vie se dploie dans la d1v1mt, car Dieu, me
cl univers rsident en Paramasiv; d'une indicible manire. L'illuslralion de l'image
vue dans le miroir pourrait. mettre les mystiques d'accord : le monde el sa multiplicit
existent; en un sens ils sont rels puisf1UC perus comme tels; mais ils n'existent pas
comme spars de Dieu et extrieurs lui, Dieu tant le miroir dans lc11uel ils se
dploient. O donc le mystique percevrait-il et l'univers et lui-mme si ce n'csl en
Dieu? A ce sujet, cr. ici p. 3'2-36.
2. Cf. Al-l:lallj, Diwan, p. 31 de la trad. L. Massignon, Qasida IX: l. Je m'tonne,
el de Toi et de moi, vu de mon dsir! 2. Tu m'avais rapproch de Toi, au point que
j'ai cru que ton c'est Moi tait le mien. 3. Puis Tu t'es clips dans l'extase, tant
qll't>n Toi tu m'as dispens de moi-mme ...
- 82
3. Puis Abhinavagupta semble revenir son t>xprience <Ht
moment de la qute ardente du Toi et Soi encore et qui
s'achve par leur fusion totale. Alors les ides errones du toi et du
:w..oi qu,il les font place, en s'effaant, une seule
Siva, Toi.
4. Dcouverte du Soi intrieur puis identit Siva, voici les
deux tapes de la voie; dit on reconnat d'abortj Sivn
comme le Soi, puis comme l'univers entier en tous
Le mystique commence par se dsintresser du monde des phno-
mnes afin de mieux savourer la batitude intime de ; plus
tard, l'absorption devep.ue constante, il vit en
Siva, servitude et douleurs lui apparaissant dsormais comme un
jeu divin. Cette identification, qui correspond d'galisa-
tiont O le Soi est peru dans runivers et l'univers dans le Soi, tant
de mystique, chappe la logique et ses mode8 d'expres-
sion : le pur sujet excelle saluer Siva et se saluer lui-mme en
manire de jeu ; jeu spontan l'intrieur de fidentit. Ainsi le
suprme Amour ne se trouve pas exclu ; ineffable changP entre
l'rpe et Dieu o les notions diffrencies (vilcalpa) subsistPnt dans
l'indiffrenci (nirvikalpa) et l'indiffrenci dans le
Abhinavagupta s'attaque ensuite aux ides fallacieuses que
font les mystiques non encore parvenus CP-tte ' ' :
5. A ceux qui prcoqisent une tche accomplir, il riposte que
du point de vue ultime (anupaya), la plus haute tche:-;,
l'absorption mme, perd tout sens puisqu'il n'y a plus en
qui s'absorber.
6. Comment po'4rrait-on, d'autre part, nflirmer ' je Toi ou
Tu es moi ' ? Toute prise de conscience de l'identit fait dchoir
d'un degr, savoir, de la suprme bhairavmudr la kramamudra
2
qui pose encore une distinction entre le Toi et le moi a fin de les
identifier. Une telle prise de conscience revient 'saisir' le snmiidhi
(extase), et ne peut avoir lieu au sein de la parfaite
7. Le verset suivant dveloppe ce thme en se plaant. deux
niveaux : d'abord celui de nos ides exprimes par' moi. toi, cela ' :
puis celui de l'univers tel que nous le percevons. Bien qu'ayant
pour assises Paramasiva et lui seul, ni nos ides ni le monde
rsident en lui comme un contenu en un contenant : rxistenccs
spares qui pourraient tre dtaches de lui, mais plutt: nous
l. Kramamudr, cf. ici p. 40-4'2 . .M.:\I., p. 50, 57 sqq., 137, 158, 171
Voir ce sujet l'Anubhavanivedann, ln fin de mon comrnentairr o ic nt'
rais qu'cfficurer la question, mai:i peut-on faire pins 1 On se dcmn111lt s'il S\l!!I. d'urH'
exprience aussi leve ou plus simplement du moment oi1 l'on essaie comprndn
et d'exprimer cc que l'on vient d'prouver d'indicible. faisant ainsi une distinction
entre soi-mme et Siva.
- 83-
l'avons vu, comme des images dans un m1r01r n'ayant d'autre
existence qu'en lui.
8. Lorsque fusionnent en un suprme Amour, Siva, le Soi et
le monde
1
et que le diffrenci s'vanouit. mettre en parole cette
exprience mystique en affirmant l'unicitk du monde et sa paix
totale, n'est-ce pas ici encore le projeter hors du Soi
2
Honte donc
qui parle ainsi. L'Un est plong de telle sorte dans l'Unit que
l'Un mme n'est plus ; et l'Unit ne peut tre extraite des choses.
A la fin Paramasiya seul demeure.
9. Et voici maintenant la rvlation concernant Siva, le moi et
l'univers : leur apparition et constituent la mare de
Paramasiva, ocan sans limite ; en avanant, il dploie Toi, moi
et univers ; en se retirant, il les rsorbe et les cache en lui-mme.
Ce rythme ternel forme la pulsation de la vie divine.
10. Ou selon une autre image, Siva peut son gr assumer des
fonctions varies de veille, sommeil, etc.; dployant toutes ses
nergies, il danse glorieusement et resplendit sur le thtre de
l'univers dont il est I1unique acteurs ; mais s'il revt tous les. r.le.s
la fois, il ne s'identifie aucun en particulier parce que ind1v1s, 11
est sans fonction spcifique.
11. Le monde a donc Siva pour essence et dpend de lui pou: se
manifester et se rsorber, selon le rythme de l'astre divin qui se
lve et se couche l'horizon.
12. Dans ces conditions, comment pourrait-on rendre extrieure-
ment hommage au Seigneur ? Abhinavagupta prend un un les
lments du rituel et montre, non sans ironie, la d'un culte
externe qui rduit la divinit adore l'tat d'objet' .. 81 la conte.m-
plation en esprit de Siva, la rcitation du nom divi11:,.
par la pense ne concernent en rien l':Btre indifTrenc1e, mfim, sans
attribut, plus forte raison les pratiques crmoniales
5
!
13-19. L'adorateur commence par vnrer le trne in:oque
prsence du dieu invit ainsi s'asseoir en ce lieu particulier. Il lm
offre l'eau lustrale (arghya) comme un hte respe,ct; cette eau
prpare selon des rites en rcitant des formules et a laquelle on a
ajout du ssame, du riz et d'autres ingrdients, rpandue sur la
tte de l'idole, servira en plusieurs occasions ; offrande galement
1. Lol..-a a souvent le sens d'humain, l'ensemble des hommes.
2. On peut aussi interprter diffremment cette strophe : le monde perd tout
charme compar l'amour pour Siva ; mme purifi et apais, il n'a plus aucune
saveur lorsque surgit la suprme bhakti.
3. Svastra 11 r, 9 sqq.
4. Ici p. 60.
5. T.A. 11.25 : Du point de vue ullirne, Abhinava dcclare : i Sans adorateur, pas
d'ador, et sans ador, pas d'adorateur.
-84-
d'eau sur ses pieds (pdya) et dans sa bouche (camana). Puis
l'adorateur baigne le Dieu, l'oint d'huile parfume, de produits
varis, poudres de santal, safran, musc, etc. ; il revt la statue de
Siva de vtements, de fleurs odorantes, d'ornements : ceinture,
cordon sacr, boucles d'oreilles; il l'encense en brlant des parfums
devant son nez. Ensuite, tenant deux mains une lampe de mtal,
il dcrit trois cercles la hauteur de la tte, du cur et des pieds
de l'idole. Aprs le repas consistant en offrandes de riz, condi-
ments, fruits, etc., il lui donne des feuilles de btel en vue de
parfumer sa bouche. Il tourne alors plusieurs fois lentement autour
de la statue partir de la droite et effectue la grande prosternation
des huit membres. La purification qui succde se fait avec des
lampes de formes varies, agites sous les yeux de l'idole ; aprs
les chants de louange en son honneur, la crmonie s'achve sur les
rites de conclusion ou de libration
1
Puis on verse l'oblation dans
le feu sacrificiel et on distribue aux clbrants les honoraires rituels.
Le fidle procde alors au rite appel larpal)a, laissant tomber de
ses doigts des libations d'eau consacre afin de ' satisfaire ' totale-
ment le dieu invoqu. Enfin, il donne cong Siva en vue de le
renvoyer et lui demande pardon de l'avoir importun si longtemps
2

A quoi bon toutes ces pratiques
1
demande Abhinavagupta
3
, la
seule adoration digne de ce nom consiste fixer l'esprit sur le souve-
rain de l'univers, sentir partout sa prsence, au cur de tout tre
et mme de toute chose.
Deux passages d' Abhinavagupta clairent cette dernire stance :
Il n'y a d'utile que l'absence de doute, car le doute en tant qu'incer-
titude fait obstacle l'absorption qui est prise de conscience et
unit d'esprit. 4
La plnitude de l'adoration, disait-il encore, a lieu dans l'tat
de parfaite conscience o l'on adore partout cette nergie (kali) et
o se produit la vibration intrieure spontane ( dhvani) qui meut
l'univers entier, le Cur suprme. s
1. Udosana, on immerge souvent les images des divinits dans l'eau sacre d'un
fleuve ou d'un tang pour qu'elles s'y dissolvent.
2. Je m'inspire des claires descriptions de crmonies sivaites donnes par Hlne
Brunner-Lachaux dans les deux volumes de sa traduction du Somasambhupaddhali .
Institut franais d'lndologie, n 25, 1963, 1968. cr. Introduction p. XXVI-XXX et
notes qui abondent tout au long des deux ouvrages concernant le rituel dans la tra-
dition sivaite de l'Inde du Sud.
3. Al-l:lallaj disait de mme : reni le culte d Dieu, et ce reniement m'tait
un devoir, alors qu'il est pour les musulmans un pch. Et encore : c J'ai laiss aux
autres leur ici-bas et leurs dvotions pour ne m'adonner qu' Toi, ma dvotion et.
mon ici-bas, op. cit., p. 107 et p. 39, verset 4.
4. Na tv aira vidyavratdi kirricit sahakribhvenopayogi keualaT]l
katuam atra upayogi fonkyl) sandehavipralipallisratay elcarasaladuimarsitmaka-
samvdauighna bhiilatuad iti sphufilcriyate J 1 Laghuvrtti p. 14, comm. au sl. 18.
5. T.A. V.180.
-85-
DEHASTHADEVATACAKRASTOTRA
1. asurasuravrndavanditam abhimatavaravitaral)e niratam 1
darsanasatagryapG.jyaf!l pral}.atanurp gal)apatirp vande Il
2. varavrayogingal).asiddhavalipjitanghriyugalam 1
apahrtavinayijanartirr vatukam apanabhidharp. vande Il
3. indriyadevyal) sada hrdambhoje [
abhipjayanti yarp tarp cinmayam anandabhairavarp vande Il
4. yaddhbalena visva:rp bhaktanrri sivapatharri bhati 1
tam aham avadhanarG.parp. sadgurum amalarp sada vande Il
5. udayavabhasacarva:r;iallarp visvasya y karoty anisam 1
nandabhairavr trp vimarsarpam aharp vande li
6. arcayati bhairavarp ya niscayakusumail) suresapatrastha 1
pra(la ma mi buddhirparp brahma.rp. tam ahaJTl satatam 11
7. kurute bhairavapjm analadalastha 'bhimanakusumair ya 1
nitynm aharpkrtirparp vande tarr sambhavm ambam Il
8. vidadhati bhairavarcarp vikalpakusumair ya 1
nityarp mana}:isvarpf!l kaumarirp tam aharri vande Il
9. nairrtadalaaa bhairavam arcayate sabdakusumair ya 1
pral)amam sabdarparp nityarp. tarp 5aktim 11
10. pascimadigdalasarp.stha hrdayaharail). _ ya 1
bhairavarp tarp tvagriipadhararp namarm varah1m 11
11. varatararpavise!?air marutadigdalani!?arHwdeha ya \
pjayati bhairavarp tam indrar:if!l drktanu1p vande Il
12. dhanapntikisalayanilaya ya nityaf!l 1
pujayati bhairavarri tarp jihvabhikhyrp namami camu9<Jam 11
-86-
13. Sadalastha bhairavam arcayate parimalair vicitrair ya 1
pra:.amami sarvada tarp ghral).abhikhyar 11
14. pjyarp. 1
atmabhikhyaip. satatarp. siddhidarp. vande l I
16. sarpsphurad nlibhav'asara'rp sarvantal)" satatasannihitam 1
naumi sadoditam ittharp nijadehagadevatacakram 11
- 87-
A LA LOUANGE DE LA ROUE DES DIVINITS
SITUES DANS LE CORPS .
1. Je rends hommage Gar:zapali
1
qui s'incarne dans le souffie
inspir ; vnr au dbut de centaines de traits, il se plat accdrder
les gre-es dsires, lui que l'on honore pr une multitude de bonnes
et de mauvaises dispositions d'esprit.
Je rei:ids hommage Vafuka
2
appel souille expir qui sup-
prime l'aiTiict.ion de ses dvots et dont les pieds de lotus sont
par la ligne des siddh<f\ l'assemble des yogin et les
n1e1lleurs des hros.
3. Je rends ho ni mage Bhairava-flicit, plein de Conscience,
qui dans le lotus du cur. C'est lui que les divinits des sehs
\nrent perptuellement par l'offrande des jouissances de leurs
propres objets.
4. Je rends hommage sans relche ce pur et
( dont la nature est vigilance puisque, par son
tuel, 1 1m1vrrs entier se rvle aux amants comme le chemin de Siva.
5. J c rends hommage cette Bhaira v-flicit qui, sous forme de
prise de conscience, s'amuse sans rpit susciter, manifester et
engloutir l'univers.
6. Je m 'inelinc encore et encore devant cette Brahmf). dont la
nature est rintelligence. Sise sur le ptale de l'est, elle adore Bhairava
wec IlC'u rs de ia certitude.
7. Je rcntls toujours homniagc cette mre Sainbhav. qui,. sous
la forme du moi, dresse sur le ptale du sud-est, offre a Bha1rava
les fleurs de l'gosme.
8. Je rrnds hommage perptuellement la jeune fille ( K umarl)
dont la nature est pense. Demeurant sur le ptale du sud, elle
offre pour r,ultc les fleurs du doute.
1. Gunda, fils de 'l dt' Panali, carlc les obstacles; on l'invoriuc donc toujo111s
a11 dl>lrnt. de lorilts l<'s <ntl''J>ris
1
:s et en llc des onnllgos religieux.
2. Jeune hral1macrrin, nnll'l' lils de ShiL
:L L1s f ns accornplis <in ,(rila!Jlrs rnystiqurs dmu;s de po11\oirs spirituels et
1y:1 ni ohtcnu 1:1 li!irralion.
-88-
9. Je m'incline perptuellement devant cette nergie Vai$1:zav
qui a pour nature le son. Demeurant sur le ptale du sud-ouest,
elle adore Bhairava avec les fleurs du son.
IO. Je salue cette V iirih qui revt l'apparence de la peau. Se
dressant sur le ptale de l'ouest, elle rjouit Bhairava avec les
fleurs du toucher qui ravissent le cur.
11. Je rends hommage cette lndrar:i, vision incarne ;
allonge sur le ptale du nord-ouest elle vnre Bhairava avec (les
fleurs) aux couleurs les plus belles.
12. Je salue cette Ciimur.:uJ.ii qu'on appelle ' langue ', tendue sur
Je bourgeon du nord, qui toujours rend un culte Bhairava avec
les diffrentes nourritures aux six saveurs.
13. Je m'incline en tout temps devant qu'on appelle
nez, sise sur le ptale nord-est et qui adore Bhairava avec des
parfums varis.
14. Je rends hommage continuellement (l'Esprit), matre du
corps _appel Soi, dispensateur de pouvoirs surnaturels. Honor dans
les six darfona1, il s'allie aux trente-six modalits
2
du rel.
15. Moi qui rside en tout, je chante ainsi la Roue perptuelle-
ment jaillissante des divinits de mon corps; (Roue) Yibrante, suc
de !'Exprience, toujours proche.
l. classiques de la philosophjc indienne.
'2. Les 36 laltl:a ou catgories du Trika.
-89-
COMMENTAIRE
Au centre <le la vivante ternit, l'immense Roue mil!e rayons
dont la circonfrence constitue l'univers et le moyeu, le Cur divin.
Mais ce Cur est aussi le cur de l'homme qui, ayant su concentrer,
canaliser et dominer ses nergies en s'identifiant leur source,
Siva, peroit leur ronde comme celle de pouvoirs divins dont rien
n>est exclu, pas mme les actes les plus blmables.
_La premire stance des Spandastra concerne Bhairava souve-
ram de la Roue cosmique : ((A cc Siva, source du glorieux dploie-
ment de la roue des nergies, Lui qui en ouvrant et en fermant les
yeux fait disparatre et apparatre l'univers, nous offrons nos
louanges.
1
Et disciple de Abhinavagupta, commente
ainsi cette strophe : le Seigneur est la cause primordiale .de la gloire
de l'univers, ce grand jeu de l'activit cratrice et rsorbatrice,
lorsqu'il unit et spare librement ses propres nergies dont procde
l'infinie varit des choses. Dans son Spandasandoha
2
, cet auteur
donne plusieurs interprtations de l'expression 'fokticakravibhava'
' gloire de la roue des nergies ' qui toutes conviennent au prsent
hymne.
Cette roue, dit-il, dsigne l'ensemble des organes sensoriels dont
la gloire : agir sur leurs objets respectifs, a pour source Siva; mais
en un sens plus profond, il faut entendre la roue de l'nerg.ie des
organes, sa glorieuse majest portant sur son pouvoir de mnmfestcr
ou de rsorber leurs objets respectifs, formes, sons,
La des nergies symbolise encore l'efficacit des. formules
et attitudes mystiques (mantra et mudrii); par sa pmssancc le
sdhaka atteint l'efficacit surnaturelle quand il se rfugie en son
Soi, savoir le Seigneur, lieu de repos de toutes les formul.es
et attitudes. On peut aussi interprter cette roue comme la puis-
sance du sam<idhi obtenue par la et l'initiation, sa gloire se
manifestant par la venue du matre dont la source est le Seigneur.
Si les nergies reprsentent les desses Brahm, etc.. et les dieux
Brahma, etc., dont le cercle forme cet univers diffrenci tcnanl
cuptive l'me indivi<lucllc, la gloire de <.;cttc Jans
1. l' usyon jagulu(z ralayodayrw 1
laq1 Suklical.'rauibhavaproblim.Jarf1 scd1karaT?I 11 l. Sm celle rouu, cl'.
p. 18, 50 sqq.
'..!. Court truit qui glosu c.:clle seuil' stance. h'..$.T.S. X\1. Je 10sumt les p. l5
7
-90-
le Seigneur, sera de quitter c.:es tats dgradants et de s'lever
toujours davantage. . . . .
On peut encore considrer le cercle des energies comme celui des
multiples yogin1 . et des siddha._ Il. devient ds qu'on
acquiert les pouvoirs de yoga ou siddhi, telle la connaissance du pas-
s et de l'avenir, sa cause tant le Seigneur qi les confre.
Ou encore 8aklicakra dsigne l'ensemble des nergies, ces rayons
qui au sadhaka dans la lumire _de . la
Conscience, libre et sans duaht ; uibhava aura alors pour s1gm fi-
cation l'panouissement de la flicit, la lumire ainsi dcouverte
donnant pleine satisfaction au cur.
Enfin voici une interprtation plus prcieuse : chez un yogin
incomplet qui aborde la pratique du cercle des nergies, la lumire
consciente ne resplendit pas de faon totale, en d'autres termes,
la Conscience indiffrencie et sa prise de conscience pleine de libre
puissance (prakasa et vimarfo) ne se rvlent pas avec clart
2

Pour les rendre efficaces, il faut les voquer sans rpit, ce quoi tend
la contemplation de la roue qui permet de pntrer en Siva - sa
propre essence - au cours de tous les tats, du fait qu'il n'y a pas
d
1
tats o Siva ne soit manifeste
3
Ainsi en atteignant la suprme
vibration (spanda), on reconnat que l'univers dont la nature est
lumire consciente, forme la roue des nergies et n'a d
1
autre exis-
tence que la lumire intrieure du suprme Siva.
Glosant les versets 6 et 7 des Spandastra, enseigne
que l'on peut restituer la conscience aux treize de la pense
et des sens devenus inconscients sous I1efet de l'iliusion. Un yogin
toujours vigilant l'gard de cette roue dont il voit les rayons
inns comme ceux de sa propre gloire, doit examiner avec zle et
rvrence la vibrante Ralit (spanda), sa vritable nature iden-.
tique Siva
4
e Ds que la diffrenciation s'vanouit, toutes les,:
divinits savourent un nectar merveilleux et universel ; et quand
ils gotent la flicit, les organes accdent une parfaite
cience.
5
Le yogin possdant partout, en ses diverses activits, la libert
inne et spontane de Soi peut jouir sans obstacle des cho'sel:i
dsires. De mme que le fer sous l'action du feu devient feu /son
tour, les organes inconsc.;ients empruntent nergie et consdcnce
1. divines pcrsnnni lies ou femmt'S prn Lir1u<.lnl. h.: yoga; <le mmc les
1
;iddha sont la rois les organes intelleclucls et sensoriels, mais aussi cs oira, hurnrrws
hroques et accomplis ous Je pouvoirs extraordinaires. cr. p. [>-1-69 d
2. Son l encore asiddlw.
3. Spandasandoha, p. 'Z4, fin.
-L Spandanirr:iay:i, p. '20-21.
S. T.A. lfl, 81. 263.
- 91-
au spanda lorsqu'ils entrent en cont::wt avec lui et baignent dans
la Lumire consciente1.
Retour au Centre, au Cur vibrant et en repos, lieu de la grce
et de la force, et aussi expansion infinie du Centre en tant que vie
universelle dans la gloire et dans la louange divine, ce double mouve-
ment de la roue des nergies peut tre compar une spirale que
d'un doigt on et droule : enroule vers le Centre, la multi-
plicit disparat, droule . nouv.eau, la varit rapparait ;
l'ignorant auquel fait dfaut une claire conscience du Centre, reste
prisonnier du droulement automatique de la spirale, le mystique
cherche l'enrouler; seul le mystique accompli, dont le doigt ne
quitte jamais le Centre, gouverne en toute libert enroulement et
droulement2.
L'homme ordinaire est broy par le cercle infernal de ses propres
nergies formant pour lui la roue du temps et de l'angoisse dont le
mouvement ne s'arrte jamais. Inattentif au centre et obissant
une incessante vasion, il se rpand la surface de son tre. Ainsi
l'nonce Abhinavaguptas : Les nergies rendent esclave .des
hens du saT[lsiira celui qui ne reconnat pas son essence relle,
Elles obscurcissent sa prise de conscience au moyen des phonemes
et de la trs redoutable alternative' laquelle il parvient durant
les tourments du doute. D'aprs un Tantra : Les matresses cl.es
centres
5
, effroyables, (le) trompent encore et encore l ' Et aussi :
' Elles prcipitent toujours plus bas les tres borns qui s'attachent
aux choses (de ce monde) '
6
Mais ces mmes nergies librent ds
cette vie celui qui les reconnait comme sa propre Les
Spandastra le dcJarent : Lorsqu'il prend de fermes en
un seul lieu (Acte pur ou Je absolu), il gouverne 1'appar1t10n et
disparition (de l'univers
7
) et accde l'tat de (suprme) agent qm
jouit. Il devie11t en consqence le souverain de la ,.s:
L'tre veill qui dcouvre le Centre et s>y tabht,
sa libert par la ronde glorieuse des nergies, l'image de Siva,
l. Rsum des c.omrnentaircs aux Spandastrn Niri.rnya de el
Spandapradipik de
2. N'est-ce pas l se tenir dans l'lan? Cr. ici p. 46.
3. P.T.v., p. 43.
4. El pourtant, prcise l'auteur, jusque dans le difcrenci cette prise de conscicnc1!
reste unique et indifTrencic. on peul se puisqur. l'alternative ou pense duali-
sante (vikalpa) est elle aussi de nature divine.
5. Pi/ha, siges de l'nergie.
6. Citation du Miilinivijayatantra Ill, sl. 31, p. 171.
7. Sous sa forme subtile de que mentionne k. prcdent stra.
8. Yadii tu ekatra sarrzrefhas tada tasya layodayau 1
niyacchan blioh:trtam eli lalt calirefoaro bhavel 11 51. 11 n'est plus alors objet
mais sujet qui c:xpclrimentc et qui jouit..
7-1
-92-
prouve une surprise toujours renouvele les voir se reployer et
s'panouir. On le nomme ' matre du champ ', savoir du corps,
des organes et de leurs objets.
En quoi consistent la contemplation de la roue des divinits, le
culte qui lui est rendu et la matrise qui en procde ?
L'hommage aux facults divinises de l'homme remonte une
lointaine origine ; des tantra perdus, comme le Kramasadbhava, le
mentionnent mais se gardent d'en traiter ouvertement, les noms
des divinits devant rester secrets
1
Par contre Abhinavagupta ne
s'embarrasse pas de tant de scrupules et en donne ici un expos
semble-t-il complet. Il y rfre aussi dans d'autres de ses ouvrages,
ce qui nous permettra de fournir quelques prcisions ce sujet
3

En son essence ce culte se ramne contempler la roue des divi-
nits lors de toutes nos activits en restant conscients de notre
cr comme du calice d'un lotus huit ptales. Chacune de nos
facults apparat comme le sige (pf/ha) d'une nergie divine
particulire reposant sur un ptale assign l'une des divinits
protectrices des points cardinaux (lokapiila), porteuses de leurs
armes, instruments de la dlivrance. Les organes cognitifs et
sensoriels rayonnent ainsi du cur, allant et venant sans rpit du
centre la priphrie.
Dans le cur, au milieu du lotus, trne la Conscience absolue,
Siva dou de sa parfaite nergie que dsignent les termes ananda-
bhairaua et nandabhairav, le Dieu et la Desse faits de Conscience
et de flicit suprmes. Il s.'agit de Siva ardhanra, mi-homme,
mi-femme, sa moiti gauche tant celle de la desse ParvatP.
Il a pour gestes ( mudri) le don et l'apaisement. Le Dieu est pure
conscience indiffrencie (pralcafo} et la Desse, prise de conscience
de soi (vimar5a). Elle s'amuse sans arrt faire surgir des mondes
varis puis les rsorber en elle-mme.
Commentant le second verset de la Paratrsika (p. 61 }, Abhina-
vagupta s'explique plus clairement : dans le Cur ou Conscience
ultime, fondement de tout ce qui existe : corps, souffie, pense, etc.,
se trouve l'nergie de la roue des divinits, qui n'est autre que
l'nergie interstitielle, au centre de la roue des organes sensoriels et
1. Atirahasya. Cf. Mahrlhamanjari, dition Trivandrum Sanskrit Serics, p. SR.
2. T.A. ch. V, sl. '26-41. Un culte analogue mais plus grossier semble encore clbr
dans l'Inde du Sud : l'adorateur contemple une srie de cercles concentriques a
du au centre. Les divinits places aux points cardinaux et interm-
diaires y ont des formes humaines cl portent leurs armes et emblmes. Voir le tableatt,
appendice VIII, de la partie de la traduction de Somafambhupaddhati p;:ir
Hlne Brunner-Lachaux.
3. f.:pousc de Siva.
-93-
canaux subtils ; ou encore le linga et la karr;ikii.
1
du lieu de
naissance : l'nergie la fois mle et femelle.
, Al! sommet du front, dans le triangle inscrit l'intrieur du lotus
a mille ptales, sige le matre vritable ( sadguru) ou vigilance
inc.essante ; magicien de la non-voie (anupiiya), il se montre
l'gard de ses disciples puisqu
1
il leur confre l'veil sans
recours moyens de libration. 11 .. suffit d'tre
v1g1lant pour que l'univers en tous ses aspects, loin' de former un
obstacle invincible, serve de voie menant la reconnaissance de
Siva.
Les narines, ces portes du corps - temple de Siva -, ont pour
gardiens les souilles expir et inspir (prr:w et apdna) livrant accs
au domaine bhairavien ; ils reprsentent les deux fils de Siva :
Ganesa, dieu de la sagesse et de la science, "tte d'lphant avec
seule dfense, mattre de la troupe des demi-dieux, et Vatuka,
Jeune brahmacarin six ttes et ux longs cheveux.
Sur les ptales du lotus formant une rosace autour du calice
dans lequel rgne la Bhairava-Bhairav, rsident huit
desses ou nergies des organes diviniss, tendues vers Bhairava
a fin de lui offrir les fleurs cueillies dans l'univers :
1. Sur le ptale du dieu Indra l'est le foudre (vajra)
J l V \
la main, la desse Brahmii.1). en tant qu'intelligence, prsente
Bhairava la certitude relative aux choses, fonction de la buddhi.
2. Sur le ptale du sud-est, celui d'Agni avec sa lance, Sambh?v
artisane du moi, se dresse avec pour offrandes gosme et orgueil2,
abhimana tant reli l'aha1J1.kiira.
3. Sur le ptale de Yama, sombre et effroyable divinit de la
mori ayant un bton la main, se tient la jeune fille Kumiir, pe,nse
vive et capricieuse comme une adolescente. Elle occupe le
du sud d'o procde la pense universelle. Elle rend .son a
l'aide de penses fluctuantes, indcises, pleines de multiples desirs,
le vikalpa tant associ au manas.
4. Sur le ptale du sud-ouest o rgne la divinit .de la destruc-
tion dmoniaque (Nirrti) dont rinsigne est un glaive, se
l'nergie en tant que voix ou son qui rcolte pour Bha1ra-
va les sons les plus mlodieux.
1. Symboles des organes masculin et fminin; pricarpe du lclus, repr-
sente l'organe fminin.
2. Les choses sont perues par les sens
1
dsires par la pense (manas), appropries
en tant que 'cela par le sentiment du preneur (aha111kiira), !ondes avec certitude
par l'inlellecl (buddhi).
3. Vai$Q.avi, puissance personnifie de l'omniprsent, associe au son qui,
lui aussi, s'tend au loin.
-94-
5. Sur le ptale de l'ouest, celui de Varul)a porteur du lacet,
sjourne V iirhl1, la peau, dont l'offrande de fleurs douc_es au
toucher et de sensations agrables ensorcelle le cur du Dieu.
6. Sur le ptale nord-ouest du dieu du vent ou de l'air, Vayu-
Marut, avec pour emblme l'aiguillon, demeure la desse de l'il
ou de la vision, I ndrii1)L', en qute de trs belles formes et couleurs
pour les dposer aux pieds du Dieu de la batitude.
7. Sur le ptale du nord, bourgeon de Dhanapati plus connu sous
le nom de Kubera
3
, dieu des trsors porteur de la massue,
la desse C.mul).</.ii., aspect terrifiant de Durga, reprsente la
langue pendante et qui .symbolise le got. Elle offre Bhaira va
les substances les plus savoureuses doues des six gots fondamen-
taux : acide, sur, doux, sal, amer et astringent.
8. Sur ptale nord-est du Seigneur ayant le trident pour
la grande desse de la beaut et de la fortune,
jouit de la senteur du miel de lotus et, en tant que nez ou odorat,
porte au Seigneur de dlicieux parfums.
Ainsi les desses des organes intellectuels et sensoriels s'empres-
sent autour de Bhairava et de Bhairavi avec leurs merveilleuses
offrandes glanes inlassablement dans toutes les directions de
ru ni vers.
Enfin le Soi, propritaire du matre du corps
qu
1
il protge, unifie les diverses nergies, les gouverne et, lorsque
la roue s'panouit, en tire pleine satisfaction. En contact avec les
aspects varis de la sous forme des trente-six catgories',
il accorde les pouvoirs surnaturels qui en dpendent.
Pour devenir le souverain de la Roue des nergies ( cakravarlin),
selon imparti par Siva la Desse dans la Paratr-
sika5, il faut s'identifier l'nergie situe dans l'espace
du Cur divin ou anutfara
8
, car les divinits tant des nergies
omniscientes, il suffit de connatre l' Insurpassable pour possder
toutes leurs connaissances. En ce but, grce l'efficience de la
formule suprme ' Je ' ( aham), on doit mettre en branle le cercle
des nergies et des organes puis l'panouir partir de la jonction,
saturant d'efficience simultanment ( akrama) extase et conscience
ordinaire
7
; interne et externe se trouvent ainsi galiss par le
I. Femelle du sanglier, a le sens galement de peau de sanglier.
2. Avec pour autre signification pupille droite.
3. Il a d'aprs la tradition un homme pour mont.ure.
4. Sur ces niveaux du rel s'tendant de aadsiua la terre, cr. P.S., p. 26 sqq.
5. SI. 14 et 19, p. 254 du vivarar.w.
6. Sl. 4. Cf. ici p. 59.
7. Samdhi et uyutthna. Spandaslra 11. Sl. 6-7 comm. p. 20, 24 fin. et. 25.
- 95-
nivellement des rugosits et vicissitudes ces grands obstacles la
vivacit de la vibration.
1
Alors le matre du champ, ayant le Cur pour assise inbran-
lable, . chaque fois qu'il se vers la priphrie imprgne ses
sensat10ns de la flicit et de la puissance de son creur. Aussitt ls
org??es identifis au Cur, celui-ci se rpnd partout o vont les
: C'est par l voie des organes que le yogin apprhende
les Jouissances du monde sensible, et par cette mme voie il a
coutume de. dverser son cur, remplissant (ainsi) le triple monde
d'une pulsation consciente.


Les rayons de sa conscience cessent d
1
tre les barreaux de sa
prison et lui livrent accs au monde environnant : il ne se disperse
pas en eux et par eux ; au contraire, plus il se diversifie et plus
fortement il se centre.
, Finalement, il n'y a plus uh seul orgarie qui n'ait ralis.,. :
1 est pntr d
1
nergie des pieds la tte, ce que le
des1gr:ie par le terme ' dehavyiipli' ; ds que la vibration envahit
le Sm ( almavyiipli), le yogin devient le souverain de la Roue
( cakravariin)2.
Abhinnvagupta dclare dans son Paramrthasara : Ainsi le
Dieu qui, pour se divertir, met en mouvement l'engin de la roue
des nergies, est le Je, essence immacule, sigeant comme coriduc-
ter de la grande Roue des nergies.
3
.
Le cerc.le des ner
0
ies tourne sans arrt chez tous les tres : leur
exprience n'est que de son frmissement; saris cette
tion il n'y aurait que l'inertie du roc. A partir du cur l'nergie
rayonne jusqu'au monde extrieur en ondes vibrantes.
rnanda en dnombre neuf successives : dyaspanda, v1brat
10
n
initiale du sujet conscient ; puis tendance de l'nergie
sion de l'univers ; parispanda, vibration encore et
subtile lie l'branlement de la connaissane l'tape de prpcr-
ception ; sphurallii, fulguration au niveau des organes .
qui cherchent stabiliser cette prperception. A ces
internes succde le quintuple dploiement des activits sensorielles
varies l'gard des sons, des contacts, des formes, des saveurs et
des odeurs.s.
Le Cur cosmique apparat ainsi comme la source de la vibration
1. 63, lrnd. p. 17;).
'.2. Plus n
1
corc, en siuavyiipti, Io suprme viltralion remplit tout, y
compris srrYilude el iJlusion. Cf. Bodhapancadasika, si. l 4, p. '26 Sur les trois vy1pti,
V.B., p. 101-1042.
3. lfi 8aklicakroyanlrafJ1 kr.ltjoyoqena viihayan 1 aham eva fokti
11 17.
"1. p. 124 comm. du 36-37. Cf. ici Inlrod. p. 13 sqq.
-96-
qui flue perptuellement travers nous, mais nous nous acharnons
cristalliser cette vie frmissante en des nuds ( granlhi) dont le
principal est l'ego, limitant de la sorte sa force et sa jubilation.
Nous n'adorons nul autre que le Soi
1
sans percevoir cependant sa
grandeur ; nous l'imaginons comme born et nos nergies triques
lui offrent des choses mdiocres dans le vain espoir de le satisfaire.
Par contre chez un yogin qui a dli ses nuds, la vibration spon:_
tane de trs haute frquence se rpand du cur tout son tre et
par del ; elle le remplit alors d'merveillement puisque c'est la
pulsation divine qu'il dcouvre en lui comme au Cur de l'univers.
En dernire analyse le culte de la Roue des divinits revient
prendre conscience de cette vibration (parispanda), celle de rner-
gie dite' glorieuse, du fait qu'elle repose au plus haut degr dans
le Cur
2
Il suffit de la reconnaitre telle pour saisir sa nature de
vibration transcendante
3
Abhinavagupta donne le conseil suivant:
({Qu'on se concentre sur la grande Roue tourbillonnante en tant
que vibration rvlatrice du Soi.
4
En effet, les actes figs devenus inconscients ainsi que les fluctua-
tions mentales conscientes se dissolvent lorsque la roue tourne
trs rapidement
5
; le yogin se tenant au Centre, la source de
l'nergie vibrante, ne voit plus ni jante ni rayons - le monde
diffrenci - et le Soi se rvle lui, rpandu partout, la pri-
phrie comme au centre. mesure qu'en se dployant la Cons-
cience recouvre et cache l'objectivit, il y a stabilit, satisfaction,
fusion avec la lumire ; voici la vibration qui permet d'obtenir la
libert ultime partout imprgne de cette Essence.
6
Abhinavagupta montre ensuite que la contemplation de la Roue
engendre des pouvoirs surnaturels : Si un yogin demeure absorb
sans interruption dans sa propre essence, alors grce la pratique
de la roue des divinits, les mres, Brahm et autres, les matresses
du yoga ... lui apparaissent. Les gloires et pouvoirs qui procdent
de cette absorption sont associs la grande puissance de Bhairava.
Cette troupe lie aux nergies khecari, etc., empruntant sa puissance
celle de Bhairava, accorde la ralisation suprme, savoir la
libert dans tous les domaines ... et l'aide du corps lui-mme. 1
1 . .Atman. Cf. IV.V.6.
2. Anayaiua hrdayarigamatay ya.asvini -iti prasiddham. P.T. Lughuvrlti, p. 8, l. 18.
3. Idem, haut de la p. 9.
4. T.A. V.33. cr. M.M., p. 53-54.
5. Cc que j'ai ludie dnns la Mahrlhamafijar, Introd., p. 53-54.
6. Yada tu vedyatyl]. kramer;w pracchiidanal'fl sal'[lvidr!pasya ca prathanaf{l taira
tuat dhrtil) tadrrpasyaiua <ipyiiyanar{'l latprakiifoyogal) 1 talraiua paramasviilanlryala-
bhlmakaf!l spandanal'[l sarvatra tenairHJ rpef)a vydplam 1 Laghuvrtti, p. 7, l. 15.
7. Ele sarue paramil"{l siddhif!l unenaivq dehena
suatanlrailf!l dadali 1 Id., p. 13, 1. 11 comm. au si.
-97-
Telle est I.a dlivrance en cette vie mme (jvanmukli); si le corps
part, la libert serait incomplte. Il n'y a donc de vraie
que. dans les activits mondaines et par rapport elles.
Que ' se librer' indpendamment d'elles et pour qui
l_es ? Intellect et sens, loin de disparatre, demeurent mais
a leur Juste place ; les sens adhrent au cur, leurs nergies s'lvent
vers Siva dans l'amour et s'y tablissent dans la libert.
Les divinits et seigneurs de la Roue dont la vie rside en Bhai-
devenus Bhairava mme, s'emploient servir le yogin auquel
ils octroient, outre la libert, tout ce qu'il peut dsirer dans l'ordre
du connaitre et du jouirt : La suprme Connaissance, celle du
cur, est confre au yogin par les divinits de Bhairava rsidant
l'intrieur du Cur et adonnes la Yibration subtile ; cette
vibration dvoile !'Essence en la librant de la vibration (grossire)
qui, dployant le monde, l'obscurcit. 2
. Elles procurent aussi des pouYoirs estims comme in(rieurs
h1en que glorieux ( vibhiili) et dus la puissance de la saisie fulgu-
rante et globale de l::l vibration consciente. i>
3
Dans les passnges cits, Abhinavagupta insiste sur la vibration
de la Conscience, ce frmissement qu'il chante la fin de son hymne
en l'honneur de la roue des nergies. Celui qui contrle son i:ropre
corps ne subit plus l'csclo.vaCYe de ses nergies et peut vraiment
jouir de chaque chose, ce dont l'ignorant se montre incapable
puisque ces mmes plaisirs se transforment pour lui en tourments.
La satisfaction des dsirs demeure lgitime d:un bout l'autre
de la voie menant Siva : avant l'veil, elle permet de
plus aisment aux plnisirs de ce monde dont on est rassasi. Ensu_ite
jouissance et libration s'obtiennent simultanment quand, au heu
de foire obstacle la jouissance devient l'occasion de la dlivrance,
car il n'y a rien' qui ne puisse servir d'accs Siva. Enfin l'tre
dsintress, dtach des joies mystiques, intellectuelles et senso-
rielles, qui a reconnu son identit Siva, Soi de l'univers, prom:e
sans interruption la flicit cosmique lorsque toutes ses
retournent constamment vers Lui, portf'uses de leurs plus subt1.les
jouissances. De (ette b:1titudc lnquellc tout prend part, rien
n'est exclu, pas penses et le sentiment du
moi.
1. Id., p. l:l.
'.!.. /if., J'. lfl, J. I COHllll. llll ;). '!i1.
:L

... /1/ .. p. 111 fin. C-:0111111. :ltl ;1. lfl.


SIGLES
I.P. lsvarapratyabhijnastra ou karika de Utpaladeva,
Srinagar, 1921, Kasmir Series of Texts and Studies (K.S.).
I.P .v. lsvarapratyabhijfivimarsih, son commentaire par Abhi-
navagupta, K.S. 22 et 23.
M.M. Maharthamafijar de Mahesvarananda, Traduction par
L. Silburn. Paris, 1968. dition sanscrite : Trivandrum
Sanskrit Series, No 66, Gai)apati Sastri, 1919.
P.T.v. Paratrsikatantra avec le vivaraQa de Abhinavagupta,
Srinagar, 1918, k.S. N 18.
ParatriSikalaghuvrtti de Abhinavagupta, Srinagar 1947,
K.S. No 68.
S. K. Spandakarika ou Spandastra de Vasugupta, trois ditions
K.S. N
8
5, 6 et 42.
S.n. The Spandakarika of Vasugupta with the nirr.rnya by
cd. Pandit Madhusdan Kaul. Srinagar, 1925,
K.S. N 42.
T.A. Tantrloka de Abhinavagupta avec le commentaire de
Rajanaka Jayaratha, en 12 vol. Srinagar, i918-1938.
V.B. Vijnnabhairavatantra, texte traduit et comtnent par
L. Silburn. Paris, 1961.
TABLE DES SUJETS
Absolu, paramasiua, anullara, 6 sqq 21
50 60 81.
alJsorption, 13 Jg 45 53 78 81-S'l 96.
Act.e pur, vihranl, spanda, 13 16 45 91,
0
de conscienct', 43,
activit spontane, 43-44 90, corporellr,
38 44 sqq, ordinaire, 13-14 16 22 39-
42 50 53 63 67 72 95.
Hcteur, 8 74 7ll 83.
adoration, bhalli, plij, 50 56-57 77
80-85 87 sqq 92.
Hgilation, fl11ct1rntion, 16 21 54-55 70
96.
nllcrnalivl', oult', vika/pa, JO 15 53 62
68 71 84 8 91.
amour, (kima,) 15 53 69 74,
divin, bhakti, 78 83, amants, 87.
mystique, mudri, 16 38 sqq 43
72 sqq 7f> cr bha;rauiD et krama-
mudra.
:rnlonomit> r la Conscience, sulgntrya, 7
32 62.
batitude, Clicil1\ nanda, 1 J I 7 20 22
40-41 45 51 5i 62 82 87 90 92 94,
cosmique, 47 54 sqq 97.
crnlre, jonction, l 6 21 42-43 45-46 54
64 94 96,
0
de la Roue cosmique 8:.l-92,
centres du corps, 91-94.
cur, hrdaya, 13 16-17 19 33 43 45 62
69 73 87-9, cosmique, 19 40 84 92
95 sqq. Gr.rnh' du cur, saul;i, 43 45.
confusion, moha, 9-1 O 5758 63 68 73.
connaissance, jnna, 13-15 26 41 65 67
71 sqq,
0
suprmc, 12 26 30-31 36
n
1
43 54 68 73 9i.
conscience, caitanya, 36 n ', saf(ltrit, cil,
prak<isa, 7 13 17 39 sqq 51 69 sqq 92,
0
cosmique, 19 29 32 sqq 44 50 53 57
59-60 63 68 74 sqq. oJibre, 32 45, acte
de prise de conscience de soi, 7 25
'.28 32 4'l 52-53 58 61 s.t 73 8i 84, 90,
toujours surgissante, 53 sqq 61, homo-
gne, 55, mousse, fragmente, 29
70-71.
conviction, 19 58 n'.
corps et ses organes, l 1 38 42 44 sqq 59
69 74 78 87-97, adoration du
0
87-88
92. Maitre du corps, 92 94, sa divi-
nisation, 11 43 45 96, connaissance
du, 16 61.
culte, yajna, 50 79-80 83 sqq, sacrifice
de l'galit, 54-55.
danse, 51 55 83.
desses, dtL-', nergies des organes divi-
niss, 87 sqq 92 sqq.
dieux protecteurs des points cardinaux,
lnkaprila, 87-88 92 sqq.
dsir, 13 25 n 44 55 61 63 73 78 93 97.
discours, bavardage, jalpa, 57 67 71 et
n 78.
discrimination, 17-19 41.
dhman, 6, unique, 32 sqq 38
62 67 sqq 71-72, bhairavien, 93.
douleur, 17 26 29 38 43 50 53 sqq 57
68 82.
dualit, duaita, diffrenciation, bhtda,
7-10 16 32 34 36 44 52 54-57 61 67-69
72 74 78 81.
efficience, vrya, 14 l 40 42 sqq 45-47
63, des rormules et attitudes, 45 89
94.
galit d'esprit, uniformit, samal, 10
40 51 53 55 74 94-95.
ego, je limit, moi, ahaf(lkra, 21 53-54
71 87 96 sqq.
lan, 12 15 21 40 46 81 n.
lphant, 28 36 69 75 93.
merveillement, stupeur, camatkcra
1
17-
18 41 46-47 60-61 n 96.
motion, impression intense, 15 21 68
70 73.
nergie. fokli, 7 25 27 38 43-45 50 74,
- 100 -
vibrante, 29 71, latente, 36
1
divinise,
44, jaillissante, 60, interstitielle, 92.
Son panouissement, 29 36 40 42 46
62 67 92, triple nergie divine, 7 13
17 22 26 30 43 45, voie de l'nergie,
15-16 39 41 43, multitude d'nergies,
.10 32-33 53 55 71 78 83 89.
0
des
organes, 93
1
omniscientes, 94.
expansion de l'nergie, 91 95, de l'univers,
55 92, de l'Essence divine, 79,
0
el
contraction de l'nergie, du souffie,
39 44 46.
exprience, 13 27-28 43 60, immdiate,
16, intime, mystique, 58 64 83.
extase, turya ou quatrime tat, 13 21
26 36, samiidhi, 35-37 42 60 73 82.
feu de la Conscience indiffrencie, 15
20 25 27 90.
firmament, ciel de la consdencc, uyoman,
7-8 13 68-70 72 sqq.
not, flux, 42 sqq 46 60 sqq 68 71 73,
et reflux, 38 40 44 46,
0
de l'ocan,
formule mystique, mantra, 16 38 43
concentre en aham, Je, 45, son eOi-
cience, 94, germe du cur, SA UIJ, 5
18 n' 43.
gloire universelle, uibhava, '215872 8U sqq
96, native, 9 61 64.
grce, anugraha, sliliprla, 6 11 19 26
28 n
1
38 50 52 sqq 71 89-90.
harmonie, quilibre, galite, samati, '20
39-40 55 64 74 82.
illusion, may, 8-10 18 21 30, molia,
57 73 90, nergie d'illusion, 74.
inconscient, jarja, moha, 17 '25 27 29
67 70 72.
indiffrenci, indifTrenciation, 11irvikalpa,
7 9 11 15 20 21 30 34 40 4'2 44 52 57
60 63 68 71 75 82.
Inexprimable, anultara, 21 57 59 sqq.
inn, sahaja, 6 J 0-11 17 26 30 58 6'l-63
90.
instant, 50, prsenl, efficace, 16
62 sqq 71, premier
0
13 15-16 11. Trois
instants successifs, 13-16 22 63 74.
Instantan, 32 35 43 58 68 73.
insurpassable, anutlara, 11 l 7 'W 45
59 sqq 6'2 94.
intriorit, anlaralva, 14 2'2 42 44 68,
et les mudrii, 46.
intuition globale indlcrrninl', par<-
marsa, niruikalpa, 9-10 16 50 n
1
58 n.
irrel, asalya, 9 67 sqq 73.
ivresse, 26 41 57 62 74.
Je, limit 53, illimit, absolu, 9 14-15
21-22 40 sqq 45 60 63 74 91 95, voir
a ha m.
jeu, 21 27 40 67 69 72 7l 82 89 95, de
el de l'nergie, 9 '24 27-29, d'amour,
81.
libration 25 46 sqq 59 sqq 74 CJ'.2-93,
durant la vie, jvanmul.-li, 26 59 62,
dans la multiplicit, 7 17 30 90 97.
liberl, 7-9 11 17 2t"> 26 '20-30 39 57 59
61 72 i4 91 96.
lien, entrave, bandha, 7 17 "26 30 o3 57
59 61-62 68 73 82 91.
lotus, '25 87 92-93.
lumii:re de la conscienc<',
praksa, 7 17 25 '2. 32 57 60 67 70
74 78 90.
matlre spirituel, guru, 11 19 26-27 5B
87 89 93, n'utilisant aucun moyen, 1
60.
miroir dP la conscirnct>, 8 15 25 S<jq 32
34-36 44 58 64 Pl n
1
, ses r<'flets, 8 27
32 36 41 63 sq q 8 1 n
1
83.
nl'.sciencr, ignoranCt', auidya, 8-10 72.
organf'S, internes, 16, se11soriels, l '2 16
"20 40 46 54 89 9'!, inconscients, tO,
diviniss et conscit>nls, 95, pratiq11t!
<les organes, kara!Ja, 16.
oubli, 40 53 57 62 64.
pl'nse dualisante, m<11ws, uplionnelll,
uikalpa, 38 40-41 54 5U 61 63 97,
purifie, 45 50 54 71 87.
phonIDl', 15 38 45 el nz 46 60 91.
pou\oir surnaturel, si<ldlli, 43 45 s1q
87 90 96, univers('), n8 91.
prodige, 46-47.
rr:-1lilP. irnm-dialP, (llW[JCIJa, 18-20 4-1,
alubal1 10, vibranle .. absolue 11,
l 7-18 32-3.'3 38 -10 4 50 ;)3 5<.l 61 74 8'2.
r<!connnissnnce de soi, de Siva, prafya-
bhijru, 55 58 n s2 Q3.
reflC't clans uu miroir, prati /Jimba,
:J,j Sf[<J 41 83, \"OI' 111iroil'.
13, l1!rrtirn1m111lr<i,
7"!, sq(,
0
de Si\.n. ;):L
1,1, :;1.1opna, 8 31 ;,1{ 60 6 <;4q 2 l'J.
rit<', sncrific<', 4fl 51 id sqq 87-8K
92 sqq.
ro11r, cakro, 8H, des 1li\i11il1"s 1,11
sa mailrist,
- 101-
sceau de Siva, smbhaurnudr, 15 38 sqq
41.
Soi, iitman, 8 16 25 32 35 40 sqq 43-46
50, 53 sqq 58 60 64 70 sqq 78 sqq
94 96.
souverain, 32 74 84, de la roue cosmique,
89 91 94-95, souverainet, 8 '25-26
64.
souffies ou vie, prT)a, 16 38 42 44 46
61 87 93.
souci, proccupation, 18 21 51 57 61 71
73.
splendeur, 27 32 68 74.
spontanit, 6 17 30 38 sqq 42 44 sqq
47 59 62 67.
sujet, suprme, 40 44 61, opur, pramatr .
13-14 22 54 72 82,
0
1imit, 59.
temps, kla, 14 17 29 32 45 57 60-61
63 69 74 91.
tnbres, 25-26 50 62 68 i4.
trsor, 18 57 62.
lridcnt, triade, triangle, /rikor:,w, lrisMa,
26 30 94.
tout, totalit, 7 36 42-43 50, indil'rrenci,
Il 13 27 34 54-55 73 78-79 81.
un, eka, 25 42 62, unit, unicit, 21 32 44
51-52 54 71 74 81,
0
d'esprit, 84.
univers, monde, viiva, loka, 17 et n
1
55 70 72 83 87, apprhend par l'igno-
rant, 29 57-58 63, par le yogin, 44
73 sqq. o en forme de roue, 90 aqq,
0
infini, glorieux, Il 20-21 28 40 45-
46 52-53 64 78 82-85 93.
0
vibrant,
20, reflet dans un miroir, 8 15 25 28
32. Vision de l'univers, 14-17 41 53.
vibrnlion consciente, spanda, dhuani, 7
13 16 21 39 42 45 67 70 sqq 84 90 95,
de neuf sortes, 95 sqq.
vide, Anya, B 38 42 67 70 sqq.
vie cosmique, 7 42-44 74 91, divine, 83.
vision intuitive, illumination, 15, globale,
42.
voie clc la libration, upya, 11 18 39
8'2, progressive, 11 sqq 15 22 39 -' l
-13-44 60 o subile ou voie de Siva, 15
22 39 44
1
60, absence de voie, an11piiya,
13 17-2'2 39 44 81 sqq 93.
INDEX SANSCHlT
aduaya, aduaita, Un-sans-sf'cond, non-
dunlit, 7-8 56 65-66.
arzultara, insurpassable, inexprimable et
autres sens, 6 Il 17-21 45 55-57
59 sqq 8 94, phonme A, 15 67 n.
anupya, non-voie, immdiat, 6 n
1
13-
14 17-21 39 44 45 n' 81-82 93.
auil.:aipa, intuition inditYrencie, 12 60,
voir niruikalpa..
auidy, nesciencc, 8.
aham, 48 66 76 94. Formule mys-
tique, 15 45 94.
aha'!lkrira, agent du moi, ego, 56 85
93.
r:ravopiiya, voie de l'individu, 16-17
39 44 60.
lman, Soi, 16 40 48 54 56 76 9c1.
adyaspanda, branlement initinl, 95.
ammda, rlicitt', 17 56 76 92.
bhasa, rcnet, npparcncP, :35 sqq 63 n '
icch, intention, volonlr, tlsir, 13 23
25 76.
0
fokli, 13 22.
uccara, 16 39 43.
uf/ara, ses sens clhers, 59-60.
udna
1
soumt ascendant, 4'2 n
3
.t:l n
1

utsaua, fte, liesse, 37.
upiya, moyen de lib6ralion, \'Oie de IA
dlivran, 13-18 39.
kiima, dsir, 31 93, dieu de l'amour
charnel, 66 74.
J.:alc, ncrg'ir. subtile, 23 -26 nt 66 76
79 n kal- 69.
1.-ila, tcmps
1
66 74.
kti/L 1"nergic divine, :>3 11' 84.
lm!i, pointe inilialc, intermdiaire 011
flnalr. 16 63.
krama, succession temporelle, 65-66
011wdr<i, attitude rnysliquP. d'galisa-
tion 39-44 46 8'2.
J.riy<i, nctivit. ordinaire, 67,


nergie utilisnnl des nrg:rncs,
13 22 3.t n
1

mailrc du champ, li Soi,
86 94.
klzewri.. souveraine, 51-::>:> ()6.
gtm<ll111rt(J, musiciens cleslc-s.
66 68.
- 102 -
gocari, un des cinq courants de l'nergie,
infrieur khecari, 71.
guru, maitre spirituel, SO 85 87, sad o
vritable maltre, 87 93.
cakra, roue des nergies, 85-87,
0
uarlin,
maitre de la roue des nergies, 91 94-95.
cari, 31-33 et n:11 56.
cil, Conscience abS-Olue, 36 48 56 66 85,
cidananda, flicit de la Consciencr, 54
56.
cilla, conscience empirique, 71.
ja<f.a, inconscient, ignorant, born, 23
26 n 29 65 70.
jagad, monde, 23 65 76 89 n
1

jagadnanda, flicil cosmiqut>, univer-
selle, 54 97.
fiuanmuldi, libration durant la vie, 7
24 30 97.
jiina, Connaissance, 13-15 31 65, osak!i,
nergie cognitive, divine, 13-14 23.
tantra, Hvres sacrs, 2 sqq 11 30.
lrika, systme si\'aite, trialisme : Siva,
n<"rgie et nara, homme, 2 4 ll-14
27.
lrikoT}a, lrila, triangle mysliqm de cc
systme, 24 30.
deha, corps humain, 95, adoration et
culte des nergies dans le
0
85 sqq.
dudas<inla, fin de douze largeurs de
doigts au-dessus du crne, 46.
duaila, dualit, 66.
dhman, domaine sivaite, rceptacle uni-
versel, l'absolu, 6 17 31-32 37 65.
Du milieu, 46 65 sqq 78 n
1

dhuani, rsonance, vibration univ<'rselle,
84.
nikhila, le Tout, sans faille, 35.
niruikalpa, essence indiffrencie, 7 9
36 n s 40 sqq 70 82,
0
sam<idhi, 13 36.
pati, matre, 74.
paramasiva, absolu, 27 81.
paramrlha, ralit ultime, 31 65.
par<imada, prise de conscience intuitive
et globale, 15.
parispanda, vibration subtile, 95-96 97 n
3

pa8u, esclave des nergies, lle de trou-
peau, 74.
plfha, trnr, pidestal, dt l'nergie,
91 n.o1 92.
pj, vnration, 56 77 85 92.
pr1,1iihant, parfaite intri()rit du Je,
15 40 n
1

prakiiAa, Lumire de la Conscience
31 34 56 62 n
1
66 70 77 90. 92:
praUbimba, reflet sans objet, 15 23
31 34.
prathamiikofi, branlement de l'acte de
conscience, 16, premier instant, 63.
pramatr, sujet connaissant, 14.
praml;ia, connaissance, 14 sqq.
pro.meya, objet connu, cercle de l'objec-
tivit, 14 16.
prtir;ia, Vie, 44, soume de vie, 37 85 93.
bimba, chose reflte dans un miroir,
34.
bindu, point sans dimension, symbole
de Siva, 45, acte libre, 15.
buddhi, intelligence, ense, 45 77 85
93 et n
11

brahman, absolu selon le uediinla, 7-9.
Le crateur, 74 89. quivalent
dhman, 65.
brahmacrin, qui mne une vie chaste
87 93, jeune brhman clibataire, 87:
bhakli, dvoti-0n, 76 83 ni, bhakla, dvot
adorateur, 76 85. '
bhaua, devenir, quivalenl au samsra
23 25 n' 49. '
bheda, difTrencialion, '.23 56 76-77
bhairaua, Siva indiffrenci, absolu,
28-30 33 48 73 85, apais, 15, ouaktra
52. '
bhairavimudri, attitude mystique avec
le regard fixe, 21 39 sqq 68 et ni s
2
.
manas, pense 7677, instable, 85 93
et n
1

mantra, formule mystique, 15-16 37
43 sqq 89.
0
vrya, B()n efficience 45.
mahkla, Temps destructeur, 74:
mahprakfo, grande Lumire.
may, illusion, 9 56 SI 63.
0
foldi, nergie
qui engendre l'illusion, 9 74.
mudri, sceau, attitude mystique, 16
37 sqq 41 sqq 89 92.
moha, illusion, confusion, 9-1 O 56 65-
66, inconscience, 27.
yama, dieu de la mort, 48, restricteur
quivaut a vikalpa, 53. >
yaga, yajna, sacrifice, ses divers rites
54 76-79,
0
de l'galit, 49. '
yoga, union, discipline, 18-19 37 44 46.
yogini, femme initie pratiquant le yoga,
4 85 87, nergie divinise, 90.
lokapiila, divinit protectrice des points
cardinaux, 92.
-103 -
uikalpa, alternative, notion double
ple. le diRrenci, 7 9 15 19 36 na
53 66 70 sqq 82 85 93.
vidy, savoir, 9-10 84 n'.
gfoire, efficience, pujssance, 56
89-90.
uibh.ti, gloire, 97.
uimarsf!, prise de conscience, 28 56
58 n 84 92, libre nergie de la cons-
90.
uira, hros, 85 90 n
1
,
u.rya, efficience mystique, 45 94.
uypli, triple pntration, 95 et n
1

Vyp- pntrer, 32 n
1
48 77 96 n.
uyoman, firmament infini de la Conscien-
ce, 7 13 66.
uyomavamesvar, !'lergie souveraine au
niveau de la parole suprme, 70.
uyulthana, tat de conscience de la
veille, 40 94 n
7

sakti, nergie divine, puissance, 7 . 23
26-29 48 triple : 22 icch
0
, 13 24,
jii.naG 13-14 24, kriy
0
13-14; anu-
graha0, grce, 19 48 52,
0
cakravibhava,
gloire de la roue de l'nergie, 89 et
n
1
95 n.
sktopya, voie de l'nergie, 15-16 22
41.
sambhauopya, voie de Siva, 15 22 39 ..
pure science ou savoir, 10
30.
1adodi!a, toujours en acte, ternellement
surgissant, 15 n
1
52 86.
galit d'_esprit, homognit,
harmonie, 3 55 64 74.
samiidhi,' extase, 21 36 40 60 76 78 8'2
89 94 n'.
sa1711ara, courant imptueux du monde,
23 26 n
1
53 sqq 56 91.
saTflslhiina, existence bien tablie, 37
43-44.
sahaja, inn, spontan, 6 7 56 62 ..
siddha, tres dous de certains pouvoirs,
4 85 87 90 et n
1

siddhi pouvoir surnaturel, 86 90 96 n
1

slotra,
1
hymne, louange, 1 5 et n' 48 77
spanda, vibration, 7 37 42 44 71 90
95 96 n.
suaprakfo, lumineux par soi-mme,
vident, 7.
sulantrya, libert, auatantratva'
23 66
96 n-
1

hrdaya, cur, 17 n 19 n
1
3l
85
96
n.
RECTIFICATIF
P. 2, note 2. Ajouter :
Ouvrage ultrieurement paru sous le titre : Hymnes aux Kilf,
la roue des nergies divines. Public. I.C.I. N 40, Paris, 1975.
P. 4, note 2. Lire :
L 'nergie de la Parole.
P. 14, 5c ligne
(vikalpa).
P. 19, note 4. Ajouter :
Article repris dans le numro 3 de la nouvelle srie d'HERMS:
Le Maitre spirituel selon les traditions d'Occident et d'Orient. ditions
des Deux Ocans, Paris, 1983, pp. 122-138.
P. 36, note 3. Lire
du Ho-ts.
P. 78, verset 3. Lire :
Lorsque ni Toi ni Soi ne sont perus, ce qui est peru, c'est
uniquement Toi.
'4i1:a:\Qtt1!i+116flltl tm!l r
A4i(\iU(l\ialQqf gqqm n t li
11 ft .tctl(:&il'fid: 1
snfft:1 n
Rd' 9 q"t: 1
tmfq ll Il
u " m ,
itlt4 CCaril1t?t<f ont: Il 'd li



ttiCf'<HitR:a U
q(t=Wc,. 1
"' tceWilEtt iaiwu'l t.n n n
1
t=q,1RfiEfttuit(ii1c4

q(+UQiil+tU 1
it ;J;rc(lqq(liltf 51k.t1f)a
"' fnrnl1q<+t1 11 ' 11
tf '
(Traduction p. 32-33)

'l)rft 'm' d
ftttT CftQMq\ttafti 1.
'1tRcQ UT 9"16l&IC(it:I
tu
f@40:111r 1C1e1aita\lol
Mt111tcsfq lla45qa1ai ficH'(4114M: 1
Q.: Phi
11t=a 'Rd f441!CtNCfii( u u
q) UllC'*
1

\1T1t q( f1ltml " u \ u
tt
!I'f tn ttitm -nr firn
tit11:
uN1d ff; "'"'itd'l ll V li
-t
(Traduction p. 38)
..
1
NWiqfic"au u t u
N .. tctGqUlvtt 1
t-1 Il Il
@iMPt mmw P 11 1
' ii
srt in JI'qttai1t ,
u v u
f<s41Rsllfw: 1
fl'S'tiilidwiffq-"''"'-" u \Il.
l
u , u
1
11111 m " 1l
QNrnc *'a<tiH=111;wacn
f;tif\4Ht'( n (; n
mtlf qif a(t("'q ,
'd firPtfQI l,.t4"'C'lt: li ' H
1w1\M11t fii'*"!J&* 9'1'i1imaM\tt 1
trRf 'AR n to u
@4'4'P(' 1
(Traduction p. 48-49)
TABLE l>ES MATlHES
lNTllO 1) UC'l'ION ... , . , , .............
BUDHAP_.41\'CADASIKA:
Texte sanscrit ...........................
Quinze stances sur 'la Conscience, traduction .......
Commentaire ..............................
J-> ARAMARTHACARCA:
Texte sanscrit .............................
Qute de la .Ralit ultime, traduction .........
Commentaire .............................
A.NUBHAVANIVEDANA:
Texte sanscrit ...........................
Ofrande de l'exprience intime, tradudion ......
Commentaire .............................
JJHAIRAVASTAVA:
Texte slnscrit ...........................
gloire de l' Absolu, traduction ......
( .. ommenta1re .........................
ANUTTARASTIKA:
Texte ........................ :
Huit stances sur l' Incomparable ...........
Co m n1e n taire .................
PAHA.MRTHADVADASJI(:
Texte sanscrit ..............
Douze stances sur la Ralit suprme, tratludion ... :
Commentaire .............
1\.IAHOPADESA V IMSA TIKA:
Texte sanscrit .. .......... .
La Vingtaine relative au grand Enseignement, trnduction
Commentaire ................
DEHASTHADEVATCAKRASTOTRA:
Texte sanscrit ...................
Hymne la louange de la roue de8 divinits situes
le traduction .......................... .
Con1n1cnta1re ......................... .
31
32
34
37
38

48
50
52
i!,...
u;J
67
70
76
78
81
85
87
89
Sigles. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98
Table des sujets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99
Index sanskrit ........... ..................... _. . . . . . . . . . 101
Rectificatif ............................................. 104
Hymnes en Nagar . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . l 05
Rimpression Imprimerie F. PAILLART, 80100 Abbeville
N d'impression : 6678. Dpt lgal : 4e trimestre 1986.
Fasc. 32. BUGAUL! (G.). - !--" notion de prajiiii ou de sapt'nce selon les
perspccmes du Mahayiina, 1968, 289 p. (rimpression 1982).
Fasc. 33. BOURGEOIS (F.). - Vensamhiira. Drame sanskrit dit et traduit 1971
245 p. . .
Fasc. 34. \AILLAT (C.). - Ca11dii1tjjhaya. Introduction, dition critique, traduc-
tion et commentaire. 1971. 162 p.
Fasc. 35. MALLISON ( F.). - L'pouse idi!ale : la Siit-Gtii de Muktiinanda,
traduite du gujarat, 1973, xix-185 p.
Fasc. 36. PEDRAGLIO (A.). - Le Prabodlwcandrodara de Kr.mamisra. Texte
traduit et comment. 1974. 408 p.
Fasc. 37. MAXIMILIEN (G. ). - Sure.frara. La dmonstration de 11011-agir ( Nai.rkar-
myasiddhi. Introduction et traduction. 1975, 102 p.
Fasc. 38. PAD0!-1X (A.). - La Partrsikiilaghmrtti de Abhinaiagupra. Texte
traduit et annot. 1975. 138 p.
Fasc. 39. PARLIER (B.). - Le Gha{akarparavfrrti cf'Abhinamgupra. Texte traduit
et comment, 1975, 103 p.
Fasc. 40. StLBURN ( L. ). - Hl'mnes aux Kiil. La mue des nergies dii'ines. 1975,
214 p. (2c dition corrige 1995).
Fasc. 41. MtMAKI (K.). - u1 rflllation bouddhiqz de la permanence des choses
( sthirasiddhidz.ra11a) et la prelll'l' de la de.\ choses (
hlzwigasiddhi). 1976. 333 p.
Fasc. 42. MALAMOUD (Ch.). - Le sviidlniim. rfritation paso1111elle du Veda.
Taittirm-A-ranraka. Livre Il. Text traduit et comment. 1977. 249 p.
Fasc. 43. (A.). -Les co11ceptio11s p.\yc/wlogiques dans les textes mdicaux
indiens, 1978. xv-291 p.
Fasc. 44. HUI.IN (M.) .. - Le principl' de /'ego dans la pensfr indienne classique. i
notion 1978. 376 p.
Fasc. 45. PORCHER (M.-Cl.). - Figures de style en sanskrit. des
alw!1kra.vcstra. de pohnes de J 1ika{tdhmri11. 1978. 421 P
rase. 46. Sn:RNBACH ( L. ). -- sanskrite conscrrfr dam les a111h11/ogies cr les
inscriptions. Tome 1. de Amsudhara Ghoraka. 1980. txxm-265 P
Fasc. 4 7. SILBUR!'; ( L. ). - Sfrastra :., J 'i111ar.vi11 de K.ycmarcja. Traductilm et
introduction. 1980. v111-l 95 p.
Fasc 48. BALBIR ( N. ). - Diintistakakatlu. Recueil jana de huit histoires sur le
don. Introduction. didon critique. traduction, notes. 1982. xxrn-261 P
Fasc. 49. ( L.). - Pohic sanskrite conscnfr dans les anthologie.\ et les
inscriptions. Tome 11. de Cakra Mauni Rariganatha. 1982. xu-477 P
Fasc. 50. YAGl(T.).- 1984,v111-l46p.
Fasc. 51. ( L. ). _ Pohic sanskrite consen dam les antlwlugies et les
inscriptions. Tome 111. de Yarytpyaka Hcvidhanesora et annexe. 1985.
XLIII-416 p. .
Fasc. 52. BLOCH (J. ). __ Recueil d'articles /90f>-ICJ55. Textes rassembles par
Colette Caillat. 1985. xxxix-559 p.
Fasc. 53. NAKATANI (H.). __ Udiiiwiarga de Suha.\'i. du
sanskrit sur bois provenant de Subasi (Bibliothque Nationale de Pans.
fonds Pelliot). Tome 1: texte. 1987, 110 p.
Fasc. 54. NAKA"fANI (H.). _ Udnmt1rga de du
sanskrit sur bois provenant de Subasi ( Nationale de Pans.
fonds Pclliot). Tome Il : planches et fac-s11111les. 1987. 41 pl.
Fasc. 55. Dialectes dans les litthatures imlo-arre1111cs. Actes du Colloque Interna-
tional organis par l'UA 1058 sous. les auspices du C.N.R.S. Ouvrage
dit par Colette Caillat. 1989, xv-580 p.
Fasc. 56. Rost' (A.). G. LI'TARI> et P C'oRDIER. Tral'llux sur /'histoire de la
mdecine indienne. 1989. cxx11-6 l 6 p.
Fasc. 57. STAAL ( F). Jouer mec le feu. Pratique et t/uiorie du rituel rt;diqut',
1990. 116 p.
Fasc. 58. SILBURN ( L. ). -- Spandakcrik. Stances sur la 1ibm1io11 de J 'asugupta et
leurs gloses. Introduction et traduction. 1990, x-220 p.
Fasc. 59
1
KAPANI (L.). - La notion de Sal?lkiira dans 1'111de brahmanique et
bouddhique. Tome I, 1992, 314 p.
Fasc. 59
2
KAPANI {L.). - La notion de sa1?1kra dans /'Inde brahma11ique et
bouddhique. Tome II, 1993, pp. 315-600.
Fasc. 60. NOLOT (E.). - Rgles de discipline des nonnes bouddhistes, 1991, x:x-
549 p.
Fasc. 61. BERHAMMER (G.). - La dlivrance. ds cette vie (Jl'Onmukti), 1994,
133 p.
Fasc. 62. Bouy (Ch.). - Les Ntlw-yogin et les 1994. 146 p.
Fasc. 63. PADOUX (A.). - Le cur de la Yogin ( Yoginl11:daya), 1994, 430 p.
Fasc. 64. RUEGG (D. S.). - Ordre spirituel et ordre temporel dans la pe11se
bouddhique de /'Inde et du Tibet, 1995, 172 p.
Fasc. 65
1
GERSCHHEIMER (G.). - La thorie de la signification che= Gaddhara.
Tome 1, 1996, 320 p.
Fasc. 65
2
GERSCHHEIMER (G.). - Lt1 thorie de la signification chez Gadiidhara.
Tome Il, 1996, pp. 321-632.
Fasc. 66. AeHINAVAGUPTA - La lumire sur les Ta111ras. Le Ta11triiloka d'Abhina-
l'agupta, chapitres J 5. Texte sanskrit prsent, traduit et annot par L.
StLBRUN t et A. PADOUX, 1998-2000, 320 p.
Fasc. 67
1
CHENET (F.). - Psyclrogense et cosmogonie selo11 le Yoga-Vsif!ha. Le
mo11de est dans /'me. Tome I. 1998, 350 p.
Fasc. 67
2
CHENET (F.). - Psydrogense et cosmogo11ie selon le Yoga-Viisif !ha. Le
monde est dans /'me . Tome Il , 1999, pp. 351-748.
Fasc. 68
1
FussMAN (G.), MATRINGE (D.). LLIVl.ER (E.). PIROT (E.). - Naissa11ce et
dclin d'une qasba : Chanderi du X" au XVII!" sicle, 2003, 385 p., 20 fig.
dans le texte et 115 pl. dont 20 en couleurs, totalisant 223 ill.
Fasc. 68
2
. SHARMA (K. L.). - Clwnderi 1990-1995, 1999, 124 p.
Fasc. 69. GAUI?APADA. - L'gamaStistra. Texte, traduction et notes par Ch. Bouv.
2000, 432 p.
Fasc. 70. VtVARD (L.). - Vacuit ( siinyatii ) et compassion ( karum) dans le boud-
dhisme madhyamaka, 2002, 340 p.
Fasc. 71 . Swt.:NNEN (Ph.). - D'Jndra Ti.i:trya. Portrait et l'Olution du c/1eval sacr
dans les mythes indo-iraniens anciem. 2004, 424 p.
Fasc. 72. FUSSMAN (G.), KELLENS (J.), FRANCFORT (H.P.), TREMBLAY (X.). - Aryas,
Aryens et Iraniens en Asie Centrale, 2005. 346 pages et 23 planches hors-
texte.
Fasc. 73. - Le S01?1khyiisamuddefa du Viikyapadiya (VP 3.11) (tho-
rie du nombre) et son commentaire le Prakrnakaprakiifo par Heliirja.
dits. traduits et comments par P. HAAG. 2005, 273 pages.
Fasc. 74. JAMISON (S.). - The Rig Veda bet1ree11 Two Worlds /Le fJ.gl'eda emre
deux mondes (Quatre confrences au Collge de France en mai 2004), 2007.
172 p.
Fasc. 75
1
ANGOT (M.). - a1ec le commentaire de Sd1!1kara.
Texte. traductions et notes. Tome I. 2007. 1-508.
Fasc. 75
2
ANGOT (M.). - aiec le comme11taire de Sa1!1kara.
Tome Il, 2007, 509-839.
Fasc. 76
1
FUSSMAN (G.). - avec la collaboration de B. MuRAD et E. OLLIVIER -
Monuments bouddhiques de la rgion de Caboul I Kabul Buddhist Mom1-
me11ts, Il, vol. 1. Inventaire et descriptions, 2008, 186 p.
Fasc. 76
2
. FUSSMAN (G.). - avec la collaboration de 8. MURAD et E. OLLIVIER -
Mon11me111s bouddhiques de la rgion de Cubuul I Kabul Buddhist Monu-
ments, Il, vol. 2, Planches, rsums et index. 2008, pp. 187-375 dont 97
planches (14 en couleurs).
Fasc. 77. MATRINGE (0.). - Littrature. histoire et religion au Panjab. 1890-1950 I
Panjabi Literature, History a11d Religion, 1890-1950. 2009, 221 p.
En l-ente chez
DE BOCCARD, DITION-DIFFUSION
Il , rue de Mdicis, 75006 Paris